3TSUA

Crystal structure of e. coli hypf with amp-pnp and carbamoyl phosphate
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
646
structure length
646
Chain Sequence
b'QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 209
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tsuA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsuA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsuA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tsuA01
3TTDA 3VEXA 3VEOA 3VENA 3VF4A 3VTHA 3VEZA 3VETA 3TTFA 3TSPA 3TTCA 3VESA 3VERA 3VF2A 3VEWA 3TSQA 3TSUA 3VTIA
chains in the Genus database with same CATH superfamily
4W5OA 3IDHA 1IBMK 2FSNA 3VGLA 3ZLJA 1UAXA 1DEJA 1OVQA 2UXBK 4KREA 3LALA 2I7NA 2QA4N 4CK2A 4DSFA 4WQ4C 4AHCA 1ZXOA 1YHQN 3OYLA 4N47A 1SKWA 3G10A 3KK7A 5JS1A 5HL7L 5LMNK 1D8YA 2A41A 4CEZA 3CMAN 3CM5A 3RRGA 4Z0UA 2RPIA 4K88A 3PX6A 4FJJA 1UA1A 1YAGA 3HSTB 4K8ZA 3OYDA 5HOOA 3P31A 5F1XA 1VQON 3CJCA 3C7NB 5AQLA 3ZYYX 4B1VA 3M8SA 3SAGA 2KFNA 4WFNL 1T03A 5DM7L 2WBNA 1BGXT 1S1WA 1IKYA 4BG9A 1N33K 4OKEA 3OS1A 4JI0K 1U47A 1JLFA 3O5BA 4CHZA 1JO0A 3SI6A 4YOWA 1XMOK 1NK0A 3QB0A 4OKKA 3D6RA 4FLYA 3O9UA 3FZFA 2CRQA 3GG4A 3PLAA 1SAZA 2HBKA 1J53A 4JK7A 3TTDA 3ZIEA 4X65K 4ELUA 5CYMA 4OX9K 4FK4A 3QEWA 4HTLA 4O55A 4QS8A 3OY9A 2P9IA 1FK9A 4Y1DA 1XHZA 3JXUA 3SZ2A 3HVRA 3O80A 3KVGA 4Z4GA 3JAMO 3NGIA 4JI6K 1NOZA 1WSHA 4B1YB 3ZSYA 1XEZA 4CHNA 1Z25A 2F96A 3TPQA 3H1QA 4JKAA 1RBUA 4N56A 4YDUC 1J9AA 4Z4FA 2FSJA 3QIOA 4BRMA 4CJEA 3KK1A 3QNNA 2BE2A 4IEEA 4E1MA 1C1CA 3OYHA 4B3SK 3DSDA 3LS6A 1H4TA 4DV3K 1Q8IA 3OJSA 3S9HA 3G25A 1HJRA 1L5UA 1RBRA 2LXRA 4LF7K 1XHXA 3LDNA 4A59A 2HHQA 3SLCA 1NGCA 3FZHA 2D1KA 3LM2A 3BGRA 2ZE2A 1YJWN 3U4LA 3KJVA 1QQCA 3MECA 5M1OA 3CCUN 3RMDA 1NJ8A 3VEXA 3F9KA 1SKSA 1YXQA 5AQZA 3NGYA 1QQOA 1D9FA 1G15A 2R7YA 2UUCK 5EY4A 4F3OA 2D0OA 1IJJA 3PIPL 3O1BA 4A61A 3TOEA 1RQ8A 1G58A 3ATUA 2OTLN 4QS7A 2A1RA 4KAZA 4BR4A 4CFDA 1JCUA 4IG0A 1YT3A 1EXQA 3A5MC 3OS0A 1RBTA 1TL1A 5JS2A 1WBDA 4M7YA 1WLJA 4WF9L 3KLHA 3TAQA 2Q3SA 4EO0A 1QS4A 5E26A 2Y1JA 3E9PA 4BG8A 5KQ8A 4KHWA 5J2MA 4J2BA 2H3GX 1QSSA 1HPZA 2OANA 4IO9L 3NE6A 4I9QA 1BWFO 3THVA 4FJKA 1ASVA 1B9FA 1HNIA 1HKCA 1YJ9N 3CCEN 5T7BA 3OBYA 4CJSA 5C2FA 2W42A 3LL3A 5GAGP 3CHWA 3OBWA 1EKEA 2ZM6K 1S6QA 1EO1A 4AQYK 1TK5A 3SQ2A 3HPGA 4WFBL 4AM6A 4I7FA 3TWHA 3MEDA 3HM9A 4WYBA 3VQ4A 3L6QA 2E20A 5KTQA 4DSLA 1IEZA 2YHAA 1X1PA 3LP1A 3DAWA 4FOIA 3O3HA 2BKYX 3BF3A 4UY8O 4H0TB 1RT6A 3R8EA 3QERA 3SUNA 3ENBA 5JLFA 2Q1NA 3J81O 3H6EA 2O8BB 2G8WA 3NMUA 2O8EA 3F5TA 3CJBA 3NH1A 1WSFA 1S6PA 3QEPA 4DFKA 4KH4A 3C6TA 3VQ7A 2JWKA 2WC9A 4EP5A 2VWKA 5AQYA 1RBVA 4B8CA 3LP3A 1VQ6N 5AQRA 1EP4A 3DXMA 3BY5A 3NVKA 1ITGA 1HC7A 4FFJA 3SMPA 4BR7A 4F9OA 4FWNA 1TUUA 4I2QA 1VSFA 1JJ2M 5A2QO 1ZBHA 3MDQA 1NKCA 1YIJN 3CCMN 3J7AP 1JDQA 1WN7A 4DB3A 3LQUA 3DI6A 1W0HA 2IVPA 2QWPA 1JXBA 2YNGA 1CZBA 4KKOA 4KHYA 1NK4A 4HVJA 3L2QA 3VESA 2GUPA 4FO0A 3AA3A 1KVCA 4AHSA 3TAPA 1S1TA 2E4LA 5FPEA 1R0AA 5KQDA 4FLZA 1HX1A 4M41A 5KPTA 3A5NC 2VYPA 3CCJN 1M1KO 1LWFA 3L7VA 4JI7K 3T1IA 2PAVA 1VK0A 1VSKA 2YHXA 2YNHA 3H08A 1NH9A 3DLHA 3I0SA 3T69A 3DXKB 3UKRA 3ZEUB 1OH7A 5JMVA 1NWKA 3ZX3A 4Z4EA 1VRTA 1NG9A 1HQEA 4OO1J 3S3OA 4NLCA 3J80O 3H07A 1NK6A 2KHOA 1YVNA 1NKBA 3U6YA 3ZCMA 3I8DA 1Y2IA 1VQ7N 1HPMA 2F7TA 3K58A 3VEVA 4YFUA 5LMUK 4KRFA 3SUQA 4BR5A 4EHUA 5GAEP 4M3WA 3TR8A 4CHOA 2W40A 1QQNA 3CFPA 2UXCK 2HHUA 3LDLA 4E7JA 3TAEA 3CETA 1LW2A 3JYTA 2DFFA 4LH4A 2CGKA 4B3OA 3VEYA 1TKDA 4U67L 3QEIA 4DG1A 1S8EA 2M71A 1EX4A 4I6MB 1Y64A 1EWRA 3SQ4A 1WAFA 4E7IA 4JD2A 3QNOA 2P9SA 3VF4A 5D3GA 2O8DB 2OYQA 1BCOA 4CD3A 4DLEA 4M3YA 5AQIA 5AQKA 4NCBA 3C6HA 4IO8A 1C0GA 2GV9A 4JKBA 2BUPA 5FROA 4JKCA 1NJ2A 4CJQA 3OA9A 1JLBA 5FPDA 2O4IA 1YTUA 1BISA 1KQSM 1NMDA 1XQSC 4O5FA 1ZBIA 4DR7K 2HF4A 5AZIB 4H4MA 4Q15A 4C8NA 5JVGL 4K25A 5AQVA 1HRUA 4EAHD 5LL6Z 4KHQA 2Z1IA 4FL9A 4P8EA 4RW4A 3SBTA 3J8AA 2FLOA 4CFCA 1Q9XA 2QKKA 4TWAA 3DLGA 2E2QA 3HP6A 4ZTFA 1NKEA 2RF2A 3AVBA 2G8KA 1L3TA 4Z4IA 4ILHA 3V9SA 3THYB 1LWEA 4ZTJA 3AVGA 5GINA 1U4BA 2F8SA 4IDKA 3T1AA 2GX9A 4CE9A 3W3DA 3AY9A 5SWMA 4AF1A 1T8EA 3ZT3A 4CEEA 3UB5A 1RDWX 1FW6A 1SS6A 3VOVA 4CGFA 4O8UA 2QWNA 3FLCO 4IOAL 1HNXK 5DK5A 1H4QA 2QXLA 4FW1A 1TKZA 4YOYA 3DOLA 1VSHA 2UYTA 1BCMA 1RTHA 3PIOL 4BRHA 3ALYA 1BA1A 1G99A 2P9PB 4HHTA 3CFRA 1P90A 2NRHA 2RHKA 3SAHA 2Y1IA 4PWDA 1LV5A 2A5XA 2O8FB 4Y0WA 4DTUA 3ZX2A 2FXUA 4QCLA 3ENHA 2KFZA 4B9UA 5KRSA 2E1YA 4FM2A 4B9NA 1NJXA 4LFBK 1RFQA 3BF1A 2BDPA 3DLEA 2YHBA 3CCSN 2HHSA 4ILJA 3VQ9A 2G8FA 3TU5A 4LY7A 3L0QA 3P39A 1IBKK 5C0YA 4FLTA 4CBUA 5J2PA 4QAGA 4DQRA 3D0PA 4JKGA 4YOVA 5BPLA 1SL1A 4O0JA 5EX5A 1VQ8N 5AZJA 3O9SA 4Q5VA 1KLNA 3HPHA 5E84A 5FDLA 1D4XA 3SPZA 3ULEA 2FBXA 2RIUA 4XEIA 3KD5E 3N4PA 1BI4A 4NCAA 5FRNA 1N8RO 2P9NB 1QQMA 5E41A 4B9QA 2P9UB 3AVHA 1JLCA 1H1VA 3ZSRA 5FPNA 4CHQA 4JHDB 4J8FA 1WAJA 3LWMA 3S41A 4PUOA 5TKWA 4B9LA 3AAPA 2E2OA 1K8KA 4JRPA 4LFCK 3TSUA 5HRSA 1Z26A 2O4GA 3PSIA 3TSPA 3VERA 1Q9YA 1NJZA 1NNEA 3E01A 2IC3A 1BQMA 1QVFM 2D0AA 3L2UA 4B3RK 4J2DA 2A2YA 2WOMA 1FKPA 3CG7A 3O9TA 3CC7N 2YV0X 3ZT2A 3C7NA 5M1NA 1K7JA 3M3ZA 1BHLA 1ASUA 2RISA 4HVCA 4BDPA 5AQXA 5M1FA 4CERA 4DFMA 2KTQA 3MN7A 5C10A 3WNEA 2VWBA 4YNQA 3OYMA 3DWLA 3AO5A 3MWTA 2Q31A 4OGEA 3ZT1A 1TKUA 1IKWA 2DFEA 4GVMA 5CR4A 5EOYA 2QEXN 1X9JA 3GBTA 4BWJA 2O8CB 1GLLO 3GL1A 3U9DA 3PX4A 5IT9O 1X9SA 5EXWA 4ISGA 4DSJA 1NGHA 1KC8O 4JI3K 3BZCA 3OW2M 2Z1HA 4O44A 3RR7A 4CGDA 1QZ6A 3QINA 3O3GA 4CGHA 4E19A 2OTJN 3M6GA 3KK3A 1OKJA 3UIQA 2GUIA 3NBPA 3U8XA 2VQEK 2Q97A 4FBKA 2LSNA 4XH1A 3SYZA 2OPPA 2GWKA 4CZLA 2IS3A 2UUBK 3MN5A 4GV6A 5HRRA 1ATSA 2KLAA 3VQQA 2FC0A 4C8MA 4DQIA 4EIAA 3H3OB 3PX0A 1I94K 4M3RA 4NXNK 5C12A 3M8QA 5AQOA 3G6EN 4YDUA 4DQSA 5I42A 3JSMA 4FWLA 2L8YA 3R1XA 1LW0A 1RCHA 3U3YA 4CJ7A 1QZ5A 4FWSA 4DV4K 4BRIA 3I55N 3HSCA 3EYZA 4O0IA 3MIOA 4J2EA 4HWIA 2OZSA 4W5QA 4YOUA 3MN6A 2XRIA 2NRTA 3F73A 4BDYA 3HZ7A 3VQEA 2P9LA 3HM8A 3AARA 4FM1A 4CJ3A 1MU2A 1JLGA 4OLFA 3AO1A 3IS9A 2HOEA 4LF8K 3I56N 4CF0A 3CPEA 4WCEL 1I3AA 1BIUA 3C94A 4BQZA 3KLFA 4FJHA 4FJLA 3OYIA 3V9UA 2KW4A 4NLBA 3WXJA 1R59O 3SPYA 3LVKB 2V7YA 1NGAA 1IG9A 2FSKA 4HTUA 3THWA 3LRJA 4GKKK 1KXPA 2WUSA 4BE2A 1Q18A 1O1WA 5C24A 4CJWA 1NJWA 4F4KA 1BO5O 3CJ9A 3L3VA 4XIUA 3I0RA 4P6PA 1DTTA 4IG3A 2YKNA 2P51A 3ULDA 2A3ZA 3N4QA 2NLXA 4NYFA 3UKUB 2A6AA 5AQHA 2ATQA 5AQNA 3SV3A 4E1NA 1YUWA 3FFKB 4H4OA 3D7EO 3CQ8A 2P9KB 4CF1A 4O5BA 2IFEA 4DTSA 1C1AA 1HYZA 5KPRA 3LPTA 3NFAA 4ICLA 2EWSA 3AA5X 4B1WB 3DLLL 3U6FA 2IOCA 2B5JA 4JRQA 1J5EK 4K43A 2H9UA 2NNWA 2HB5A 1RDCA 4IJAA 4AHRA 3ZSXA 2YHYA 2YHWA 4FLVA 1YTAA 1U2VA 3HBTA 4MFBA 3AA2A 4FWRA 3G4SN 1A5XA 4PL8A 4O8KA 3IRXA 3RWUA 2ASOA 3HL8A 1N36K 5AFUA 3O4NA 4AHUA 5J2QA 3C6AA 4CIGA 2O8BA 2X78A 3K0SA 1EETA 1GLCG 1ZBSA 4BACA 4BY9C 4FJ7A 4YKEA 1ZBUA 3P5JA 3UE5A 1KFDA 2IDOA 4IZ9A 4NZRM 1RDAA 2V7ZA 1U49A 4LD0A 4KTQA 4A5BA 3A8YA 4CJFA 3IKMA 4BGAA 4HUFA 3CJAA 4BE1A 3TANA 3U9ZA 4CK1A 2LN3A 2D4WA 1DKGD 2HHVA 3V9WA 4KH5A 1XWLA 2GTDA 4FPBA 2B4JA 4BRGA 3LANA 5H1SQ 4KI6A 1E4FT 4GKJK 1L3UA 3M8RA 4BRDA 1WUAA 3MXIA 4E0DA 5J2NA 4JKDA 5AQSA 1CLQA 1D9DA 1BDGA 1HJOA 2QWLA 2HSTA 5AQFA 4CJ4A 4DF8A 1K4LA 1VSIA 3E9LA 3LP2A 2ZJRL 4PL7A 3V1OA 1ILYA 2X6NA 4LSNA 3SJJA 4PA1A 2WONA 2QWRA 1YVUA 3WEEA 3WXKA 3OYJA 4JI8K 1E3MA 2CH5A 3DLBA 1JLAA 2GBZA 3MCPA 4X62K 1XUPO 3DXKA 3KK2A 3ZT0A 5HP1A 5M1QA 4G9ZA 2HHTA 2J4RA 4NXMK 4DV0K 4A2AA 1JKHA 3TTCA 1F21A 5LJVA 4B3TK 4DV7K 3EZWA 4YOTA 1IH7A 5ELZA 2MX1A 1RDBA 4IBNA 3OYGA 3PSFA 3VF2A 4U7BA 4FJ5A 3OHRA 1LAWA 1S72N 4DFPA 3C0BA 2HHWA 4Z94A 1U04A 3KWGA 2YI1A 4BRLA 3ASMA 1SL0A 4CFBA 3FZKA 4H5TA 1WSIA 1HMVA 5C42A 1TV6A 3V81A 1N34K 3P04A 4FVUA 3ZX0A 1EQYA 3DYAA 4LH5A 5CZ2A 5LJWA 3HXMA 4DFJA 3VPZA 3ZIGA 3DOKA 3QDKA 1VQ9N 1I39A 2Y1BA 5TKYA 2O8DA 3MK6A 3I8BA 4PKHA 3QBXA 1C6VA 3IAYA 4DS4A 4XH4A 1VSJA 4GY2B 4H0YB 5M1PA 2YKMA 1W2BM 3QICA 2IGIA 1RNHA 3ENOA 1VSDA 1RDDA 5GADP 4FVMA 1S1XA 4YORA 4ELTA 1KAZA 4CHPA 1WSGA 3ZSVA 3W0LA 4M3TA 3L2RA 2FF6A 2FBYA 4PQUA 1BIZA 1NGDA 4H0PA 4GMJB 1QHAA 2KKZA 5KGWA 4DR4K 1NJ5A 2FBVA 3VEZA 3THYA 3AO4A 3NCIA 4BROA 3WXIA 5CE3A 2UUAK 3SBGA 4DR1K 4H8KA 3CC4N 2E1ZA 4OPAA 3WXMB 3PO5A 4ZHRA 3P83D 4PKGA 3B6PA 4R79A 2JGUA 1XI1A 2F9WA 3K57A 3GOIA 4DTNA 4CECA 1NFHA 2IAJA 2P9PA 1TAUA 3AA4A 4M3XA 1TKXA 1IKXA 3SQ0A 3CXCM 4FK2A 4B9SA 3QO9A 5FRMA 3VGKA 1YITN 4M45A 3J7ZO 3DLKA 1HKGA 4BE0A 3EE9A 2NRRA 4CCHA 4P6DA 4BRNA 4CZEA 4RWTA 4OPHA 5AQJA 4AM7A 3D2EA 1XC9A 4CJ5A 2NZTA 3PY8A 2G8IA 3LP0A 1MA9B 5AFUH 2ZD1A 1ZBLA 1HR0K 3L4QA 4NCGA 4JV5K 1U45A 4KH6A 3HJFA 1YJNN 1ATRA 1PAVA 3DM2A 1GLFO 1O13A 4H5VA 4JAXA 3IALA 3DSCA 1IG8A 1MDUB 2B6AA 3AVAA 1BQNA 2OZMA 3MCAB 3THXA 2YX6A 3AGRA 3F9MA 5K14A 1OH6A 2O8EB 1NGGA 4ID5A 4YOXA 4BR9A 2XHBA 1K49A 3D2FA 5CYQA 3NDKA 4E7LA 2QWMA 3OYAA 3U3GA 1QE1A 2P9NA 4I14A 3CI5A 4N41A 3MX2A 1TVRA 2P9UA 3NGZA 3O9RA 4CHYA 2ITGA 3DXMB 2AA4A 4JHDA 3ZT4A 5BPMA 4W5NA 3CJ7A 1G57A 3RTVA 4DF4A 1W9HA 3G71N 3T3FA 1SQKA 1SV5A 1QVGM 5AR0A 3FZMA 4IFEA 1HYSA 4BRPA 3RMBA 3V1RA 1QSYA 3F2KA 1HQUA 5FLXO 2HMIA 3HYFA 2EHGA 4PKIA 1WB9A 4FJGA 2QXFA 4KB1A 1UOCA 1BL3A 1HNVA 4CF8A 2VGNA 5F2RA 3CF5L 4DSKA 3CQYA 4ID1A 1S3XA 1NU0A 3VQCA 2RKIA 3CIPA 2DY4A 3CD6N 2CH6A 4FBQA 1S9GA 4X66K 3L4IA 4FWKA 3FR0A 3QETA 2ZWHA 4CJRA 2E2PA 4JNEA 4CEBA 4RG8A 3ZETA 3CERA 1KCFA 3KIOA 1B92A 4H0XB 4DR5K 1QSLA 3FZLA 1UWBA 3MXMA 5BREA 4LF5K 4BR2A 3WNGA 4DTMA 4LF9K 5BN8A 5AJ3K 4LF4K 4I2PA 3LZJA 3K5LA 1VRUA 4R5PA 3TAFA 4FW2A 4YDQA 2WTUA 1EWQA 1Q82O 1K73O 1TIGA 1IO2A 2O8CA 2PYJA 3VA3A 3EY1A 4ISFA 4JK8A 4A62A 2Q0RA 3H46O 3HP9A 5BRFA 2NRXA 1Z05A 2ZF5O 4YY3K 4CBXA 4CJLA 1CXUA 4K42A 2JLEA 1C0FA 1SUQA 3Q7CA 5GIPA 1T6DA 4DQPA 4HD0A 3T19A 3KKSA 3KTQA 3O8MA 3OYEA 3QIPA 1BUPA 2E2NA 1P8ZA 1DCJA 1GOCA 2A1SA 4CZJA 3MMVA 2G8UA 2IIRA 1HUXA 2X6SA 3MEGA 4IFVA 4WQ5C 4CFAA 3NF8A 4KHPK 3P4IA 4JD2B 3L8BA 4DR2K 3A5OC 4KB0A 3EO3A 1MWMA 3Q7BA 5M1KA 2EH1A 1Y9XA 4DTPA 3DRRA 3O1WA 4A5AA 3QFPA 3ZSWA 4FSVA 4KPYA 4M42A 4K86A 4BWMA 1NOYA 3MX5A 4H03B 4KTZA 4L3QA 1NMNA 2G8VA 3LPUA 2XY8A 1T3VA 4KO0A 4BRQA 5BR9A 3KKRA 4BVOA 4F3TA 2W41A 2F9TA 4BC2A 2Q36A 4FK0A 2QKBA 4K8XA 4OJRA 4N5SA 1GLEG 4TSXA 4OPJA 2Q3VA 5AQMA 4OVLA 3CFOA 2IVOA 1ZYQA 4EZ9A 4B9TA 5HLFA 2KZMA 4WQ4A 5AQPA 2E6LA 4DSEA 3KHYA 4Q0BA 1FKOA 3JS6A 1RTJA 3O3FA 4DTXA 4MQ3A 4F2RA 1HNZK 4YHHK 4RTFD 1X9WA 5I3UA 4FZXC 3EKUA 2P1JA 4KV8A 4OLAA 2DPNA 4JKFA 1TKTA 2VQFK 3O4QA 2YNIA 5KPZA 5KRTA 4HVZA 4BGBA 1CZ9A 4GNIA 2HVIA 3K2PA 4DU3A 3R9PA 3TI0A 3HK2A 2KQ2A 1ASWA 1VQNN 4FZYA 3ZSOA 3CCQN 3NHGA 3RSEB 2QK9A 2PYLA 4WI1A 2XY6A 1L3SA 2DFHA 1VSMA 2HNDA 2QTDA 1MWKA 4LF6K 1KVBA 2W6KA 3K5OA 5JICA 2BTFA 3FGUA 5CY4A 4FYDA 4B08A 3PUFA 5HRNA 3BDPA 2CGLA 3TABA 1HYVA 1NJ1A 3AVNA 1IV0A 3D45A 1BA0A 4JKGB 3A5LC 3H3NO 2V52B 4FWPA 4EP4A 4FWQA 3T7ZA 3ISNC 5EVZA 5AZJB 4FCYA 4IWVA 4MDBA 3VQ8A 4KFBA 2F4VK 1VM0A 3S3NA 3VQ6A 1T7PA 2OPRA 4KHNA 3ULEB 1S1UA 4N76A 4FJNA 4XH5A 4P77A 1BI4B 4JYAK 3V1QA 4NO7A 4DU4A 3AVKA 4JLHA 2D5RA 3C95A 2EX3A 3BP8A 5BRHA 4OGCA 4CEAA 3LDOA 4FLWA 4B3MK 3B6OA 1TYQB 5C15A 1KLMA 2ZJPL 1XMQK 2ITMA 2EK0A 4QOZB 1T05A 2X74A 4CEQA 3EE8A 3E1YA 1S1VA 4O4GA 3CCRN 3K9KA 3C65A 1K8KB 1LAVA 1NGFA 3SUPA 4CIFA 1K8AO 3ID6A 4DMNA 3OYKA 4DWIA 4IOCL 2PY5A 1OH5A 1NK9A 2D0PA 1K4PA 4FM0A 2FF3B 3IABB 4C1NK 1TAQA 4H5WA 3RMAA 4B9MA 2ETJA 4DTOA 3QBWA 4JK9A 4H5RA 1DLOA 1WNSA 1XC3A 3OS2A 3ZSQA 2HNYA 4KTWA 1JCGA 3OYBA 3VN5A 1TL3A 4AH9A 2P5OA 4CJVA 1VR4A 1IBLK 4CJPA 5KGXA 3E9OA 4FLXA 1K4OA 5GIOA 3CC2N 3J7YP 3S3MA 1RTIA 3NAEA 4DR3K 5BN9A 4OPKA 2CGJA 4CJTA 4FJ9A 1RT7A 3TAMA 1NJYA 4C1NI 2XY7A 1J6ZA 4EFHA 2PZSA 4ELVA 3LVJC 3VGMA 2OA8A 3KD1E 3VENA 4BRCA 4M63C 3DRSA 3NF7A 3ITHA 3KLEA 1H0XA 1GLJO 4DUZK 2ASPA 2RE2A 3VEWA 4GW6A 2HHHK 5KI6A 1FJGK 2NUBA 3KWIA 5SZTA 4C8KA 2HBJA 4X64K 3M1FA 4CZHA 2NRZA 4Z4CA 3L2WA 4GV3A 5MLCQ 3NVMA 4IFYA 1X3NA 2UXDK 1IKVA 4FBWA 1VQLN 2E88A 5ADXA 3AVJA 2E5LK 4JI5K 4E89A 3RMCA 4FJMA 4B8AB 4JKHA 3LDPA 4B1UB 1Y97A 3EN9A 3MN9A 4OLBA 4K87A 4HUGA 4B1XB 4LSLA 2E8AA 4MLHA 2VG7A 1KAYA 4IJNA 1K4IA 2QW9A 3VTHA 3AGKA 3K9JA 3L3UA 3HO1A 1RT2A 4OKJA 1GLAG 4IXCA 2IVNA 1C1BA 3NF9A 2P9LB 1JE3A 2GTCA 4NZTM 5DMRA 3HI0A 1CZAN 3MK5A 4JI2K 1UA0A 4BR0A 3DRPA 3CM6A 3ZEUA 3LM9A 4RCHA 4GV9A 3CMEN 1RILA 3NH0A 2QM1A 1KK9A 1JCEA 3THWB 4PY5A 1SZ2A 1LN4A 3AV9A 4LFAK 3CQXA 1RT3A 4WFAL 1RBSA 3R3LA 1Q7YO 3IG1A 2HW3A 3QFUA 3LAMA 3TTFA 3PO4A 2P9IB 4CZIA 1WOQA 5C2DA 1JCFA 1VSEA 4A57A 4E1JA 3BEXA 1VAZA 3WNFA 1B9DA 1LOTB 4DHYA 4DQ8A 2QWOA 2A42A 4M3ZA 4MLEA 3HZ6A 1KVAA 3LDQA 3WUHA 3T1HK 1RT5A 2Q0UA 4A2BA 3OYNA 1S9EA 2YCHA 3HPOA 1SL2A 3QMLA 4IEIA 4CEOA 3P38A 5JVHL 4BRKA 2WFBA 4I6MA 4FXDA 3CYMA 1XNRK 2ZQBA 2KZZA 1U2VB 1SNNA 1WSJA 3HOSA 3WNHA 4L8RB 1HRHA 4CJKA 4CEDA 4Z4HA 4WE1A 3V4IA 1Q81O 2Z1JA 4FLUA 1PVYA 1TK8A 1BU6O 3NH2A 4FJ8A 1M90O 2I7PA 2A40A 1XNQK 5BRDA 4IDHA 4DLGA 1W97L 4M3UA 1ZBFA 3VQDA 2DTUA 2QI2A 2OCEA 4BREA 2ZGYA 3LZIA 2D0CA 5AZIA 3OYCA 3MWPA 2I5JA 4JS4A 4K41A 2HBMA 2HNZA 1KFSA 2HVHA 1KD1O 1DGKN 1NGIA 4CK3A 4CVNE 1BOTO 3V9XA 1HNWK 2Q2RA 5DM6L 1WSEA 3K59A 1VHXA 1N5YA 5AQUA 4DKWA 2HF3A 1HLUA 1X3MA 4C8LA 1UDVA 4E1BA 3AVCA 4KHSA 1A5VA 3I33A 2GEMA 3KLIA 1GLDG 3MEEA 5AQGA 4PHTX 1RDUA 3B8AX 4Z9EA 4G1QA 2VG6A 3WQTA 1V4TA 4NB4A 3RR8A 3HVTA 3VEOA 5EU7A 2BANA 4UQGA 3H1VX 4MO5A 3WEEB 5AQTA 1J54A 1H4SA 3OVNA 5HBMA 3DLRA 2YJFA 3CPWM 2O8FA 3SJHA 3TSQA 4RW9A 1W7AA 4CZGA 4CZKA 4RW6A 2BH1A 4CBWA 4QS9A 4FJXA 4RW7A 3WBMA 1JLQA 3VQBA 5C25A 1NM1A 4DCHA 3AVMA 3HTVA 3EZ5A 3AO3A 1TUYA 1U6ZA 4CGJA 3VQAA 3K5MA 1WBBA 3HRGA 4Y1CA 3OYFA 1KTQA 4CGGA 3SNNA 2PFUA 4BVPA 5F0XA 4DV6K 3AVLA 3G0ZA 5BR8K 1V4SA 4DS5A 3EEQA 1NK8A 3C6UA 3KZBA 5ADXH 4KHUA 5IWAK 4MDAA 3ZIIA 3KLGA 1NGJA 3RRHA 4C8OA 1JXEA 3BUZB 3M8PA 3HOTA 4BDZA 1JL2A 3SK3A 1TKSA 4B9VA 4DV2K 4W5RA 3E66A 2NRWA 3O6WA 1REVA 2OPQA 4BC3A 2E6MA 2GELA 1CXQA 1VQ4N 2FBTA 4JI4K 3V9ZA 3MGZA 2HMPA 3AVFA 4F2SA 3VMFB 1GOAA 4WQ5A 4CGIA 3CCLN 4ILGB 3QEXA 1N6QA 1VSLA 1GOBA 4K0KK 1NJ6A 4JN4A 3AO2A 3TARA 4CI6A 1RT1A 5BPNA 5I9EB 2EQAA 1OVYA 1S22A 4CESA 4BRAA 4DQQA 4BQLA 2Z1GA 5CZ1A 1C0MA 4FCXA 4NCXA 3LAKA 2P5GA 3P1GA 3L2VA 4DR6K 5J1EA 3WQUA 4CW7B 3SAFA 5HROA 4FWMA 1RT4A 3UKRB 3DMJA 2PBDA 1JL1A 3A2FA 1VQPN 1RGIA 3DJCA 3FFIA 4LC9B 1KAXA 4IOXA 1VQMN 3ID8A 4AHTA 3EKSA 4KI4A 1TK0A 2P9BA 3RSEA 1FXXA 3ATVA 3K5NA 2XY5A 4BC4A 1KRPA 2F8TA 1K9MO 4CJUA 3QLHA 3RVCA 3QKBA 3SV4A 3ZIHA 3IUCA 5AQQA 1NGEA 3D2EB 3T1YK 3H45C 4M7XA 3O08A 4IKFA 4HCCA 2ZGZA 1K6YA 3VQPA 3ZSZA 2UU9K 1OH8A 2ZJQL 3IMXA 2HBLA 2AJQA 4CEFA 1TGOA 4I9LA 1RTDA 4CF2A 1NBWA 3R6MA 4CIEA 4HCBA 1GLBG 4DTRA 5GAHP 2P9SB 4DUYK 3OTOK 4W5TA 2W6LA 3THXB 4RW8A 3FE1A 3V6DA 4P6CA 1NFJA 2NRVA 3AJEA 3D2FB 2Z7CA 1A5WA 4DSIA 4FWOA 2HHXA 1S5JA 1TYQA 3PV8A 1DT9A 1H0YA 1NLVA 5HRPA 1Z6RA 1BG3A 2JWLA 3VA0A 3NF6A 5CHIA 2VG5A 2QWQA 3SCXA 3O4WA 5LY3A 1C0TA 3QEVA 4HUEA 4DTJA 4NYNA 1Q86O 1LCUA 1JLEA 1U48A 1SKRA 1T6CA 5JLHA 4P8JA 4BC5A 4DV5K 2YNFA 4ISEA 2OPSA 2VGMA 4FZZA 3IABA 1ZC6A 1D5AA 4J2AA 3A0IX 3WXLA 4H0VB 4JS5A 3VTIA 2ASMA 4JKEA 3LWLA 4H5NA 1C0UA 2BGGA 2YJEA 4CZFA 1L3VA 4V19S 3OJUA 4GVEA 3QESA 5B8HA 1ESVA 4B1ZA 4EZ6A 4DU1A 3VF6A 4MO4A 1II7A 1ATNA 3WT0A 3ZETB 1YI2N 1QTMA 1T44A 3UKUA 2D0BA 1X9MA 3GDQA 1YF5L 3CCVN 2P9KA 1VQKN 1DTQA 3HT3A 4E3SA 3SQ1A 1KSPA 3SMSA 1N32K 3MAQA 3VETA 4AHVA 3AAQA 1QHTA 4CD1A 4BRFA 1LWCA 4E7HA 4FOEA 3MXJA 4CZMA 5AQWA 4FPAA 4JEPA 1VQ5N 1NJIO 4E7KA 2AP1A 3AVIA 1NK5A 4FJIA 2GWJA 2VWJA 4JI1K 3GE1A 4H0OA 1E4GT 4CF9A 3EL2A 3SUOA 3M5RA 3VQ5A 3TAGA 1NGBA 3LDSA 4DV1K 1J5OA 3IFRA 4KBOA 1PVWA 4EHTA 1NK7A 2G8HA 2XO7A 4C23A 2V51B 4F8RA 3BZKA 2RN2A 3CJ1A 5FPMA 3O9QA 2VCPA 4AILC 1HKBA
chains in the Genus database with same CATH topology
3IDHA 2FSNA 4JKGA 4YOVA 4NZTM 2P9PA 3VGLA 5BPLA 5EX5A 1DEJA 1VQ8N 3HI0A 2QA4N 2I7NA 1CZAN 3CXCM 5AZJA 3MK5A 3O9SA 4WQ4C 1ZXOA 5E84A 3VGKA 1YHQN 1YITN 1D4XA 3J7ZO 4BR0A 1HKGA 3KK7A 3EE9A 3ZEUA 3ULEA 2NRRA 5HL7L 2RIUA 4XEIA 2A41A 3LM9A 3N4PA 4RCHA 4GV9A 4P6DA 3CMEN 4BRNA 4CZEA 4RWTA 4OPHA 3CMAN 5AQJA 4AM7A 3D2EA 2QM1A 1KK9A 1N8RO 2P9NB 1JCEA 1QQMA 2NZTA 1SZ2A 2P9UB 4B9QA 1H1VA 1MA9B 1YAGA 5AFUH 5HOOA 3CQXA 3P31A 5FPNA 3L4QA 4WFAL 4JHDB 5F1XA 3R3LA 3CJCA 1VQON 3C7NB 1Q7YO 5AQLA 3ZYYX 3QFUA 4J8FA 4B1VA 4KH6A 3TTFA 1YJNN 1ATRA 2P9IB 3S41A 5TKWA 1WOQA 4CZIA 3SAGA 1GLFO 2E2OA 1JCFA 1O13A 3AAPA 4H5VA 4A57A 2WBNA 4JAXA 5C2DA 1K8KA 4E1JA 1IG8A 1MDUB 3BEXA 4BG9A 1VAZA 3MCAB 1LOTB 2YX6A 3AGRA 3F9MA 3TSUA 4DHYA 4DQ8A 1NGGA 2QWOA 4YOXA 2A42A 4BR9A 4MLEA 3HZ6A 1K49A 3D2FA 3O5BA 3LDQA 3TSPA 3WUHA 3VERA 4YOWA 2QWMA 2Q0UA 4A2BA 2YCHA 1QVFM 3QB0A 2P9NA 3D6RA 4I14A 3O9UA 3FZFA 3CI5A 3GG4A 3QMLA 3MX2A 4IEIA 2P9UA 3PLAA 1SAZA 3O9TA 2HBKA 3CC7N 3P38A 4JK7A 3TTDA 3O9RA 3ZIEA 4BRKA 5JVHL 2WFBA 4I6MA 3DXMB 2AA4A 4JHDA 3C7NA 4HTLA 5M1NA 3M3ZA 1U2VB 5BPMA 1K7JA 4QS8A 2RISA 1SNNA 2P9IA 3CJ7A 3HOSA 1G57A 5AQXA 5M1FA 3G71N 3JXUA 1SQKA 1QVGM 5AR0A 3MN7A 3FZMA 1Q81O 4IFEA 3O80A 5C10A 1PVYA 3KVGA 4BRPA 1BU6O 2VWBA 1M90O 3F2KA 2I7PA 2A40A 3DWLA 3MWTA 4PKIA 4B1YB 5BRDA 1XEZA 2Q31A 4IDHA 3TPQA 1TKUA 3H1QA 4JKAA 5CR4A 1W97L 4YDUC 2VGNA 5F2RA 2FSJA 2QI2A 5EOYA 3CF5L 4BRMA 2QEXN 4BREA 2ZGYA 3CQYA 1S3XA 4IEEA 5AZIA 3CIPA 3MWPA 4K41A 2HBMA 1X9JA 3GBTA 3CD6N 2CH6A 4FBQA 3LS6A 3L4IA 1GLLO 3GL1A 4FWKA 3FR0A 3U9DA 1KD1O 3G25A 1DGKN 1NGIA 2ZWHA 5EXWA 2E2PA 4ISGA 4JNEA 1NGHA 1KC8O 3ZETA 1BOTO 3CERA 3LDNA 4H0XB 4A59A 2Q2RA 3OW2M 3SLCA 1NGCA 5DM6L 3FZHA 2D1KA 3FZLA 1QZ6A 5AQUA 4DKWA 5BREA 2HF3A 3LM2A 1HLUA 1X3MA 4BR2A 2OTJN 3M6GA 1OKJA 5BN8A 1YJWN 4E1BA 3I33A 2GEMA 3U4LA 3U8XA 1GLDG 5M1OA 2Q97A 4FBKA 5AQGA 4PHTX 3CCUN 4XH1A 1RDUA 3B8AX 1Q82O 1K73O 3WQTA 1V4TA 2GWKA 4NB4A 4CZLA 3VEXA 3MN5A 3VEOA 4GV6A 1YXQA 4ISFA 1ATSA 2KLAA 5AQZA 3H1VX 1QQOA 4JK8A 4MO5A 3WEEB 4A62A 2Q0RA 3H46O 5BRFA 2NRXA 1Z05A 2ZF5O 5AQTA 5EY4A 2D0OA 1IJJA 4CBXA 3PIPL 3O1BA 4EIAA 3H3OB 4K42A 4A61A 1G58A 1C0FA 3ATUA 3Q7CA 5GIPA 2YJFA 1T6DA 4QS7A 5C12A 5AQOA 3CPWM 2OTLN 3G6EN 3SJHA 4YDUA 3TSQA 3O8MA 4BR4A 1JCUA 4FWLA 3R1XA 4CZGA 4CZKA 3A5MC 4CBWA 1BUPA 2BH1A 4QS9A 4CJ7A 1QZ5A 2E2NA 4FWSA 4BRIA 3I55N 3HSCA 4M7YA 3MIOA 4WF9L 1P8ZA 4HWIA 1NM1A 4DCHA 4EO0A 4YOUA 5E26A 3MN6A 4CZJA 3HTVA 3MMVA 2NRTA 2IIRA 1HUXA 3E9PA 1TUYA 4BG8A 1U6ZA 5KQ8A 2P9LA 3HM8A 4WQ5C 2H3GX 3AARA 2OANA 3P4IA 4JD2B 4IO9L 3HRGA 1BWFO 3A5OC 3EO3A 1MWMA 2PFUA 3Q7BA 5M1KA 4BVPA 5F0XA 1YJ9N 1HKCA 3CCEN 2HOEA 3O1WA 4A5AA 3I56N 3QFPA 3CPEA 4FSVA 3OBYA 4WCEL 1V4SA 5C2FA 4BQZA 3LL3A 5GAGP 3CHWA 3MX5A 4H03B 4L3QA 3OBWA 1T3VA 4NLBA 4BRQA 3KZBA 3WXJA 5BR9A 1R59O 5ADXH 4BVOA 2V7YA 2W41A 1NGAA 2F9TA 3ZIIA 2Q36A 4MDAA 4BC2A 2FSKA 1EO1A 1NGJA 3LRJA 4WFBL 4AM6A 1KXPA 2WUSA 1Q18A 4WYBA 1GLEG 3L6QA 2E20A 1IEZA 1BO5O 3CJ9A 3BUZB 4P6PA 5AQMA 2IVOA 3HOTA 3DAWA 4FOIA 3SK3A 1TKSA 4WQ4A 3BF3A 5AQPA 4UY8O 4H0TB 3E66A 3R8EA 2NRWA 3KHYA 3O6WA 2A3ZA 3JS6A 3N4QA 2NLXA 3ENBA 5JLFA 2Q1NA 2A6AA 3UKUB 3H6EA 4BC3A 5AQHA 5AQNA 3NMUA 1YUWA 3FFKB 3D7EO 2GELA 3CJBA 2P9KB 3F5TA 4RTFD 1VQ4N 3MGZA 3EKUA 4KH4A 5KPRA 2HMPA 2DPNA 2JWKA 4JKFA 3DLLL 2EWSA 2WC9A 4B1WB 3VMFB 4WQ5A 4K43A 5KPZA 2NNWA 4HVZA 5AQYA 4BGBA 3CCLN 4IJAA 4GNIA 5AQRA 4ILGB 1VQ6N 3DXMA 2YHYA 4JN4A 2YHWA 3NVKA 3R9PA 1U2VA 3HBTA 4FFJA 4CI6A 3SMPA 5BPNA 4BR7A 4F9OA 1VQNN 5I9EB 2EQAA 1OVYA 1S22A 4FWRA 4FWNA 1TUUA 3G4SN 4BRAA 4PL8A 1JJ2M 3CCQN 4O8KA 4BQLA 3RSEB 2ASOA 3MDQA 5AFUA 3C6AA 1YIJN 3CCMN 4DB3A 4FCXA 3LQUA 1GLCG 1ZBSA 4BY9C 4YKEA 2IVPA 2QWPA 2QTDA 1MWKA 4WFNL 3WQUA 3SAFA 2IVNA 3UE5A 4FWMA 5JICA 4IZ9A 3UKRB 4NZRM 2PBDA 2BTFA 2V7ZA 3VESA 3FGUA 1VQPN 1RGIA 3DJCA 4LC9B 2GUPA 4FO0A 4A5BA 3A8YA 1KAXA 2CGLA 4IOXA 3IKMA 4BGAA 1VQMN 1PVWA 3CJAA 5FPEA 3U9ZA 3ID8A 5KQDA 3EKSA 1HX1A 5KPTA 2LN3A 3A5NC 2P9BA 1BA0A 2VYPA 2D4WA 1DKGD 4JKGB 3CCJN 1M1KO 3RSEA 3A5LC 3H3NO 4KH5A 3ATVA 2V52B 3L7VA 4FWPA 4FWQA 2GTDA 3T1IA 2PAVA 4FPBA 3T7ZA 4BRGA 5EVZA 5AZJB 2YHXA 4IWVA 4MDBA 5H1SQ 4BC4A 1E4FT 3T69A 3DXKB 1K9MO 4BRDA 1WUAA 3UKRA 3ZEUB 3ULEB 4JKDA 3RVCA 5AQSA 5JMVA 1NWKA 3ZX3A 4XH5A 1BDGA 1HJOA 2QWLA 4P77A 4OO1J 3ZIHA 3IUCA 2HSTA 4NO7A 1NGEA 3D2EB 4NLCA 3H45C 5AQFA 5AQQA 4M7XA 3O08A 3H07A 3BP8A 2KHOA 5BRHA 1YVNA 1K4LA 3LDOA 2ZGZA 3E9LA 2ZJRL 1VQ7N 1HPMA 1TYQB 5C15A 4PL7A 2F7TA 2ZJPL 1ILYA 2ITMA 2ZJQL 3IMXA 2HBLA 3VEVA 3WEEA 2QWRA 3WXKA 4BR5A 4EHUA 1NBWA 2CH5A 3R6MA 5GAEP 3EE8A 3E1YA 1GLBG 3MCPA 3K9KA 2P9SB 3C65A 5GAHP 1K8KB 3CCRN 1NGFA 1XUPO 2W40A 3DXKA 5DM7L 1QQNA 3LDLA 3FE1A 1K8AO 5M1QA 4P6CA 2NRVA 3CETA 3ID6A 4G9ZA 3AJEA 3D2FB 2J4RA 4IOCL 4A2AA 2D0PA 3TTCA 2CGKA 2FF3B 1K4PA 5LJVA 4FWOA 4C1NK 4H5WA 3VEYA 4U67L 1TYQA 1DT9A 3EZWA 4I6MB 4YOTA 1NLVA 1Y64A 5ELZA 2MX1A 1Z6RA 3QBWA 1BG3A 2JWLA 4JK9A 4H5RA 4JD2A 5CHIA 3VF2A 4U7BA 2QWQA 2P9SA 3OHRA 3O4WA 1XC3A 5LY3A 3VF4A 1JCGA 1S72N 1Q86O 3C0BA 1LCUA 4CD3A 4Z94A 1T6CA 3KWGA 5JLHA 4P8JA 3E9OA 5AQIA 5AQKA 4BC5A 3C6HA 4IO8A 1C0GA 2YI1A 4ISEA 2BUPA 4JKBA 4JKCA 2VGMA 4BRLA 3OA9A 3FZKA 1ZC6A 4H5TA 5FPDA 1K4OA 5GIOA 3CC2N 3A0IX 3WXLA 1KQSM 4H0VB 3VTIA 2ASMA 1NMDA 1XQSC 4JKEA 5BN9A 4O5FA 3P04A 2HF4A 2CGJA 5AZIB 3ZX0A 4FVUA 4H5NA 1EQYA 2YJEA 4CZFA 5JVGL 1HRUA 4K25A 5AQVA 4C1NI 4EAHD 5LJWA 1J6ZA 3VPZA 3ZIGA 4GVEA 4EFHA 3QDKA 4FL9A 3VGMA 1ESVA 4B1ZA 5B8HA 3VENA 1VQ9N 4P8EA 4BRCA 3SBTA 3VF6A 4M63C 3J8AA 2FLOA 5TKYA 4MO4A 1ATNA 3WT0A 3ZETB 3MK6A 1GLJO 2E2QA 3I8BA 4PKHA 1YI2N 1T44A 3UKUA 2ASPA 2RE2A 3VEWA 3QBXA 3GDQA 4ILHA 1YF5L 3CCVN 5GINA 4XH4A 2P9KA 3KWIA 4GY2B 4H0YB 5M1PA 1VQKN 2GX9A 2HBJA 1W2BM 3M1FA 3QICA 3SMSA 3ENOA 4CZHA 3W3DA 3AY9A 3VETA 3AAQA 4AF1A 2NRZA 4CD1A 5GADP 4BRFA 4YORA 3UB5A 1RDWX 4GV3A 5MLCQ 3NVMA 1SS6A 1X3NA 3VOVA 1KAZA 4FOEA 4O8UA 2QWNA 3FLCO 4FBWA 3W0LA 4CZMA 2FF6A 5AQWA 1VQLN 4IOAL 2E88A 2QXLA 5ADXA 4YOYA 2UYTA 1NGDA 4H0PA 4FPAA 4JEPA 1VQ5N 1QHAA 2KKZA 2AP1A 4BRHA 3PIOL 1NJIO 1G99A 1BA1A 2P9PB 1P90A 4JKHA 3LDPA 2GWJA 2NRHA 3VEZA 2RHKA 4B1UB 3SAHA 3GE1A 4H0OA 2A5XA 1E4GT 3EN9A 3MN9A 4Y0WA 4BROA 3EL2A 3WXIA 2FXUA 3ZX2A 3ENHA 5CE3A 4B1XB 3SBGA 3M5RA 2E8AA 4MLHA 2E1YA 1NGBA 3CC4N 2E1ZA 1RFQA 1KAYA 3BF1A 3IFRA 4IJNA 4KBOA 4OPAA 3WXMB 4EHTA 1K4IA 2QW9A 3CCSN 3VTHA 3AGKA 3K9JA 4ILJA 4C23A 2V51B 4PKGA 3TU5A 4R79A 3L0QA 3CJ1A 3P39A 5C0YA 4CBUA 2F9WA 5FPMA 1GLAG 3O9QA 4IXCA 2VCPA 3GOIA 2P9LB 1HKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTD A;  3VEX A;  3VEO A;  3VEN A;  3VF4 A;  3VTH A;  3VEZ A;  3VET A;  3TTF A;  3TSP A;  3TTC A;  3VES A;  3VER A;  3VF2 A;  3VEW A;  3TSQ A;  3TSU A;  3VTI A; 
#chains in the Genus database with same CATH topology
 4W5O A;  3IDH A;  1IBM K;  2FSN A;  3VGL A;  3ZLJ A;  1UAX A;  1DEJ A;  1OVQ A;  2UXB K;  4KRE A;  3LAL A;  2I7N A;  2QA4 N;  4CK2 A;  4DSF A;  4WQ4 C;  4AHC A;  1ZXO A;  1YHQ N;  3OYL A;  4N47 A;  1SKW A;  3G10 A;  3KK7 A;  5JS1 A;  5HL7 L;  5LMN K;  1D8Y A;  2A41 A;  4CEZ A;  3CMA N;  3CM5 A;  3RRG A;  4Z0U A;  2RPI A;  4K88 A;  3PX6 A;  4FJJ A;  1UA1 A;  1YAG A;  3HST B;  4K8Z A;  3OYD A;  5HOO A;  3P31 A;  5F1X A;  1VQO N;  3CJC A;  3C7N B;  5AQL A;  3ZYY X;  4B1V A;  3M8S A;  3SAG A;  2KFN A;  4WFN L;  1T03 A;  5DM7 L;  2WBN A;  1BGX T;  1S1W A;  1IKY A;  4BG9 A;  1N33 K;  4OKE A;  3OS1 A;  4JI0 K;  1U47 A;  1JLF A;  3O5B A;  4CHZ A;  1JO0 A;  3SI6 A;  4YOW A;  1XMO K;  1NK0 A;  3QB0 A;  4OKK A;  3D6R A;  4FLY A;  3O9U A;  3FZF A;  2CRQ A;  3GG4 A;  3PLA A;  1SAZ A;  2HBK A;  1J53 A;  4JK7 A;  3TTD A;  3ZIE A;  4X65 K;  4ELU A;  5CYM A;  4OX9 K;  4FK4 A;  3QEW A;  4HTL A;  4O55 A;  4QS8 A;  3OY9 A;  2P9I A;  1FK9 A;  4Y1D A;  1XHZ A;  3JXU A;  3SZ2 A;  3HVR A;  3O80 A;  3KVG A;  4Z4G A;  3JAM O;  3NGI A;  4JI6 K;  1NOZ A;  1WSH A;  4B1Y B;  3ZSY A;  1XEZ A;  4CHN A;  1Z25 A;  2F96 A;  3TPQ A;  3H1Q A;  4JKA A;  1RBU A;  4N56 A;  4YDU C;  1J9A A;  4Z4F A;  2FSJ A;  3QIO A;  4BRM A;  4CJE A;  3KK1 A;  3QNN A;  2BE2 A;  4IEE A;  4E1M A;  1C1C A;  3OYH A;  4B3S K;  3DSD A;  3LS6 A;  1H4T A;  4DV3 K;  1Q8I A;  3OJS A;  3S9H A;  3G25 A;  1HJR A;  1L5U A;  1RBR A;  2LXR A;  4LF7 K;  1XHX A;  3LDN A;  4A59 A;  2HHQ A;  3SLC A;  1NGC A;  3FZH A;  2D1K A;  3LM2 A;  3BGR A;  2ZE2 A;  1YJW N;  3U4L A;  3KJV A;  1QQC A;  3MEC A;  5M1O A;  3CCU N;  3RMD A;  1NJ8 A;  3VEX A;  3F9K A;  1SKS A;  1YXQ A;  5AQZ A;  3NGY A;  1QQO A;  1D9F A;  1G15 A;  2R7Y A;  2UUC K;  5EY4 A;  4F3O A;  2D0O A;  1IJJ A;  3PIP L;  3O1B A;  4A61 A;  3TOE A;  1RQ8 A;  1G58 A;  3ATU A;  2OTL N;  4QS7 A;  2A1R A;  4KAZ A;  4BR4 A;  4CFD A;  1JCU A;  4IG0 A;  1YT3 A;  1EXQ A;  3A5M C;  3OS0 A;  1RBT A;  1TL1 A;  5JS2 A;  1WBD A;  4M7Y A;  1WLJ A;  4WF9 L;  3KLH A;  3TAQ A;  2Q3S A;  4EO0 A;  1QS4 A;  5E26 A;  2Y1J A;  3E9P A;  4BG8 A;  5KQ8 A;  4KHW A;  5J2M A;  4J2B A;  2H3G X;  1QSS A;  1HPZ A;  2OAN A;  4IO9 L;  3NE6 A;  4I9Q A;  1BWF O;  3THV A;  4FJK A;  1ASV A;  1B9F A;  1HNI A;  1HKC A;  1YJ9 N;  3CCE N;  5T7B A;  3OBY A;  4CJS A;  5C2F A;  2W42 A;  3LL3 A;  5GAG P;  3CHW A;  3OBW A;  1EKE A;  2ZM6 K;  1S6Q A;  1EO1 A;  4AQY K;  1TK5 A;  3SQ2 A;  3HPG A;  4WFB L;  4AM6 A;  4I7F A;  3TWH A;  3MED A;  3HM9 A;  4WYB A;  3VQ4 A;  3L6Q A;  2E20 A;  5KTQ A;  4DSL A;  1IEZ A;  2YHA A;  1X1P A;  3LP1 A;  3DAW A;  4FOI A;  3O3H A;  2BKY X;  3BF3 A;  4UY8 O;  4H0T B;  1RT6 A;  3R8E A;  3QER A;  3SUN A;  3ENB A;  5JLF A;  2Q1N A;  3J81 O;  3H6E A;  2O8B B;  2G8W A;  3NMU A;  2O8E A;  3F5T A;  3CJB A;  3NH1 A;  1WSF A;  1S6P A;  3QEP A;  4DFK A;  4KH4 A;  3C6T A;  3VQ7 A;  2JWK A;  2WC9 A;  4EP5 A;  2VWK A;  5AQY A;  1RBV A;  4B8C A;  3LP3 A;  1VQ6 N;  5AQR A;  1EP4 A;  3DXM A;  3BY5 A;  3NVK A;  1ITG A;  1HC7 A;  4FFJ A;  3SMP A;  4BR7 A;  4F9O A;  4FWN A;  1TUU A;  4I2Q A;  1VSF A;  1JJ2 M;  5A2Q O;  1ZBH A;  3MDQ A;  1NKC A;  1YIJ N;  3CCM N;  3J7A P;  1JDQ A;  1WN7 A;  4DB3 A;  3LQU A;  3DI6 A;  1W0H A;  2IVP A;  2QWP A;  1JXB A;  2YNG A;  1CZB A;  4KKO A;  4KHY A;  1NK4 A;  4HVJ A;  3L2Q A;  3VES A;  2GUP A;  4FO0 A;  3AA3 A;  1KVC A;  4AHS A;  3TAP A;  1S1T A;  2E4L A;  5FPE A;  1R0A A;  5KQD A;  4FLZ A;  1HX1 A;  4M41 A;  5KPT A;  3A5N C;  2VYP A;  3CCJ N;  1M1K O;  1LWF A;  3L7V A;  4JI7 K;  3T1I A;  2PAV A;  1VK0 A;  1VSK A;  2YHX A;  2YNH A;  3H08 A;  1NH9 A;  3DLH A;  3I0S A;  3T69 A;  3DXK B;  3UKR A;  3ZEU B;  1OH7 A;  5JMV A;  1NWK A;  3ZX3 A;  4Z4E A;  1VRT A;  1NG9 A;  1HQE A;  4OO1 J;  3S3O A;  4NLC A;  3J80 O;  3H07 A;  1NK6 A;  2KHO A;  1YVN A;  1NKB A;  3U6Y A;  3ZCM A;  3I8D A;  1Y2I A;  1VQ7 N;  1HPM A;  2F7T A;  3K58 A;  3VEV A;  4YFU A;  5LMU K;  4KRF A;  3SUQ A;  4BR5 A;  4EHU A;  5GAE P;  4M3W A;  3TR8 A;  4CHO A;  2W40 A;  1QQN A;  3CFP A;  2UXC K;  2HHU A;  3LDL A;  4E7J A;  3TAE A;  3CET A;  1LW2 A;  3JYT A;  2DFF A;  4LH4 A;  2CGK A;  4B3O A;  3VEY A;  1TKD A;  4U67 L;  3QEI A;  4DG1 A;  1S8E A;  2M71 A;  1EX4 A;  4I6M B;  1Y64 A;  1EWR A;  3SQ4 A;  1WAF A;  4E7I A;  4JD2 A;  3QNO A;  2P9S A;  3VF4 A;  5D3G A;  2O8D B;  2OYQ A;  1BCO A;  4CD3 A;  4DLE A;  4M3Y A;  5AQI A;  5AQK A;  4NCB A;  3C6H A;  4IO8 A;  1C0G A;  2GV9 A;  4JKB A;  2BUP A;  5FRO A;  4JKC A;  1NJ2 A;  4CJQ A;  3OA9 A;  1JLB A;  5FPD A;  2O4I A;  1YTU A;  1BIS A;  1KQS M;  1NMD A;  1XQS C;  4O5F A;  1ZBI A;  4DR7 K;  2HF4 A;  5AZI B;  4H4M A;  4Q15 A;  4C8N A;  5JVG L;  4K25 A;  5AQV A;  1HRU A;  4EAH D;  5LL6 Z;  4KHQ A;  2Z1I A;  4FL9 A;  4P8E A;  4RW4 A;  3SBT A;  3J8A A;  2FLO A;  4CFC A;  1Q9X A;  2QKK A;  4TWA A;  3DLG A;  2E2Q A;  3HP6 A;  4ZTF A;  1NKE A;  2RF2 A;  3AVB A;  2G8K A;  1L3T A;  4Z4I A;  4ILH A;  3V9S A;  3THY B;  1LWE A;  4ZTJ A;  3AVG A;  5GIN A;  1U4B A;  2F8S A;  4IDK A;  3T1A A;  2GX9 A;  4CE9 A;  3W3D A;  3AY9 A;  5SWM A;  4AF1 A;  1T8E A;  3ZT3 A;  4CEE A;  3UB5 A;  1RDW X;  1FW6 A;  1SS6 A;  3VOV A;  4CGF A;  4O8U A;  2QWN A;  3FLC O;  4IOA L;  1HNX K;  5DK5 A;  1H4Q A;  2QXL A;  4FW1 A;  1TKZ A;  4YOY A;  3DOL A;  1VSH A;  2UYT A;  1BCM A;  1RTH A;  3PIO L;  4BRH A;  3ALY A;  1BA1 A;  1G99 A;  2P9P B;  4HHT A;  3CFR A;  1P90 A;  2NRH A;  2RHK A;  3SAH A;  2Y1I A;  4PWD A;  1LV5 A;  2A5X A;  2O8F B;  4Y0W A;  4DTU A;  3ZX2 A;  2FXU A;  4QCL A;  3ENH A;  2KFZ A;  4B9U A;  5KRS A;  2E1Y A;  4FM2 A;  4B9N A;  1NJX A;  4LFB K;  1RFQ A;  3BF1 A;  2BDP A;  3DLE A;  2YHB A;  3CCS N;  2HHS A;  4ILJ A;  3VQ9 A;  2G8F A;  3TU5 A;  4LY7 A;  3L0Q A;  3P39 A;  1IBK K;  5C0Y A;  4FLT A;  4CBU A;  5J2P A;  4QAG A;  4DQR A;  3D0P A;  4JKG A;  4YOV A;  5BPL A;  1SL1 A;  4O0J A;  5EX5 A;  1VQ8 N;  5AZJ A;  3O9S A;  4Q5V A;  1KLN A;  3HPH A;  5E84 A;  5FDL A;  1D4X A;  3SPZ A;  3ULE A;  2FBX A;  2RIU A;  4XEI A;  3KD5 E;  3N4P A;  1BI4 A;  4NCA A;  5FRN A;  1N8R O;  2P9N B;  1QQM A;  5E41 A;  4B9Q A;  2P9U B;  3AVH A;  1JLC A;  1H1V A;  3ZSR A;  5FPN A;  4CHQ A;  4JHD B;  4J8F A;  1WAJ A;  3LWM A;  3S41 A;  4PUO A;  5TKW A;  4B9L A;  3AAP A;  2E2O A;  1K8K A;  4JRP A;  4LFC K;  3TSU A;  5HRS A;  1Z26 A;  2O4G A;  3PSI A;  3TSP A;  3VER A;  1Q9Y A;  1NJZ A;  1NNE A;  3E01 A;  2IC3 A;  1BQM A;  1QVF M;  2D0A A;  3L2U A;  4B3R K;  4J2D A;  2A2Y A;  2WOM A;  1FKP A;  3CG7 A;  3O9T A;  3CC7 N;  2YV0 X;  3ZT2 A;  3C7N A;  5M1N A;  1K7J A;  3M3Z A;  1BHL A;  1ASU A;  2RIS A;  4HVC A;  4BDP A;  5AQX A;  5M1F A;  4CER A;  4DFM A;  2KTQ A;  3MN7 A;  5C10 A;  3WNE A;  2VWB A;  4YNQ A;  3OYM A;  3DWL A;  3AO5 A;  3MWT A;  2Q31 A;  4OGE A;  3ZT1 A;  1TKU A;  1IKW A;  2DFE A;  4GVM A;  5CR4 A;  5EOY A;  2QEX N;  1X9J A;  3GBT A;  4BWJ A;  2O8C B;  1GLL O;  3GL1 A;  3U9D A;  3PX4 A;  5IT9 O;  1X9S A;  5EXW A;  4ISG A;  4DSJ A;  1NGH A;  1KC8 O;  4JI3 K;  3BZC A;  3OW2 M;  2Z1H A;  4O44 A;  3RR7 A;  4CGD A;  1QZ6 A;  3QIN A;  3O3G A;  4CGH A;  4E19 A;  2OTJ N;  3M6G A;  3KK3 A;  1OKJ A;  3UIQ A;  2GUI A;  3NBP A;  3U8X A;  2VQE K;  2Q97 A;  4FBK A;  2LSN A;  4XH1 A;  3SYZ A;  2OPP A;  2GWK A;  4CZL A;  2IS3 A;  2UUB K;  3MN5 A;  4GV6 A;  5HRR A;  1ATS A;  2KLA A;  3VQQ A;  2FC0 A;  4C8M A;  4DQI A;  4EIA A;  3H3O B;  3PX0 A;  1I94 K;  4M3R A;  4NXN K;  5C12 A;  3M8Q A;  5AQO A;  3G6E N;  4YDU A;  4DQS A;  5I42 A;  3JSM A;  4FWL A;  2L8Y A;  3R1X A;  1LW0 A;  1RCH A;  3U3Y A;  4CJ7 A;  1QZ5 A;  4FWS A;  4DV4 K;  4BRI A;  3I55 N;  3HSC A;  3EYZ A;  4O0I A;  3MIO A;  4J2E A;  4HWI A;  2OZS A;  4W5Q A;  4YOU A;  3MN6 A;  2XRI A;  2NRT A;  3F73 A;  4BDY A;  3HZ7 A;  3VQE A;  2P9L A;  3HM8 A;  3AAR A;  4FM1 A;  4CJ3 A;  1MU2 A;  1JLG A;  4OLF A;  3AO1 A;  3IS9 A;  2HOE A;  4LF8 K;  3I56 N;  4CF0 A;  3CPE A;  4WCE L;  1I3A A;  1BIU A;  3C94 A;  4BQZ A;  3KLF A;  4FJH A;  4FJL A;  3OYI A;  3V9U A;  2KW4 A;  4NLB A;  3WXJ A;  1R59 O;  3SPY A;  3LVK B;  2V7Y A;  1NGA A;  1IG9 A;  2FSK A;  4HTU A;  3THW A;  3LRJ A;  4GKK K;  1KXP A;  2WUS A;  4BE2 A;  1Q18 A;  1O1W A;  5C24 A;  4CJW A;  1NJW A;  4F4K A;  1BO5 O;  3CJ9 A;  3L3V A;  4XIU A;  3I0R A;  4P6P A;  1DTT A;  4IG3 A;  2YKN A;  2P51 A;  3ULD A;  2A3Z A;  3N4Q A;  2NLX A;  4NYF A;  3UKU B;  2A6A A;  5AQH A;  2ATQ A;  5AQN A;  3SV3 A;  4E1N A;  1YUW A;  3FFK B;  4H4O A;  3D7E O;  3CQ8 A;  2P9K B;  4CF1 A;  4O5B A;  2IFE A;  4DTS A;  1C1A A;  1HYZ A;  5KPR A;  3LPT A;  3NFA A;  4ICL A;  2EWS A;  3AA5 X;  4B1W B;  3DLL L;  3U6F A;  2IOC A;  2B5J A;  4JRQ A;  1J5E K;  4K43 A;  2H9U A;  2NNW A;  2HB5 A;  1RDC A;  4IJA A;  4AHR A;  3ZSX A;  2YHY A;  2YHW A;  4FLV A;  1YTA A;  1U2V A;  3HBT A;  4MFB A;  3AA2 A;  4FWR A;  3G4S N;  1A5X A;  4PL8 A;  4O8K A;  3IRX A;  3RWU A;  2ASO A;  3HL8 A;  1N36 K;  5AFU A;  3O4N A;  4AHU A;  5J2Q A;  3C6A A;  4CIG A;  2O8B A;  2X78 A;  3K0S A;  1EET A;  1GLC G;  1ZBS A;  4BAC A;  4BY9 C;  4FJ7 A;  4YKE A;  1ZBU A;  3P5J A;  3UE5 A;  1KFD A;  2IDO A;  4IZ9 A;  4NZR M;  1RDA A;  2V7Z A;  1U49 A;  4LD0 A;  4KTQ A;  4A5B A;  3A8Y A;  4CJF A;  3IKM A;  4BGA A;  4HUF A;  3CJA A;  4BE1 A;  3TAN A;  3U9Z A;  4CK1 A;  2LN3 A;  2D4W A;  1DKG D;  2HHV A;  3V9W A;  4KH5 A;  1XWL A;  2GTD A;  4FPB A;  2B4J A;  4BRG A;  3LAN A;  5H1S Q;  4KI6 A;  1E4F T;  4GKJ K;  1L3U A;  3M8R A;  4BRD A;  1WUA A;  3MXI A;  4E0D A;  5J2N A;  4JKD A;  5AQS A;  1CLQ A;  1D9D A;  1BDG A;  1HJO A;  2QWL A;  2HST A;  5AQF A;  4CJ4 A;  4DF8 A;  1K4L A;  1VSI A;  3E9L A;  3LP2 A;  2ZJR L;  4PL7 A;  3V1O A;  1ILY A;  2X6N A;  4LSN A;  3SJJ A;  4PA1 A;  2WON A;  2QWR A;  1YVU A;  3WEE A;  3WXK A;  3OYJ A;  4JI8 K;  1E3M A;  2CH5 A;  3DLB A;  1JLA A;  2GBZ A;  3MCP A;  4X62 K;  1XUP O;  3DXK A;  3KK2 A;  3ZT0 A;  5HP1 A;  5M1Q A;  4G9Z A;  2HHT A;  2J4R A;  4NXM K;  4DV0 K;  4A2A A;  1JKH A;  3TTC A;  1F21 A;  5LJV A;  4B3T K;  4DV7 K;  3EZW A;  4YOT A;  1IH7 A;  5ELZ A;  2MX1 A;  1RDB A;  4IBN A;  3OYG A;  3PSF A;  3VF2 A;  4U7B A;  4FJ5 A;  3OHR A;  1LAW A;  1S72 N;  4DFP A;  3C0B A;  2HHW A;  4Z94 A;  1U04 A;  3KWG A;  2YI1 A;  4BRL A;  3ASM A;  1SL0 A;  4CFB A;  3FZK A;  4H5T A;  1WSI A;  1HMV A;  5C42 A;  1TV6 A;  3V81 A;  1N34 K;  3P04 A;  4FVU A;  3ZX0 A;  1EQY A;  3DYA A;  4LH5 A;  5CZ2 A;  5LJW A;  3HXM A;  4DFJ A;  3VPZ A;  3ZIG A;  3DOK A;  3QDK A;  1VQ9 N;  1I39 A;  2Y1B A;  5TKY A;  2O8D A;  3MK6 A;  3I8B A;  4PKH A;  3QBX A;  1C6V A;  3IAY A;  4DS4 A;  4XH4 A;  1VSJ A;  4GY2 B;  4H0Y B;  5M1P A;  2YKM A;  1W2B M;  3QIC A;  2IGI A;  1RNH A;  3ENO A;  1VSD A;  1RDD A;  5GAD P;  4FVM A;  1S1X A;  4YOR A;  4ELT A;  1KAZ A;  4CHP A;  1WSG A;  3ZSV A;  3W0L A;  4M3T A;  3L2R A;  2FF6 A;  2FBY A;  4PQU A;  1BIZ A;  1NGD A;  4H0P A;  4GMJ B;  1QHA A;  2KKZ A;  5KGW A;  4DR4 K;  1NJ5 A;  2FBV A;  3VEZ A;  3THY A;  3AO4 A;  3NCI A;  4BRO A;  3WXI A;  5CE3 A;  2UUA K;  3SBG A;  4DR1 K;  4H8K A;  3CC4 N;  2E1Z A;  4OPA A;  3WXM B;  3PO5 A;  4ZHR A;  3P83 D;  4PKG A;  3B6P A;  4R79 A;  2JGU A;  1XI1 A;  2F9W A;  3K57 A;  3GOI A;  4DTN A;  4CEC A;  1NFH A;  2IAJ A;  2P9P A;  1TAU A;  3AA4 A;  4M3X A;  1TKX A;  1IKX A;  3SQ0 A;  3CXC M;  4FK2 A;  4B9S A;  3QO9 A;  5FRM A;  3VGK A;  1YIT N;  4M45 A;  3J7Z O;  3DLK A;  1HKG A;  4BE0 A;  3EE9 A;  2NRR A;  4CCH A;  4P6D A;  4BRN A;  4CZE A;  4RWT A;  4OPH A;  5AQJ A;  4AM7 A;  3D2E A;  1XC9 A;  4CJ5 A;  2NZT A;  3PY8 A;  2G8I A;  3LP0 A;  1MA9 B;  5AFU H;  2ZD1 A;  1ZBL A;  1HR0 K;  3L4Q A;  4NCG A;  4JV5 K;  1U45 A;  4KH6 A;  3HJF A;  1YJN N;  1ATR A;  1PAV A;  3DM2 A;  1GLF O;  1O13 A;  4H5V A;  4JAX A;  3IAL A;  3DSC A;  1IG8 A;  1MDU B;  2B6A A;  3AVA A;  1BQN A;  2OZM A;  3MCA B;  3THX A;  2YX6 A;  3AGR A;  3F9M A;  5K14 A;  1OH6 A;  2O8E B;  1NGG A;  4ID5 A;  4YOX A;  4BR9 A;  2XHB A;  1K49 A;  3D2F A;  5CYQ A;  3NDK A;  4E7L A;  2QWM A;  3OYA A;  3U3G A;  1QE1 A;  2P9N A;  4I14 A;  3CI5 A;  4N41 A;  3MX2 A;  1TVR A;  2P9U A;  3NGZ A;  3O9R A;  4CHY A;  2ITG A;  3DXM B;  2AA4 A;  4JHD A;  3ZT4 A;  5BPM A;  4W5N A;  3CJ7 A;  1G57 A;  3RTV A;  4DF4 A;  1W9H A;  3G71 N;  3T3F A;  1SQK A;  1SV5 A;  1QVG M;  5AR0 A;  3FZM A;  4IFE A;  1HYS A;  4BRP A;  3RMB A;  3V1R A;  1QSY A;  3F2K A;  1HQU A;  5FLX O;  2HMI A;  3HYF A;  2EHG A;  4PKI A;  1WB9 A;  4FJG A;  2QXF A;  4KB1 A;  1UOC A;  1BL3 A;  1HNV A;  4CF8 A;  2VGN A;  5F2R A;  3CF5 L;  4DSK A;  3CQY A;  4ID1 A;  1S3X A;  1NU0 A;  3VQC A;  2RKI A;  3CIP A;  2DY4 A;  3CD6 N;  2CH6 A;  4FBQ A;  1S9G A;  4X66 K;  3L4I A;  4FWK A;  3FR0 A;  3QET A;  2ZWH A;  4CJR A;  2E2P A;  4JNE A;  4CEB A;  4RG8 A;  3ZET A;  3CER A;  1KCF A;  3KIO A;  1B92 A;  4H0X B;  4DR5 K;  1QSL A;  3FZL A;  1UWB A;  3MXM A;  5BRE A;  4LF5 K;  4BR2 A;  3WNG A;  4DTM A;  4LF9 K;  5BN8 A;  5AJ3 K;  4LF4 K;  4I2P A;  3LZJ A;  3K5L A;  1VRU A;  4R5P A;  3TAF A;  4FW2 A;  4YDQ A;  2WTU A;  1EWQ A;  1Q82 O;  1K73 O;  1TIG A;  1IO2 A;  2O8C A;  2PYJ A;  3VA3 A;  3EY1 A;  4ISF A;  4JK8 A;  4A62 A;  2Q0R A;  3H46 O;  3HP9 A;  5BRF A;  2NRX A;  1Z05 A;  2ZF5 O;  4YY3 K;  4CBX A;  4CJL A;  1CXU A;  4K42 A;  2JLE A;  1C0F A;  1SUQ A;  3Q7C A;  5GIP A;  1T6D A;  4DQP A;  4HD0 A;  3T19 A;  3KKS A;  3KTQ A;  3O8M A;  3OYE A;  3QIP A;  1BUP A;  2E2N A;  1P8Z A;  1DCJ A;  1GOC A;  2A1S A;  4CZJ A;  3MMV A;  2G8U A;  2IIR A;  1HUX A;  2X6S A;  3MEG A;  4IFV A;  4WQ5 C;  4CFA A;  3NF8 A;  4KHP K;  3P4I A;  4JD2 B;  3L8B A;  4DR2 K;  3A5O C;  4KB0 A;  3EO3 A;  1MWM A;  3Q7B A;  5M1K A;  2EH1 A;  1Y9X A;  4DTP A;  3DRR A;  3O1W A;  4A5A A;  3QFP A;  3ZSW A;  4FSV A;  4KPY A;  4M42 A;  4K86 A;  4BWM A;  1NOY A;  3MX5 A;  4H03 B;  4KTZ A;  4L3Q A;  1NMN A;  2G8V A;  3LPU A;  2XY8 A;  1T3V A;  4KO0 A;  4BRQ A;  5BR9 A;  3KKR A;  4BVO A;  4F3T A;  2W41 A;  2F9T A;  4BC2 A;  2Q36 A;  4FK0 A;  2QKB A;  4K8X A;  4OJR A;  4N5S A;  1GLE G;  4TSX A;  4OPJ A;  2Q3V A;  5AQM A;  4OVL A;  3CFO A;  2IVO A;  1ZYQ A;  4EZ9 A;  4B9T A;  5HLF A;  2KZM A;  4WQ4 A;  5AQP A;  2E6L A;  4DSE A;  3KHY A;  4Q0B A;  1FKO A;  3JS6 A;  1RTJ A;  3O3F A;  4DTX A;  4MQ3 A;  4F2R A;  1HNZ K;  4YHH K;  4RTF D;  1X9W A;  5I3U A;  4FZX C;  3EKU A;  2P1J A;  4KV8 A;  4OLA A;  2DPN A;  4JKF A;  1TKT A;  2VQF K;  3O4Q A;  2YNI A;  5KPZ A;  5KRT A;  4HVZ A;  4BGB A;  1CZ9 A;  4GNI A;  2HVI A;  3K2P A;  4DU3 A;  3R9P A;  3TI0 A;  3HK2 A;  2KQ2 A;  1ASW A;  1VQN N;  4FZY A;  3ZSO A;  3CCQ N;  3NHG A;  3RSE B;  2QK9 A;  2PYL A;  4WI1 A;  2XY6 A;  1L3S A;  2DFH A;  1VSM A;  2HND A;  2QTD A;  1MWK A;  4LF6 K;  1KVB A;  2W6K A;  3K5O A;  5JIC A;  2BTF A;  3FGU A;  5CY4 A;  4FYD A;  4B08 A;  3PUF A;  5HRN A;  3BDP A;  2CGL A;  3TAB A;  1HYV A;  1NJ1 A;  3AVN A;  1IV0 A;  3D45 A;  1BA0 A;  4JKG B;  3A5L C;  3H3N O;  2V52 B;  4FWP A;  4EP4 A;  4FWQ A;  3T7Z A;  3ISN C;  5EVZ A;  5AZJ B;  4FCY A;  4IWV A;  4MDB A;  3VQ8 A;  4KFB A;  2F4V K;  1VM0 A;  3S3N A;  3VQ6 A;  1T7P A;  2OPR A;  4KHN A;  3ULE B;  1S1U A;  4N76 A;  4FJN A;  4XH5 A;  4P77 A;  1BI4 B;  4JYA K;  3V1Q A;  4NO7 A;  4DU4 A;  3AVK A;  4JLH A;  2D5R A;  3C95 A;  2EX3 A;  3BP8 A;  5BRH A;  4OGC A;  4CEA A;  3LDO A;  4FLW A;  4B3M K;  3B6O A;  1TYQ B;  5C15 A;  1KLM A;  2ZJP L;  1XMQ K;  2ITM A;  2EK0 A;  4QOZ B;  1T05 A;  2X74 A;  4CEQ A;  3EE8 A;  3E1Y A;  1S1V A;  4O4G A;  3CCR N;  3K9K A;  3C65 A;  1K8K B;  1LAV A;  1NGF A;  3SUP A;  4CIF A;  1K8A O;  3ID6 A;  4DMN A;  3OYK A;  4DWI A;  4IOC L;  2PY5 A;  1OH5 A;  1NK9 A;  2D0P A;  1K4P A;  4FM0 A;  2FF3 B;  3IAB B;  4C1N K;  1TAQ A;  4H5W A;  3RMA A;  4B9M A;  2ETJ A;  4DTO A;  3QBW A;  4JK9 A;  4H5R A;  1DLO A;  1WNS A;  1XC3 A;  3OS2 A;  3ZSQ A;  2HNY A;  4KTW A;  1JCG A;  3OYB A;  3VN5 A;  1TL3 A;  4AH9 A;  2P5O A;  4CJV A;  1VR4 A;  1IBL K;  4CJP A;  5KGX A;  3E9O A;  4FLX A;  1K4O A;  5GIO A;  3CC2 N;  3J7Y P;  3S3M A;  1RTI A;  3NAE A;  4DR3 K;  5BN9 A;  4OPK A;  2CGJ A;  4CJT A;  4FJ9 A;  1RT7 A;  3TAM A;  1NJY A;  4C1N I;  2XY7 A;  1J6Z A;  4EFH A;  2PZS A;  4ELV A;  3LVJ C;  3VGM A;  2OA8 A;  3KD1 E;  3VEN A;  4BRC A;  4M63 C;  3DRS A;  3NF7 A;  3ITH A;  3KLE A;  1H0X A;  1GLJ O;  4DUZ K;  2ASP A;  2RE2 A;  3VEW A;  4GW6 A;  2HHH K;  5KI6 A;  1FJG K;  2NUB A;  3KWI A;  5SZT A;  4C8K A;  2HBJ A;  4X64 K;  3M1F A;  4CZH A;  2NRZ A;  4Z4C A;  3L2W A;  4GV3 A;  5MLC Q;  3NVM A;  4IFY A;  1X3N A;  2UXD K;  1IKV A;  4FBW A;  1VQL N;  2E88 A;  5ADX A;  3AVJ A;  2E5L K;  4JI5 K;  4E89 A;  3RMC A;  4FJM A;  4B8A B;  4JKH A;  3LDP A;  4B1U B;  1Y97 A;  3EN9 A;  3MN9 A;  4OLB A;  4K87 A;  4HUG A;  4B1X B;  4LSL A;  2E8A A;  4MLH A;  2VG7 A;  1KAY A;  4IJN A;  1K4I A;  2QW9 A;  3VTH A;  3AGK A;  3K9J A;  3L3U A;  3HO1 A;  1RT2 A;  4OKJ A;  1GLA G;  4IXC A;  2IVN A;  1C1B A;  3NF9 A;  2P9L B;  1JE3 A;  2GTC A;  4NZT M;  5DMR A;  3HI0 A;  1CZA N;  3MK5 A;  4JI2 K;  1UA0 A;  4BR0 A;  3DRP A;  3CM6 A;  3ZEU A;  3LM9 A;  4RCH A;  4GV9 A;  3CME N;  1RIL A;  3NH0 A;  2QM1 A;  1KK9 A;  1JCE A;  3THW B;  4PY5 A;  1SZ2 A;  1LN4 A;  3AV9 A;  4LFA K;  3CQX A;  1RT3 A;  4WFA L;  1RBS A;  3R3L A;  1Q7Y O;  3IG1 A;  2HW3 A;  3QFU A;  3LAM A;  3TTF A;  3PO4 A;  2P9I B;  4CZI A;  1WOQ A;  5C2D A;  1JCF A;  1VSE A;  4A57 A;  4E1J A;  3BEX A;  1VAZ A;  3WNF A;  1B9D A;  1LOT B;  4DHY A;  4DQ8 A;  2QWO A;  2A42 A;  4M3Z A;  4MLE A;  3HZ6 A;  1KVA A;  3LDQ A;  3WUH A;  3T1H K;  1RT5 A;  2Q0U A;  4A2B A;  3OYN A;  1S9E A;  2YCH A;  3HPO A;  1SL2 A;  3QML A;  4IEI A;  4CEO A;  3P38 A;  5JVH L;  4BRK A;  2WFB A;  4I6M A;  4FXD A;  3CYM A;  1XNR K;  2ZQB A;  2KZZ A;  1U2V B;  1SNN A;  1WSJ A;  3HOS A;  3WNH A;  4L8R B;  1HRH A;  4CJK A;  4CED A;  4Z4H A;  4WE1 A;  3V4I A;  1Q81 O;  2Z1J A;  4FLU A;  1PVY A;  1TK8 A;  1BU6 O;  3NH2 A;  4FJ8 A;  1M90 O;  2I7P A;  2A40 A;  1XNQ K;  5BRD A;  4IDH A;  4DLG A;  1W97 L;  4M3U A;  1ZBF A;  3VQD A;  2DTU A;  2QI2 A;  2OCE A;  4BRE A;  2ZGY A;  3LZI A;  2D0C A;  5AZI A;  3OYC A;  3MWP A;  2I5J A;  4JS4 A;  4K41 A;  2HBM A;  2HNZ A;  1KFS A;  2HVH A;  1KD1 O;  1DGK N;  1NGI A;  4CK3 A;  4CVN E;  1BOT O;  3V9X A;  1HNW K;  2Q2R A;  5DM6 L;  1WSE A;  3K59 A;  1VHX A;  1N5Y A;  5AQU A;  4DKW A;  2HF3 A;  1HLU A;  1X3M A;  4C8L A;  1UDV A;  4E1B A;  3AVC A;  4KHS A;  1A5V A;  3I33 A;  2GEM A;  3KLI A;  1GLD G;  3MEE A;  5AQG A;  4PHT X;  1RDU A;  3B8A X;  4Z9E A;  4G1Q A;  2VG6 A;  3WQT A;  1V4T A;  4NB4 A;  3RR8 A;  3HVT A;  3VEO A;  5EU7 A;  2BAN A;  4UQG A;  3H1V X;  4MO5 A;  3WEE B;  5AQT A;  1J54 A;  1H4S A;  3OVN A;  5HBM A;  3DLR A;  2YJF A;  3CPW M;  2O8F A;  3SJH A;  3TSQ A;  4RW9 A;  1W7A A;  4CZG A;  4CZK A;  4RW6 A;  2BH1 A;  4CBW A;  4QS9 A;  4FJX A;  4RW7 A;  3WBM A;  1JLQ A;  3VQB A;  5C25 A;  1NM1 A;  4DCH A;  3AVM A;  3HTV A;  3EZ5 A;  3AO3 A;  1TUY A;  1U6Z A;  4CGJ A;  3VQA A;  3K5M A;  1WBB A;  3HRG A;  4Y1C A;  3OYF A;  1KTQ A;  4CGG A;  3SNN A;  2PFU A;  4BVP A;  5F0X A;  4DV6 K;  3AVL A;  3G0Z A;  5BR8 K;  1V4S A;  4DS5 A;  3EEQ A;  1NK8 A;  3C6U A;  3KZB A;  5ADX H;  4KHU A;  5IWA K;  4MDA A;  3ZII A;  3KLG A;  1NGJ A;  3RRH A;  4C8O A;  1JXE A;  3BUZ B;  3M8P A;  3HOT A;  4BDZ A;  1JL2 A;  3SK3 A;  1TKS A;  4B9V A;  4DV2 K;  4W5R A;  3E66 A;  2NRW A;  3O6W A;  1REV A;  2OPQ A;  4BC3 A;  2E6M A;  2GEL A;  1CXQ A;  1VQ4 N;  2FBT A;  4JI4 K;  3V9Z A;  3MGZ A;  2HMP A;  3AVF A;  4F2S A;  3VMF B;  1GOA A;  4WQ5 A;  4CGI A;  3CCL N;  4ILG B;  3QEX A;  1N6Q A;  1VSL A;  1GOB A;  4K0K K;  1NJ6 A;  4JN4 A;  3AO2 A;  3TAR A;  4CI6 A;  1RT1 A;  5BPN A;  5I9E B;  2EQA A;  1OVY A;  1S22 A;  4CES A;  4BRA A;  4DQQ A;  4BQL A;  2Z1G A;  5CZ1 A;  1C0M A;  4FCX A;  4NCX A;  3LAK A;  2P5G A;  3P1G A;  3L2V A;  4DR6 K;  5J1E A;  3WQU A;  4CW7 B;  3SAF A;  5HRO A;  4FWM A;  1RT4 A;  3UKR B;  3DMJ A;  2PBD A;  1JL1 A;  3A2F A;  1VQP N;  1RGI A;  3DJC A;  3FFI A;  4LC9 B;  1KAX A;  4IOX A;  1VQM N;  3ID8 A;  4AHT A;  3EKS A;  4KI4 A;  1TK0 A;  2P9B A;  3RSE A;  1FXX A;  3ATV A;  3K5N A;  2XY5 A;  4BC4 A;  1KRP A;  2F8T A;  1K9M O;  4CJU A;  3QLH A;  3RVC A;  3QKB A;  3SV4 A;  3ZIH A;  3IUC A;  5AQQ A;  1NGE A;  3D2E B;  3T1Y K;  3H45 C;  4M7X A;  3O08 A;  4IKF A;  4HCC A;  2ZGZ A;  1K6Y A;  3VQP A;  3ZSZ A;  2UU9 K;  1OH8 A;  2ZJQ L;  3IMX A;  2HBL A;  2AJQ A;  4CEF A;  1TGO A;  4I9L A;  1RTD A;  4CF2 A;  1NBW A;  3R6M A;  4CIE A;  4HCB A;  1GLB G;  4DTR A;  5GAH P;  2P9S B;  4DUY K;  3OTO K;  4W5T A;  2W6L A;  3THX B;  4RW8 A;  3FE1 A;  3V6D A;  4P6C A;  1NFJ A;  2NRV A;  3AJE A;  3D2F B;  2Z7C A;  1A5W A;  4DSI A;  4FWO A;  2HHX A;  1S5J A;  1TYQ A;  3PV8 A;  1DT9 A;  1H0Y A;  1NLV A;  5HRP A;  1Z6R A;  1BG3 A;  2JWL A;  3VA0 A;  3NF6 A;  5CHI A;  2VG5 A;  2QWQ A;  3SCX A;  3O4W A;  5LY3 A;  1C0T A;  3QEV A;  4HUE A;  4DTJ A;  4NYN A;  1Q86 O;  1LCU A;  1JLE A;  1U48 A;  1SKR A;  1T6C A;  5JLH A;  4P8J A;  4BC5 A;  4DV5 K;  2YNF A;  4ISE A;  2OPS A;  2VGM A;  4FZZ A;  3IAB A;  1ZC6 A;  1D5A A;  4J2A A;  3A0I X;  3WXL A;  4H0V B;  4JS5 A;  3VTI A;  2ASM A;  4JKE A;  3LWL A;  4H5N A;  1C0U A;  2BGG A;  2YJE A;  4CZF A;  1L3V A;  4V19 S;  3OJU A;  4GVE A;  3QES A;  5B8H A;  1ESV A;  4B1Z A;  4EZ6 A;  4DU1 A;  3VF6 A;  4MO4 A;  1II7 A;  1ATN A;  3WT0 A;  3ZET B;  1YI2 N;  1QTM A;  1T44 A;  3UKU A;  2D0B A;  1X9M A;  3GDQ A;  1YF5 L;  3CCV N;  2P9K A;  1VQK N;  1DTQ A;  3HT3 A;  4E3S A;  3SQ1 A;  1KSP A;  3SMS A;  1N32 K;  3MAQ A;  3VET A;  4AHV A;  3AAQ A;  1QHT A;  4CD1 A;  4BRF A;  1LWC A;  4E7H A;  4FOE A;  3MXJ A;  4CZM A;  5AQW A;  4FPA A;  4JEP A;  1VQ5 N;  1NJI O;  4E7K A;  2AP1 A;  3AVI A;  1NK5 A;  4FJI A;  2GWJ A;  2VWJ A;  4JI1 K;  3GE1 A;  4H0O A;  1E4G T;  4CF9 A;  3EL2 A;  3SUO A;  3M5R A;  3VQ5 A;  3TAG A;  1NGB A;  3LDS A;  4DV1 K;  1J5O A;  3IFR A;  4KBO A;  1PVW A;  4EHT A;  1NK7 A;  2G8H A;  2XO7 A;  4C23 A;  2V51 B;  4F8R A;  3BZK A;  2RN2 A;  3CJ1 A;  5FPM A;  3O9Q A;  2VCP A;  4AIL C;  1HKB A; 
#chains in the Genus database with same CATH homology
 3IDH A;  2FSN A;  4JKG A;  4YOV A;  4NZT M;  2P9P A;  3VGL A;  5BPL A;  5EX5 A;  1DEJ A;  1VQ8 N;  3HI0 A;  2QA4 N;  2I7N A;  1CZA N;  3CXC M;  5AZJ A;  3MK5 A;  3O9S A;  4WQ4 C;  1ZXO A;  5E84 A;  3VGK A;  1YHQ N;  1YIT N;  1D4X A;  3J7Z O;  4BR0 A;  1HKG A;  3KK7 A;  3EE9 A;  3ZEU A;  3ULE A;  2NRR A;  5HL7 L;  2RIU A;  4XEI A;  2A41 A;  3LM9 A;  3N4P A;  4RCH A;  4GV9 A;  4P6D A;  3CME N;  4BRN A;  4CZE A;  4RWT A;  4OPH A;  3CMA N;  5AQJ A;  4AM7 A;  3D2E A;  2QM1 A;  1KK9 A;  1N8R O;  2P9N B;  1JCE A;  1QQM A;  2NZT A;  1SZ2 A;  2P9U B;  4B9Q A;  1H1V A;  1MA9 B;  1YAG A;  5AFU H;  5HOO A;  3CQX A;  3P31 A;  5FPN A;  3L4Q A;  4WFA L;  4JHD B;  5F1X A;  3R3L A;  3CJC A;  1VQO N;  3C7N B;  1Q7Y O;  5AQL A;  3ZYY X;  3QFU A;  4J8F A;  4B1V A;  4KH6 A;  3TTF A;  1YJN N;  1ATR A;  2P9I B;  3S41 A;  5TKW A;  1WOQ A;  4CZI A;  3SAG A;  1GLF O;  2E2O A;  1JCF A;  1O13 A;  3AAP A;  4H5V A;  4A57 A;  2WBN A;  4JAX A;  5C2D A;  1K8K A;  4E1J A;  1IG8 A;  1MDU B;  3BEX A;  4BG9 A;  1VAZ A;  3MCA B;  1LOT B;  2YX6 A;  3AGR A;  3F9M A;  3TSU A;  4DHY A;  4DQ8 A;  1NGG A;  2QWO A;  4YOX A;  2A42 A;  4BR9 A;  4MLE A;  3HZ6 A;  1K49 A;  3D2F A;  3O5B A;  3LDQ A;  3TSP A;  3WUH A;  3VER A;  4YOW A;  2QWM A;  2Q0U A;  4A2B A;  2YCH A;  1QVF M;  3QB0 A;  2P9N A;  3D6R A;  4I14 A;  3O9U A;  3FZF A;  3CI5 A;  3GG4 A;  3QML A;  3MX2 A;  4IEI A;  2P9U A;  3PLA A;  1SAZ A;  3O9T A;  2HBK A;  3CC7 N;  3P38 A;  4JK7 A;  3TTD A;  3O9R A;  3ZIE A;  4BRK A;  5JVH L;  2WFB A;  4I6M A;  3DXM B;  2AA4 A;  4JHD A;  3C7N A;  4HTL A;  5M1N A;  3M3Z A;  1U2V B;  5BPM A;  1K7J A;  4QS8 A;  2RIS A;  1SNN A;  2P9I A;  3CJ7 A;  3HOS A;  1G57 A;  5AQX A;  5M1F A;  3G71 N;  3JXU A;  1SQK A;  1QVG M;  5AR0 A;  3MN7 A;  3FZM A;  1Q81 O;  4IFE A;  3O80 A;  5C10 A;  1PVY A;  3KVG A;  4BRP A;  1BU6 O;  2VWB A;  1M90 O;  3F2K A;  2I7P A;  2A40 A;  3DWL A;  3MWT A;  4PKI A;  4B1Y B;  5BRD A;  1XEZ A;  2Q31 A;  4IDH A;  3TPQ A;  1TKU A;  3H1Q A;  4JKA A;  5CR4 A;  1W97 L;  4YDU C;  2VGN A;  5F2R A;  2FSJ A;  2QI2 A;  5EOY A;  3CF5 L;  4BRM A;  2QEX N;  4BRE A;  2ZGY A;  3CQY A;  1S3X A;  4IEE A;  5AZI A;  3CIP A;  3MWP A;  4K41 A;  2HBM A;  1X9J A;  3GBT A;  3CD6 N;  2CH6 A;  4FBQ A;  3LS6 A;  3L4I A;  1GLL O;  3GL1 A;  4FWK A;  3FR0 A;  3U9D A;  1KD1 O;  3G25 A;  1DGK N;  1NGI A;  2ZWH A;  5EXW A;  2E2P A;  4ISG A;  4JNE A;  1NGH A;  1KC8 O;  3ZET A;  1BOT O;  3CER A;  3LDN A;  4H0X B;  4A59 A;  2Q2R A;  3OW2 M;  3SLC A;  1NGC A;  5DM6 L;  3FZH A;  2D1K A;  3FZL A;  1QZ6 A;  5AQU A;  4DKW A;  5BRE A;  2HF3 A;  3LM2 A;  1HLU A;  1X3M A;  4BR2 A;  2OTJ N;  3M6G A;  1OKJ A;  5BN8 A;  1YJW N;  4E1B A;  3I33 A;  2GEM A;  3U4L A;  3U8X A;  1GLD G;  5M1O A;  2Q97 A;  4FBK A;  5AQG A;  4PHT X;  3CCU N;  4XH1 A;  1RDU A;  3B8A X;  1Q82 O;  1K73 O;  3WQT A;  1V4T A;  2GWK A;  4NB4 A;  4CZL A;  3VEX A;  3MN5 A;  3VEO A;  4GV6 A;  1YXQ A;  4ISF A;  1ATS A;  2KLA A;  5AQZ A;  3H1V X;  1QQO A;  4JK8 A;  4MO5 A;  3WEE B;  4A62 A;  2Q0R A;  3H46 O;  5BRF A;  2NRX A;  1Z05 A;  2ZF5 O;  5AQT A;  5EY4 A;  2D0O A;  1IJJ A;  4CBX A;  3PIP L;  3O1B A;  4EIA A;  3H3O B;  4K42 A;  4A61 A;  1G58 A;  1C0F A;  3ATU A;  3Q7C A;  5GIP A;  2YJF A;  1T6D A;  4QS7 A;  5C12 A;  5AQO A;  3CPW M;  2OTL N;  3G6E N;  3SJH A;  4YDU A;  3TSQ A;  3O8M A;  4BR4 A;  1JCU A;  4FWL A;  3R1X A;  4CZG A;  4CZK A;  3A5M C;  4CBW A;  1BUP A;  2BH1 A;  4QS9 A;  4CJ7 A;  1QZ5 A;  2E2N A;  4FWS A;  4BRI A;  3I55 N;  3HSC A;  4M7Y A;  3MIO A;  4WF9 L;  1P8Z A;  4HWI A;  1NM1 A;  4DCH A;  4EO0 A;  4YOU A;  5E26 A;  3MN6 A;  4CZJ A;  3HTV A;  3MMV A;  2NRT A;  2IIR A;  1HUX A;  3E9P A;  1TUY A;  4BG8 A;  1U6Z A;  5KQ8 A;  2P9L A;  3HM8 A;  4WQ5 C;  2H3G X;  3AAR A;  2OAN A;  3P4I A;  4JD2 B;  4IO9 L;  3HRG A;  1BWF O;  3A5O C;  3EO3 A;  1MWM A;  2PFU A;  3Q7B A;  5M1K A;  4BVP A;  5F0X A;  1YJ9 N;  1HKC A;  3CCE N;  2HOE A;  3O1W A;  4A5A A;  3I56 N;  3QFP A;  3CPE A;  4FSV A;  3OBY A;  4WCE L;  1V4S A;  5C2F A;  4BQZ A;  3LL3 A;  5GAG P;  3CHW A;  3MX5 A;  4H03 B;  4L3Q A;  3OBW A;  1T3V A;  4NLB A;  4BRQ A;  3KZB A;  3WXJ A;  5BR9 A;  1R59 O;  5ADX H;  4BVO A;  2V7Y A;  2W41 A;  1NGA A;  2F9T A;  3ZII A;  2Q36 A;  4MDA A;  4BC2 A;  2FSK A;  1EO1 A;  1NGJ A;  3LRJ A;  4WFB L;  4AM6 A;  1KXP A;  2WUS A;  1Q18 A;  4WYB A;  1GLE G;  3L6Q A;  2E20 A;  1IEZ A;  1BO5 O;  3CJ9 A;  3BUZ B;  4P6P A;  5AQM A;  2IVO A;  3HOT A;  3DAW A;  4FOI A;  3SK3 A;  1TKS A;  4WQ4 A;  3BF3 A;  5AQP A;  4UY8 O;  4H0T B;  3E66 A;  3R8E A;  2NRW A;  3KHY A;  3O6W A;  2A3Z A;  3JS6 A;  3N4Q A;  2NLX A;  3ENB A;  5JLF A;  2Q1N A;  2A6A A;  3UKU B;  3H6E A;  4BC3 A;  5AQH A;  5AQN A;  3NMU A;  1YUW A;  3FFK B;  3D7E O;  2GEL A;  3CJB A;  2P9K B;  3F5T A;  4RTF D;  1VQ4 N;  3MGZ A;  3EKU A;  4KH4 A;  5KPR A;  2HMP A;  2DPN A;  2JWK A;  4JKF A;  3DLL L;  2EWS A;  2WC9 A;  4B1W B;  3VMF B;  4WQ5 A;  4K43 A;  5KPZ A;  2NNW A;  4HVZ A;  5AQY A;  4BGB A;  3CCL N;  4IJA A;  4GNI A;  5AQR A;  4ILG B;  1VQ6 N;  3DXM A;  2YHY A;  4JN4 A;  2YHW A;  3NVK A;  3R9P A;  1U2V A;  3HBT A;  4FFJ A;  4CI6 A;  3SMP A;  5BPN A;  4BR7 A;  4F9O A;  1VQN N;  5I9E B;  2EQA A;  1OVY A;  1S22 A;  4FWR A;  4FWN A;  1TUU A;  3G4S N;  4BRA A;  4PL8 A;  1JJ2 M;  3CCQ N;  4O8K A;  4BQL A;  3RSE B;  2ASO A;  3MDQ A;  5AFU A;  3C6A A;  1YIJ N;  3CCM N;  4DB3 A;  4FCX A;  3LQU A;  1GLC G;  1ZBS A;  4BY9 C;  4YKE A;  2IVP A;  2QWP A;  2QTD A;  1MWK A;  4WFN L;  3WQU A;  3SAF A;  2IVN A;  3UE5 A;  4FWM A;  5JIC A;  4IZ9 A;  3UKR B;  4NZR M;  2PBD A;  2BTF A;  2V7Z A;  3VES A;  3FGU A;  1VQP N;  1RGI A;  3DJC A;  4LC9 B;  2GUP A;  4FO0 A;  4A5B A;  3A8Y A;  1KAX A;  2CGL A;  4IOX A;  3IKM A;  4BGA A;  1VQM N;  1PVW A;  3CJA A;  5FPE A;  3U9Z A;  3ID8 A;  5KQD A;  3EKS A;  1HX1 A;  5KPT A;  2LN3 A;  3A5N C;  2P9B A;  1BA0 A;  2VYP A;  2D4W A;  1DKG D;  4JKG B;  3CCJ N;  1M1K O;  3RSE A;  3A5L C;  3H3N O;  4KH5 A;  3ATV A;  2V52 B;  3L7V A;  4FWP A;  4FWQ A;  2GTD A;  3T1I A;  2PAV A;  4FPB A;  3T7Z A;  4BRG A;  5EVZ A;  5AZJ B;  2YHX A;  4IWV A;  4MDB A;  5H1S Q;  4BC4 A;  1E4F T;  3T69 A;  3DXK B;  1K9M O;  4BRD A;  1WUA A;  3UKR A;  3ZEU B;  3ULE B;  4JKD A;  3RVC A;  5AQS A;  5JMV A;  1NWK A;  3ZX3 A;  4XH5 A;  1BDG A;  1HJO A;  2QWL A;  4P77 A;  4OO1 J;  3ZIH A;  3IUC A;  2HST A;  4NO7 A;  1NGE A;  3D2E B;  4NLC A;  3H45 C;  5AQF A;  5AQQ A;  4M7X A;  3O08 A;  3H07 A;  3BP8 A;  2KHO A;  5BRH A;  1YVN A;  1K4L A;  3LDO A;  2ZGZ A;  3E9L A;  2ZJR L;  1VQ7 N;  1HPM A;  1TYQ B;  5C15 A;  4PL7 A;  2F7T A;  2ZJP L;  1ILY A;  2ITM A;  2ZJQ L;  3IMX A;  2HBL A;  3VEV A;  3WEE A;  2QWR A;  3WXK A;  4BR5 A;  4EHU A;  1NBW A;  2CH5 A;  3R6M A;  5GAE P;  3EE8 A;  3E1Y A;  1GLB G;  3MCP A;  3K9K A;  2P9S B;  3C65 A;  5GAH P;  1K8K B;  3CCR N;  1NGF A;  1XUP O;  2W40 A;  3DXK A;  5DM7 L;  1QQN A;  3LDL A;  3FE1 A;  1K8A O;  5M1Q A;  4P6C A;  2NRV A;  3CET A;  3ID6 A;  4G9Z A;  3AJE A;  3D2F B;  2J4R A;  4IOC L;  4A2A A;  2D0P A;  3TTC A;  2CGK A;  2FF3 B;  1K4P A;  5LJV A;  4FWO A;  4C1N K;  4H5W A;  3VEY A;  4U67 L;  1TYQ A;  1DT9 A;  3EZW A;  4I6M B;  4YOT A;  1NLV A;  1Y64 A;  5ELZ A;  2MX1 A;  1Z6R A;  3QBW A;  1BG3 A;  2JWL A;  4JK9 A;  4H5R A;  4JD2 A;  5CHI A;  3VF2 A;  4U7B A;  2QWQ A;  2P9S A;  3OHR A;  3O4W A;  1XC3 A;  5LY3 A;  3VF4 A;  1JCG A;  1S72 N;  1Q86 O;  3C0B A;  1LCU A;  4CD3 A;  4Z94 A;  1T6C A;  3KWG A;  5JLH A;  4P8J A;  3E9O A;  5AQI A;  5AQK A;  4BC5 A;  3C6H A;  4IO8 A;  1C0G A;  2YI1 A;  4ISE A;  2BUP A;  4JKB A;  4JKC A;  2VGM A;  4BRL A;  3OA9 A;  3FZK A;  1ZC6 A;  4H5T A;  5FPD A;  1K4O A;  5GIO A;  3CC2 N;  3A0I X;  3WXL A;  1KQS M;  4H0V B;  3VTI A;  2ASM A;  1NMD A;  1XQS C;  4JKE A;  5BN9 A;  4O5F A;  3P04 A;  2HF4 A;  2CGJ A;  5AZI B;  3ZX0 A;  4FVU A;  4H5N A;  1EQY A;  2YJE A;  4CZF A;  5JVG L;  1HRU A;  4K25 A;  5AQV A;  4C1N I;  4EAH D;  5LJW A;  1J6Z A;  3VPZ A;  3ZIG A;  4GVE A;  4EFH A;  3QDK A;  4FL9 A;  3VGM A;  1ESV A;  4B1Z A;  5B8H A;  3VEN A;  1VQ9 N;  4P8E A;  4BRC A;  3SBT A;  3VF6 A;  4M63 C;  3J8A A;  2FLO A;  5TKY A;  4MO4 A;  1ATN A;  3WT0 A;  3ZET B;  3MK6 A;  1GLJ O;  2E2Q A;  3I8B A;  4PKH A;  1YI2 N;  1T44 A;  3UKU A;  2ASP A;  2RE2 A;  3VEW A;  3QBX A;  3GDQ A;  4ILH A;  1YF5 L;  3CCV N;  5GIN A;  4XH4 A;  2P9K A;  3KWI A;  4GY2 B;  4H0Y B;  5M1P A;  1VQK N;  2GX9 A;  2HBJ A;  1W2B M;  3M1F A;  3QIC A;  3SMS A;  3ENO A;  4CZH A;  3W3D A;  3AY9 A;  3VET A;  3AAQ A;  4AF1 A;  2NRZ A;  4CD1 A;  5GAD P;  4BRF A;  4YOR A;  3UB5 A;  1RDW X;  4GV3 A;  5MLC Q;  3NVM A;  1SS6 A;  1X3N A;  3VOV A;  1KAZ A;  4FOE A;  4O8U A;  2QWN A;  3FLC O;  4FBW A;  3W0L A;  4CZM A;  2FF6 A;  5AQW A;  1VQL N;  4IOA L;  2E88 A;  2QXL A;  5ADX A;  4YOY A;  2UYT A;  1NGD A;  4H0P A;  4FPA A;  4JEP A;  1VQ5 N;  1QHA A;  2KKZ A;  2AP1 A;  4BRH A;  3PIO L;  1NJI O;  1G99 A;  1BA1 A;  2P9P B;  1P90 A;  4JKH A;  3LDP A;  2GWJ A;  2NRH A;  3VEZ A;  2RHK A;  4B1U B;  3SAH A;  3GE1 A;  4H0O A;  2A5X A;  1E4G T;  3EN9 A;  3MN9 A;  4Y0W A;  4BRO A;  3EL2 A;  3WXI A;  2FXU A;  3ZX2 A;  3ENH A;  5CE3 A;  4B1X B;  3SBG A;  3M5R A;  2E8A A;  4MLH A;  2E1Y A;  1NGB A;  3CC4 N;  2E1Z A;  1RFQ A;  1KAY A;  3BF1 A;  3IFR A;  4IJN A;  4KBO A;  4OPA A;  3WXM B;  4EHT A;  1K4I A;  2QW9 A;  3CCS N;  3VTH A;  3AGK A;  3K9J A;  4ILJ A;  4C23 A;  2V51 B;  4PKG A;  3TU5 A;  4R79 A;  3L0Q A;  3CJ1 A;  3P39 A;  5C0Y A;  4CBU A;  2F9W A;  5FPM A;  1GLA G;  3O9Q A;  4IXC A;  2VCP A;  3GOI A;  2P9L B;  1HKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...