3TSUA

Crystal structure of e. coli hypf with amp-pnp and carbamoyl phosphate
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 209
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tsuA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsuA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsuA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tsuA01
3VTHA 3VEXA 3VENA 3VF2A 3TTDA 3TTFA 3TSPA 3VEZA 3VEOA 3TSQA 3VEWA 3VETA 3VTIA 3VF4A 3TSUA 3TTCA 3VESA 3VERA
chains in the Genus database with same CATH superfamily
3T69A 5FPDA 4E7LA 4CHPA 1JLEA 3WNFA 1H0YA 4DS4A 4BRPA 2P9UA 3CCLN 3GBTA 1VQ5N 2A42A 3ZT2A 4BWMA 4KB1A 2P9PA 1A5VA 5EU7A 1JLFA 2D1KA 1JKHA 4W5QA 3HI0A 2JWLA 2QXFA 1WBDA 5FRNA 3AA5X 3HZ6A 1ATNA 3JS6A 3RSEA 2HBKA 4CE9A 1Q9XA 2O8BA 3OYNA 4DSJA 3ZIGA 1VAZA 4PHTX 5AQFA 1SL2A 3MGZA 3VGKA 5LMNK 5AQVA 1NK7A 3ISNC 3R8EA 1VQMN 3OS2A 3CQXA 1HQUA 2O8DB 3JXUA 3VQAA 2WFBA 4G9ZA 4CF8A 3CETA 3HPHA 1MDUB 3A5LC 5EY4A 4DV4K 3Q7CA 3HT3A 5AQIA 3UKUB 4FWRA 4BRGA 1OKJA 4DQQA 2HOEA 3LAKA 2F8SA 4JKGA 1HQEA 4Q15A 4N5SA 4DUZK 3PUFA 1GOCA 4OLAA 4JKFA 1GLLO 4CBUA 4DMNA 2F96A 3VQEA 4O8KA 2WTUA 5AQLA 2MX1A 2IFEA 4K88A 1HYSA 4WFBL 2YHAA 5AQRA 4GVEA 1SS6A 5HP1A 3EYZA 3TAPA 4FVUA 3TSPA 1JCFA 5KQ8A 4FJXA 1MWKA 3DXMB 5D3GA 5F2RA 2Z1IA 3V9ZA 4O0JA 2ASPA 5A2QO 3CJ7A 1XEZA 5BREA 2QWRA 1CLQA 1SAZA 3VF4A 5JICA 1UWBA 1T6DA 3LM2A 1BQNA 2P9NA 1Q9YA 5HRNA 4K87A 3THYA 4C8OA 4KHYA 3AO1A 1JLBA 5I9EB 1VSJA 3UKRB 5IWAK 1OVYA 4DF8A 4DR3K 1LW0A 2O8CA 3NF7A 1GLJO 1UOCA 2YJEA 3O5BA 3GL1A 1NNEA 2GTCA 3H6EA 2RE2A 1BG3A 5JVHL 1NJYA 3VEZA 2BKYX 4Z9EA 1XQSC 5AQZA 4BC5A 3RWUA 1W0HA 3CJAA 4DTNA 2IVOA 3ZX2A 3CCEN 1S22A 2WONA 1KAXA 4CEZA 5CHIA 3F9KA 4C8LA 4X66K 1VHXA 4FM2A 1K4IA 3CXCM 3NGYA 1WSGA 3H46O 3SAFA 3CFRA 3QETA 1XHXA 2VCPA 4LY7A 3NAEA 3FZHA 1EETA 4ICLA 4FJ9A 3ENHA 1WN7A 1X3MA 1YXQA 3DYAA 4F2SA 2GEMA 1HLUA 2BE2A 3VQBA 3IAYA 3ZYYX 3SZ2A 1L3TA 4CFCA 1HJRA 4PKGA 1FXXA 3HL8A 1Q8IA 4CZEA 5I42A 1IG8A 3KHYA 3ZETB 1S1TA 1WSEA 3O4WA 5EXWA 1SL1A 2HHWA 2HBJA 5BRFA 4M3XA 2UXBK 3ZT3A 1BA0A 4HTLA 4BR2A 5AQWA 1DTQA 4CI6A 4DCHA 3OJSA 3H45C 3VQCA 3OA9A 1TK5A 3SPZA 3THWA 4JK9A 2G8KA 1LWFA 4A5AA 4IO9L 2IVPA 3AGKA 3IKMA 1NK8A 4EIAA 4BR9A 3H3NO 4YDUC 5TKYA 2OZMA 3F73A 3S3NA 3SAGA 1VSDA 3MN6A 3N4QA 1VQ9N 3VQ9A 1UA0A 2D0CA 3HBTA 4FWLA 3DAWA 3R6MA 4AF1A 3EO3A 1LN4A 4RW7A 1ZC6A 3J80O 3SYZA 5DK5A 4N76A 4M41A 4JN4A 3MXJA 1LCUA 5J2MA 5FPEA 3NF8A 4DR5K 3V9UA 1NFHA 3DLGA 1TYQB 1NMNA 2NRXA 1YTUA 4CD1A 5CYMA 4JNEA 3PO5A 1D9DA 5JVGL 3ALYA 2AP1A 3MN7A 4L3QA 3OW2M 4JKDA 4K42A 2VG7A 2UXCK 4F3OA 2XRIA 4KO0A 1D4XA 3C6HA 3M1FA 5C10A 1NJ1A 3A2FA 3C94A 3T1IA 2HNDA 4CGGA 4CZKA 3MIOA 3G4SN 3TSQA 4B1YB 2DFEA 4CIEA 4K8XA 5AQYA 4X64K 2RKIA 3G71N 1HRUA 1WAFA 1KAYA 2NRHA 5KPRA 3TSUA 4W5TA 1SUQA 3SPYA 3AVKA 1N36K 4A2AA 1H1VA 4Z4HA 4A59A 3DRRA 4BQZA 3KLIA 3VA3A 4FWOA 1N34K 1NWKA 4JYAK 3O9RA 4Q0BA 3L2WA 1VQKN 4DR6K 1DKGD 1NK0A 1M1KO 1TUUA 3NE6A 3WUHA 2QKBA 2HBMA 4DV0K 4CJTA 3CG7A 5AQMA 3AVHA 1VRUA 4YOTA 1K4OA 3E01A 3MEEA 3IRXA 1VRTA 3ULEB 4BRFA 4ILJA 3R3LA 1LOTB 4CFDA 1S6PA 1ASWA 5FDLA 4A2BA 1BCOA 3HM9A 2XHBA 1S5JA 3BF3A 2P9LB 3P39A 4O4GA 4FK0A 2IC3A 4BR7A 3D2FB 4OPJA 3SCXA 3ZSQA 5E84A 3WQTA 2UUAK 4E7KA 3LL3A 3S3OA 1K7JA 4GMJB 4H0YB 4IG0A 2QWPA 4BG8A 4FLWA 4FCXA 3PX0A 4E0DA 3C6TA 3MDQA 2Z1HA 1RT1A 3ASMA 4OKJA 4HUEA 1NGJA 4BRAA 1EKEA 5BR9A 3P04A 4R79A 1A5XA 3OYEA 3ZSWA 4W5NA 3Q7BA 4CJVA 1K4PA 4WFAL 2KFZA 2DFHA 4B08A 1DGKN 3HPGA 3P5JA 4DV5K 5BPNA 3EE8A 5LJVA 4IEEA 1HPZA 2F8TA 2CH5A 4F4KA 3WQUA 1PVWA 1D5AA 1RT3A 1WSJA 4CZGA 2XY6A 4FM0A 2ZF5O 4B8CA 1L3VA 4FWKA 3VQ4A 4GV6A 1NU0A 1XMQK 4J2EA 4RW4A 3QEXA 4LF6K 3U8XA 3L2RA 4FVMA 3LDLA 1HNWK 4OGEA 4BREA 4DSEA 4FWPA 1T7PA 2UU9K 3VEOA 3C95A 3DJCA 2HMIA 1S3XA 2FBYA 1UDVA 3VN5A 1C1BA 3IDHA 2W6KA 3ZEUA 4CJSA 4BACA 4FW1A 2E2NA 4IDHA 3TAQA 1NJ5A 1JLAA 1C0UA 4H5TA 1REVA 1VR4A 2P1JA 2WUSA 2QXLA 2E8AA 3CF5L 3BZKA 2IGIA 3B6OA 5AQSA 3UIQA 3D2EB 5AJ3K 1VM0A 1TUYA 2QW9A 1K49A 3TR8A 3O6WA 1JLQA 1HJOA 3VF2A 3PO4A 4FBKA 3SBGA 1JL2A 1DTTA 1VK0A 3F9MA 1RT7A 4BRIA 1Q82O 1J5EK 2I7NA 2P9KB 3P83D 2ZGZA 4KKOA 4P8EA 3ZSXA 4CD3A 4Z94A 4H0TB 3K57A 1XC9A 2OZSA 4B9VA 1PAVA 4RTFD 4DTRA 5KPZA 4HCCA 3OYHA 1OH8A 3THVA 4ELVA 4BE1A 3TARA 3VQ6A 3K2PA 1G57A 4DG1A 2L8YA 4B3SK 2KW4A 2ITMA 4DKWA 2NRVA 4BRMA 3C7NB 1NOYA 1IBLK 5C42A 1TV6A 4PQUA 1NOZA 1DEJA 5AZJB 3NH0A 4ELUA 3ULDA 3AO4A 5J2NA 1U45A 2VWKA 3L7VA 4Z0UA 3O1WA 1E4FT 3MEGA 4MLEA 2NRTA 4YNQA 1EO1A 2FSNA 4LC9B 3VQ5A 4AHVA 3UE5A 1SL0A 3V1OA 2Z7CA 4H5RA 2GTDA 1OVQA 3ZCMA 1G58A 3L2QA 1I39A 3HSCA 3DLHA 1IKYA 2NUBA 3FZLA 2FF3B 4DQRA 3AO2A 3SUOA 4O55A 1RT6A 1TL3A 2JGUA 1N32K 3WEEB 3JSMA 3A8YA 3LANA 3VQDA 3UB5A 1NM1A 3VMFB 1NJIO 2Q3VA 3QFUA 3KD5E 4BVPA 2O8DA 4XIUA 4CJKA 3FLCO 2CGLA 3CJBA 4LF7K 3UKUA 1SNNA 1HR0K 4C1NI 3SI6A 4OPAA 1V4TA 3K9JA 1JLCA 2ZGYA 1ZBLA 4L8RB 4I14A 3R1XA 2E4LA 2XY7A 4FLYA 3V81A 4M42A 3U4LA 1NMDA 1I3AA 2D0OA 3ZSYA 4OVLA 1N33K 2X74A 1GOBA 5M1PA 3KLGA 4BQLA 1SQKA 3LWLA 3AVIA 1LAVA 4H03B 4GV9A 1O1WA 3DXMA 5BPMA 3P31A 4DV1K 2O8FB 1IKVA 1B9FA 1RT2A 4CEFA 3LM9A 2M71A 3B8AX 5F0XA 2DFFA 3AO3A 2A1SA 4IJAA 4CZJA 3ENOA 1NLVA 3D7EO 1KLNA 3O9UA 4CEDA 2CRQA 4FLZA 1W7AA 3O9QA 1QZ5A 3QBXA 3MK6A 1II7A 3VTIA 5F1XA 4B3TK 4OKKA 4DFPA 1LV5A 3KZBA 5AQNA 3CC4N 5KPTA 1HKBA 3DRPA 4OLFA 4BC4A 4B3RK 1N5YA 1I94K 3ZSZA 4EFHA 1LWEA 3LWMA 1WAJA 4JI4K 3FZFA 3ITHA 4PKIA 5EX5A 4EO0A 1S1UA 2H3GX 3SLCA 4NYFA 3I55N 2HHQA 1WSIA 3CJ9A 1VSIA 4GKKK 3T1AA 3EKSA 2ITGA 4DTSA 4PY5A 3NDKA 4C8MA 4A62A 4FJ5A 2E20A 2GX9A 1H4QA 1U2VB 1KFSA 5LJWA 4DSIA 2YHBA 1NGFA 2AA4A 4IZ9A 1DLOA 4FWNA 3THXB 3IFRA 4CF2A 4NLCA 3TTFA 4FL9A 4IJNA 4YY3K 4LFBK 4F8RA 4N56A 1ZBUA 3I56N 3I0SA 3HPOA 3ZETA 3KIOA 3BZCA 2ZE2A 4AQYK 3QEVA 1NGHA 3TPQA 4DWIA 2OANA 4M3WA 4E1JA 5AQHA 2I7PA 4FJGA 2P51A 4LFAK 1VSLA 4QCLA 1N8RO 2ZJRL 2YNGA 4DB3A 2Z1GA 1VSKA 3DOLA 3LP3A 4BVOA 3LDNA 2GBZA 1QS4A 2KQ2A 1HYVA 4WQ4C 2GWJA 4B9SA 1VQPN 3QINA 3QFPA 3KVGA 1QSSA 4BR5A 1RTJA 4IOCL 1OH7A 4R5PA 4FJJA 3LDOA 4H4OA 3QNNA 4CJ4A 5KGWA 4WQ5C 2NRWA 1YI2N 3S9HA 4DQ8A 1WNSA 2YHYA 4LF9K 2FSKA 4J8FA 3AV9A 4WI1A 3AJEA 3CQYA 3OBYA 1NJXA 1R59O 4K41A 3IS9A 3G10A 3CERA 4XH5A 2QWNA 4DTPA 4BRNA 1TK8A 3CJ1A 4RW8A 3ZT1A 1XHZA 3CQ8A 2G8FA 3VERA 4J2DA 3KWGA 1ZBIA 5AQKA 4BRQA 3CCSN 1VSHA 3KLEA 3MN5A 3LZIA 4DU4A 1GLDG 2Y1IA 3S41A 3PX6A 1M90O 1Q86O 2YKMA 1SZ2A 4JRQA 4FJMA 1J53A 1RFQA 3F5TA 4NLBA 4P6CA 1XMOK 5AQQA 4C8NA 2A6AA 3SMSA 3VEVA 2EHGA 4B8AB 5KQDA 4CF1A 5AR0A 1NK4A 3QKBA 4FWSA 1HRHA 5AQOA 2O4GA 4H5NA 4IXCA 4CZMA 5BN9A 2A1RA 2GWKA 4CHZA 4XEIA 1L5UA 2P9SB 4RCHA 3OVNA 1RDBA 2RPIA 3MXIA 4BC3A 2YNHA 1N6QA 5FPMA 2A5XA 4GW6A 4DLEA 1Y9XA 1IO2A 1Q18A 3IG1A 3ULEA 4CZFA 4EAHD 3IABA 5AQGA 4KAZA 3QDKA 1S1VA 3ID8A 3L3VA 2BANA 4N47A 3VESA 4DFMA 5BRHA 1FKOA 4KPYA 3CC2N 4NZTM 4KREA 2P9LA 3QO9A 4H0OA 1KVAA 3RRGA 5M1OA 2HVHA 4CEAA 3U3GA 2E2PA 2ETJA 3BGRA 1FKPA 3BY5A 5E26A 1BIZA 4DTOA 1HNXK 3P4IA 1TK0A 1RT4A 2O8BB 4I9QA 4LF8K 3RVCA 4CJLA 3MEDA 1TKDA 1RCHA 1ESVA 3FZMA 3M8RA 1VSEA 1YT3A 4E7HA 1YHQN 1WBBA 4FJHA 4MO4A 1TKXA 3H08A 3C65A 4JI2K 2PYJA 3D0PA 3MXMA 1HNVA 2D0AA 1IJJA 4JHDB 3M8QA 3J7AP 4QOZB 2IIRA 4W5OA 4K8ZA 1TAQA 1QZ6A 2E6MA 3AAPA 3CCQN 3NGZA 3OYKA 4CJWA 4DV6K 3P38A 2QK9A 3V4IA 1K4LA 1C1CA 2V52B 3O3GA 4FOEA 2HB5A 4PUOA 3AVGA 4FJ8A 4BWJA 1C0FA 4QS7A 2F9WA 3MCAB 5CE3A 4CECA 3KK2A 2ZQBA 4CK3A 2ASMA 3LVKB 1JLGA 4WF9L 4CZLA 1JDQA 4YOVA 3O9SA 4YOWA 3CPWM 4CF9A 1KTQA 3QLHA 2NNWA 2P9BA 1OH6A 3MK5A 2QI2A 2UUCK 3RR8A 1IV0A 4FM1A 1HKCA 3D2EA 2P9NB 2QWMA 1XNRK 2YX6A 3J7YP 1HC7A 2BH1A 1BWFO 1VQNN 1HNIA 1NGDA 3HXMA 1GLCG 4NCBA 2P9KA 4BDPA 3D45A 4IFEA 1NGIA 2RF2A 2HMPA 4CZHA 1Z26A 1ASUA 4RWTA 4W5RA 4EZ6A 3FR0A 3AAQA 5GAGP 5C2FA 1JE3A 1R0AA 4YDQA 4PKHA 4FBWA 3OYGA 4MQ3A 1D8YA 4DTXA 3LS6A 3O08A 2X6NA 4NYNA 3K59A 4B3OA 4JI1K 3C7NA 1U47A 4LD0A 3CIPA 5AZJA 3ZSVA 2EWSA 4CF0A 1T3VA 3HYFA 2Q36A 4IEIA 4JK7A 1EX4A 4KHPK 4DHYA 4JI7K 3PIOL 5AFUH 3PIPL 4BRDA 1JXBA 4JKAA 1VSFA 3GOIA 3CJCA 4DFJA 4EHTA 5CY4A 3O80A 1IBKK 1VQLN 4DU3A 3QICA 4I2PA 2VGMA 3D6RA 1OH5A 4BR0A 3EZ5A 3ENBA 4B1WB 4NXNK 4ID5A 4HWIA 1K8AO 3AA4A 1BU6O 1G99A 1RTIA 4RW9A 1EWRA 3SNNA 4FXDA 5E41A 2YNIA 4FJLA 1GLAG 3WEEA 4LF4K 1HX1A 2KTQA 3KD1E 2IS3A 4CEBA 1QVFM 2W42A 3MWTA 3OYCA 4EP5A 2YCHA 3EY1A 3OYBA 3AVLA 3MX2A 3T19A 3TAEA 3EZWA 4CK2A 1P8ZA 2KHOA 4LSNA 1CZ9A 3OS1A 3LP1A 4UY8O 4KB0A 1K8KB 2JWKA 3EN9A 4BRCA 4E1MA 4AH9A 4J2AA 3M8SA 3CI5A 4NCXA 1HUXA 1KQSM 3KK3A 1NJWA 4B1XB 4PL8A 3O4QA 4H5WA 4AHSA 3FFIA 3ZT4A 2FC0A 4MDBA 4CGHA 2DPNA 3DLBA 4AHCA 1BO5O 5BPLA 3OTOK 1EP4A 5C0YA 2YI1A 1KLMA 3SJJA 3VENA 2YHWA 4M3UA 1QTMA 1JCEA 3DLKA 3P1GA 1SKSA 4TSXA 1NJ6A 4FZZA 4B9UA 5DMRA 4DQPA 3T1YK 3PSFA 4CW7B 1CZBA 2O8FA 5BRDA 3ZSOA 4IOXA 5C2DA 4LH4A 3HOSA 3OYLA 4KH5A 2E88A 3K5LA 1S9GA 1BI4B 3QBWA 2ASOA 3I0RA 5ADXH 2EH1A 3TTDA 3LVJC 4KHNA 2HHXA 1SKRA 2YKNA 3HO1A 2FXUA 4FJ7A 3BDPA 3RTVA 2HNZA 3HTVA 5AFUA 1C0GA 3AVMA 2F9TA 3B6PA 3FE1A 3A5MC 3MCPA 3CPEA 1VQ6N 1JJ2M 5AQXA 5LY3A 4B9QA 3CM6A 4CERA 4Z4FA 2LN3A 4CJ5A 4CGIA 4OKEA 4GY2B 4JI3K 1E3MA 2KZMA 5CR4A 2I5JA 4YOYA 5B8HA 3QESA 3TU5A 1ZXOA 4B1VA 4E19A 1ZBFA 3DSDA 4DV7K 1JCUA 3KK7A 4LSLA 4QS9A 4KV8A 3QEWA 3BUZB 4QAGA 5AQJA 3DXKB 1ZYQA 2IVNA 3ZLJA 4KH6A 1NJ2A 1KVBA 3AY9A 3IUCA 3SQ0A 4Y0WA 4M3RA 3BP8A 1GLEG 2VWBA 4DUYK 5KRTA 1CXUA 1YIJN 1U4BA 1MWMA 1Q81O 1L3UA 4JS5A 4DS5A 2GUPA 2ZJPL 3THXA 1SV5A 3O9TA 4BC2A 4F9OA 1ZBSA 3MAQA 3E9OA 1RTHA 4ID1A 3K58A 4FJIA 4AILC 5FRMA 4KRFA 4FO0A 2HHVA 4FWMA 2HBLA 1BHLA 3VQQA 4JEPA 3NF6A 5HL7L 3LZJA 3V1QA 4CJPA 3WXMB 4CJRA 1VSMA 4JI5K 3L4QA 1NH9A 1X9WA 1J9AA 3MN9A 2OCEA 1LWCA 1T6CA 4I6MB 4WE1A 4B9LA 5ADXA 2FF6A 3RMDA 2O8EB 3DMJA 1QQNA 3VEYA 3NVKA 4ILHA 3SUNA 3LQUA 4O0IA 3OYFA 3HRGA 4M3TA 1VQ7N 2NRZA 5GIPA 1UAXA 4LFCK 1C6VA 3OS0A 1J6ZA 2BGGA 3K9KA 3OYMA 1X9SA 4B1UB 1Y2IA 1YAGA 3SUQA 4NZRM 4UQGA 2PAVA 4BE0A 4MLHA 4A5BA 3OYDA 2XY8A 3ATUA 1L3SA 4MFBA 1ITGA 4JI0K 1G15A 5HROA 4DU1A 3NCIA 1RT5A 1NGBA 1X3NA 5FPNA 1YJNN 2W6LA 3GDQA 3VGMA 4BGAA 4CBXA 2HW3A 3PX4A 2OYQA 2HF3A 2NZTA 1C0MA 3WXKA 1KCFA 3H1QA 2PFUA 1VQ8N 4ZTJA 4OLBA 3F2KA 1XI1A 2B6AA 5ELZA 3UKRA 3ID6A 4FLVA 3DWLA 5HRRA 2Q97A 3WXLA 2D0PA 3VTHA 4E1BA 3M8PA 2EX3A 2HHTA 1SKWA 3K5NA 4CJFA 4P6PA 1B9DA 3K5MA 2P5GA 3N4PA 3EE9A 4BR4A 4DV2K 4EZ9A 2KFNA 3MECA 3OBWA 2FBXA 2ZJQL 5DM6L 1XUPO 1BA1A 1RNHA 1QQOA 4K0KK 3L0QA 1HMVA 3KJVA 3WBMA 3J8AA 3VF6A 4ZTFA 4IDKA 2G8HA 1H4TA 1CZAN 3H07A 4JKBA 4FSVA 2P9SA 1WUAA 1RBRA 1NGCA 3RMCA 3U6FA 4KHQA 1QHAA 1W9HA 1X1PA 4DR7K 2GELA 3TOEA 1QSLA 1RGIA 1YVNA 4CESA 2XY5A 1D9FA 5C24A 3QB0A 2VGNA 3O8MA 3G25A 3O1BA 3SBTA 3KLHA 1NKBA 5M1QA 1C0TA 4YDUA 4CIGA 2RIUA 5AZIB 4IO8A 1W97L 2ZD1A 3I33A 3AVNA 4CVNE 4NXMK 5AQPA 4O8UA 3M6GA 3TAFA 1K6YA 3H3OB 2F7TA 1BDGA 2G8UA 2WBNA 3CFOA 2PY5A 4B9NA 4BY9C 1Y97A 3AA2A 3V9SA 3IALA 3V9WA 5JLHA 2P9IB 4OX9K 4JKEA 1ZBHA 4JV5K 5HRSA 3ZT0A 1BIUA 3SQ1A 4CK1A 1Z25A 3QEIA 4CJQA 1WLJA 3G0ZA 4M7XA 3SJHA 4CHOA 3QIPA 1V4SA 1TKSA 3LP0A 3W0LA 2VWJA 1RBUA 4BE2A 2WOMA 3A5OC 4YHHK 1YVUA 5M1FA 4IFVA 4M63C 3CM5A 1S8EA 1J54A 4JHDA 4FJKA 1ASVA 1NG9A 2HHSA 2Q1NA 2KLAA 3L4IA 4JD2B 3TAGA 2EQAA 3L6QA 2NRRA 4BG9A 3PLAA 2UUBK 3BEXA 4M3ZA 2FSJA 2HF4A 1TYQA 2Q0RA 4U67L 4Z4GA 4N41A 4ISGA 4HVJA 2A2YA 1NJZA 5AQUA 3ZX3A 3V1RA 1A5WA 4H5VA 3KKSA 1YJWN 5CZ1A 2E2QA 4A57A 3JYTA 4AM7A 2X6SA 3E9LA 3HP9A 4FCYA 3OYIA 3C0BA 4P6DA 4ISFA 1UA1A 5BN8A 4DSKA 3J7ZO 3RMAA 5CYQA 3VOVA 5C25A 3M3ZA 5LL6Z 3CC7N 5JS2A 3NGIA 4OGCA 4C1NK 5BR8K 3AVFA 4B3MK 2B5JA 1KXPA 3S3MA 4BROA 4JI6K 4O44A 4CBWA 2HNYA 5M1NA 4GNIA 4OJRA 2H9UA 4PWDA 5K14A 3WNGA 3T3FA 4I7FA 2LXRA 1X9MA 1TGOA 3C6AA 3DRSA 2QWQA 1RDWX 3KTQA 3L2UA 2F4VK 2UYTA 4X65K 1T03A 3BF1A 3CCMN 3O3FA 4I9LA 2OTJN 1BOTO 3CHWA 2VYPA 2V51B 3JAMO 3WXJA 3NHGA 3CFPA 1QQMA 4YKEA 1P90A 4FZYA 4NB4A 1S72N 4JLHA 4KHWA 1QSYA 1JO0A 2D0BA 3HSTB 2Q31A 3WXIA 1HPMA 1S1WA 3PV8A 4JK8A 4ZHRA 5JS1A 2YV0X 1JL1A 5I3UA 2P9UB 4HCBA 3AVAA 1TKUA 1T05A 3D2FA 5JLFA 3I8DA 1RBSA 5GIOA 1NKCA 2OPQA 2QWLA 1HKGA 2R7YA 2P9PB 1X9JA 5M1KA 4XH4A 1Z05A 4YOXA 2B4JA 2V7ZA 1RDAA 4U7BA 1S6QA 3RSEB 4KTWA 4DR4K 3M5RA 1LAWA 1XC3A 2BTFA 1FK9A 4K86A 4X62K 4F3TA 1QVGM 3OYAA 3AARA 4JRPA 3U9DA 3O3HA 1TL1A 5MLCQ 4DTUA 4DTJA 2V7YA 3CYMA 4HVZA 2Y1BA 2QWOA 3WT0A 5HBMA 1S1XA 4E1NA 3HZ7A 2VQEK 3CCVN 3EKUA 3TAMA 4CZIA 2BDPA 4TWAA 5GAEP 3SAHA 2OPSA 1DCJA 4Z4EA 1QQCA 2E2OA 2QTDA 4CJUA 2UXDK 2P5OA 4DV3K 1RTDA 4JKGB 1YJ9N 5J2PA 4DF4A 1K8KA 3SQ2A 4YFUA 3DLRA 5C15A 1EQYA 4EP4A 4MO5A 4KI4A 3PY8A 5J1EA 4DR1K 2W40A 1WSHA 3LPUA 4AM6A 4Y1DA 4CGFA 3CCRN 4H4MA 3K5OA 1RDUA 4G1QA 2W41A 3NMUA 4XH1A 3W3DA 4E89A 2ATQA 2XO7A 1XNQK 1GOAA 4B9TA 4FFJA 2DY4A 2A3ZA 4LF5K 3C6UA 1QHTA 1Q7YO 1BUPA 3VA0A 4CGJA 4LH5A 4KH4A 4DR2K 4BGBA 4OPHA 3T7ZA 2OA8A 4FLUA 3VGLA 1CXQA 2E1YA 1BL3A 5SWMA 5TKWA 3THYB 2Q3SA 4GVMA 3ZX0A 5HRPA 1BI4A 3SK3A 3TANA 3QMLA 4CGDA 3QEPA 2O8CB 3RMBA 3SV4A 3SUPA 4CJEA 3ZIEA 3DOKA 1F21A 2HHUA 2ZM6K 3HP6A 2KZZA 2D5RA 1LW2A 4FPAA 5FROA 1KRPA 3LDQA 4JKCA 4K43A 4CEQA 1DT9A 2PYLA 1IKWA 3NF9A 3AVCA 3VQ7A 3QNOA 1RDCA 2FBTA 3ZSRA 2RHKA 1NJ8A 4CJ7A 4BRLA 4CIFA 1WB9A 3DSCA 5KTQA 1KK9A 4A61A 1C1AA 3E66A 3DLEA 3AA3A 3A0IX 5SZTA 3NBPA 3KLFA 2LSNA 3LALA 1IG9A 3LDSA 1TKTA 3L8BA 4M45A 1ATSA 3CCJN 1NK6A 3KK1A 1RBTA 4YORA 5FLXO 5H1SQ 1TIGA 4FYDA 1NGGA 4KI6A 2HSTA 3H1VX 4B1ZA 1W2BM 3IMXA 4IKFA 2CGJA 3IABB 3VQ8A 3VEWA 3DXKA 4WYBA 3V6DA 2BUPA 3DI6A 1MA9B 4DQSA 4O5FA 2Q0UA 1U04A 1H0XA 4IWVA 4FZXC 4OPKA 4H0XB 5C12A 1Z6RA 3LP2A 5GAHP 4E7IA 3NFAA 2Q2RA 1BGXT 4DSFA 4J2BA 2YHXA 3FGUA 3U9ZA 3I8BA 4KTQA 5EVZA 4FWQA 1KD1O 2OTLN 3THWB 4FK4A 2KKZA 1T8EA 1U6ZA 4F2RA 3A5NC 4FW2A 1E4GT 3VEXA 5T7BA 4AHUA 4FLTA 4KHUA 1JCGA 3KWIA 1NBWA 1O13A 2O4IA 4Q5VA 4JI8K 1ILYA 4I6MA 1BQMA 3LRJA 1JXEA 2O8EA 4CFBA 1KFDA 4HD0A 2VQFK 4GKJK 4IOAL 3NH1A 4AHTA 4CJ3A 1WOQA 3TTCA 1KAZA 4IFYA 1NK9A 4I2QA 2QKKA 1TKZA 1ATRA 4P8JA 3VPZA 4FK2A 2Z1JA 3TWHA 1NFJA 4H0VB 1RDDA 3E1YA 3VETA 5J2QA 2JLEA 3G6EN 1GLFO 2DTUA 3GG4A 4FJNA 4AHRA 4RG8A 3QERA 2G8WA 4Y1CA 4DQIA 4GV3A 3WNEA 3FFKB 4FPBA 3TI0A 1HYZA 4HTUA 2E1ZA 3O4NA 3OY9A 1U48A 3LDPA 5KI6A 5IT9O 3AVBA 2CGKA 1NGEA 1EWQA 1B92A 4CHQA 4CCHA 1QE1A 3U3YA 4EHUA 1S9EA 3V9XA 2GV9A 2HHHK 3OYJA 4FOIA 4E3SA 3GE1A 4M7YA 2YJFA 4RW6A 3CMAN 4BDZA 4O5BA 1K9MO 3DLLL 2A40A 5GINA 3SV3A 4V19S 2RISA 4HVCA 3HM8A 4PL7A 3HVTA 3TABA 1WSFA 1VQ4N 4NO7A 3EL2A 3VQPA 3HVRA 1YF5L 4WFNL 4OO1J 5KGXA 1VQON 3J81O 3KKRA 4ISEA 2VG5A 1IEZA 5CZ2A 4IBNA 1NK5A 2OPPA 3E9PA 4BRHA 4WCEL 1U2VA 4BDYA 2E5LK 3HJFA 4WQ4A 5HLFA 3MX5A 3SMPA 2CH6A 4B9MA 3SQ4A 2YNFA 3LAMA 5AZIA 3AVJA 3K0SA 3ATVA 4ILGB 3ZIHA 2X78A 1GLBG 2QA4N 4PA1A 3RRHA 1HNZK 1TVRA 2J4RA 4WQ5A 1RQ8A 5HOOA 2OPRA 5LMUK 1FJGK 1U49A 3L2VA 2D4WA 2ZWHA 4M3YA 2IAJA 1BCMA 5DM7L 4KTZA 3RR7A 2P9IA 3MWPA 5AQTA 1RBVA 4CEEA 4FLXA 1NKEA 3OHRA 3T1HK 1KVCA 4CEOA 3EEQA 4CFAA 3NVMA 3CD6N 3WNHA 3MMVA 4Z4CA 4C8KA 2G8IA 3L3UA 4QS8A 1IH7A 4JKHA 4MDAA 4NCGA 4DLGA 4JD2A 4FBQA 1IKXA 4CHYA 1TAUA 3ZIIA 4KFBA 4DTMA 4HHTA 4C23A 5JMVA 3ZEUB 3FZKA 1T44A 4K25A 3PSIA 4BRKA 4CHNA 1PVYA 1YTAA 1KC8O 2WC9A 3QIOA 2GUIA 1FW6A 4ELTA 2PZSA 2FBVA 5EOYA 1KSPA 1IBMK 4NCAA 2PBDA 2VG6A 4DSLA 2RN2A 2HVIA 3AO5A 4E7JA 2EK0A 3LPTA 5GADP 3HK2A 1YITN 4IG3A 2Y1JA 1BISA 1K73O 3CMEN 4H0PA 3CCUN 1H4SA 4HUFA 2QM1A 1Y64A 2IDOA 2NLXA 3AGRA 4JAXA 1NGAA 1EXQA 2A41A 4KBOA 2IOCA 1J5OA 4Z4IA 3OJUA 1YUWA 4HUGA 2QEXN 3DM2A 4P77A 2FLOA 3NH2A 4DFKA 5KRSA 4YOUA 3HOTA 1MU2A 2E6LA 4H8KA 2G8VA 2AJQA 3R9PA 4JS4A 1RILA 4KHSA 3U6YA 1XWLA
chains in the Genus database with same CATH topology
3L7VA 1T3VA 3O1WA 3T69A 5FPDA 1E4FT 2Q36A 4IEIA 4JK7A 2P9UB 4MLEA 1TKUA 2NRTA 4DHYA 1EO1A 2FSNA 3D2FA 4LC9B 5JLFA 4BRPA 2P9UA 5GIOA 3CCLN 3PIOL 2QWLA 5AFUH 1HKGA 3GBTA 2P9PB 4H5RA 3UE5A 4BRDA 2GTDA 3PIPL 1VQ5N 1X9JA 2A42A 4JKAA 2P9PA 3GOIA 3CJCA 1G58A 5M1KA 3HSCA 4XH4A 1Z05A 4EHTA 4YOXA 3O80A 2V7ZA 2D1KA 1VQLN 4U7BA 3RSEB 3FZLA 3M5RA 3QICA 2FF3B 1XC3A 2JWLA 2BTFA 2VGMA 3HI0A 3D6RA 3HZ6A 1ATNA 3JS6A 3RSEA 2HBKA 4BR0A 3ZIGA 1VAZA 1QVGM 3ENBA 4PHTX 5AQFA 4B1WB 3AARA 3MGZA 3U9DA 5MLCQ 4HWIA 3VGKA 1K8AO 5AQVA 1BU6O 1G99A 2V7YA 3WEEB 3R8EA 1VQMN 4HVZA 2QWOA 3A8YA 3WT0A 1GLAG 3WEEA 1HX1A 3CQXA 3VMFB 3UB5A 1NM1A 3EKUA 3CCVN 1NJIO 3JXUA 1QVFM 4CZIA 3MWTA 3QFUA 5GAEP 3SAHA 4BVPA 2WFBA 4G9ZA 3CETA 2YCHA 1MDUB 3A5LC 5EY4A 2QTDA 2E2OA 3MX2A 3FLCO 2CGLA 3EZWA 3Q7CA 1P8ZA 2KHOA 3CJBA 4FWRA 5AQIA 3UKUB 4BRGA 1OKJA 4UY8O 2HOEA 4JKGB 1K8KB 3UKUA 1YJ9N 2JWKA 3EN9A 4C1NI 1SNNA 4BRCA 4OPAA 1V4TA 4JKGA 1K8KA 3CI5A 3K9JA 2ZGYA 5C15A 1HUXA 1EQYA 1KQSM 4MO5A 4JKFA 1GLLO 3R1XA 4B1XB 4I14A 4PL8A 4H5WA 4CBUA 4MDBA 2DPNA 3U4LA 1NMDA 4O8KA 5AQLA 1BO5O 2W40A 5BPLA 2D0OA 2MX1A 3CCRN 4AM6A 4WFBL 5AQRA 5C0YA 2YI1A 4GVEA 1RDUA 1SS6A 2W41A 3NMUA 4XH1A 3VENA 2YHWA 5M1PA 3W3DA 4BQLA 4FVUA 3TSPA 1JCFA 1SQKA 5KQ8A 1JCEA 1MWKA 3DXMB 5F2RA 4H03B 4GV9A 3DXMA 5BPMA 3P31A 4FFJA 2A3ZA 2ASPA 3CJ7A 1XEZA 5BRDA 2QWRA 5BREA 4IOXA 5C2DA 1Q7YO 1BUPA 1SAZA 3VF4A 4KH4A 5JICA 4KH5A 3HOSA 4BGBA 4OPHA 2E88A 3T7ZA 1T6DA 3LM2A 3VGLA 2E1YA 3QBWA 2ASOA 2P9NA 5TKWA 3LM9A 3ZX0A 5ADXH 3TTDA 3SK3A 3B8AX 3QMLA 5F0XA 5I9EB 3UKRB 3ZIEA 1OVYA 4IJAA 4CZJA 2FXUA 4FPAA 3ENOA 1NLVA 3LDQA 4JKCA 4K43A 3HTVA 3D7EO 1GLJO 5AFUA 3O9UA 1DT9A 1C0GA 2YJEA 3O5BA 3GL1A 3O9QA 3H6EA 2F9TA 1QZ5A 2RE2A 3FE1A 3A5MC 3MCPA 3QBXA 3CPEA 1VQ6N 1JJ2M 1BG3A 3MK6A 2RHKA 5JVHL 3VTIA 5AQXA 5F1XA 5LY3A 3VEZA 4B9QA 4BRLA 4CJ7A 2LN3A 3KZBA 1KK9A 4A61A 5AQNA 3E66A 3CC4N 5KPTA 1XQSC 1HKBA 5AQZA 4BC5A 4BC4A 3A0IX 4GY2B 4EFHA 3CJAA 2IVOA 3ZX2A 3CCEN 1S22A 5CR4A 4YOYA 5B8HA 1KAXA 3FZFA 5CHIA 3TU5A 4PKIA 1ZXOA 5EX5A 1ATSA 4B1VA 3CCJN 4EO0A 2H3GX 4YORA 3SLCA 3I55N 1K4IA 5H1SQ 3CXCM 3KK7A 3H46O 3CJ9A 1NGGA 4QS9A 3SAFA 1JCUA 3EKSA 2HSTA 3H1VX 3BUZB 2VCPA 4B1ZA 1W2BM 3IMXA 2CGJA 3FZHA 5AQJA 4A62A 3DXKB 2E20A 2GX9A 2IVNA 3VEWA 3ENHA 3DXKA 4KH6A 4WYBA 1U2VB 3AY9A 3IUCA 2BUPA 5LJWA 4Y0WA 1MA9B 3BP8A 1NGFA 1X3MA 1GLEG 2AA4A 4O5FA 1YXQA 2Q0UA 2VWBA 4IZ9A 2GEMA 1HLUA 4IWVA 1YIJN 1Q81O 1MWMA 4FWNA 3ZYYX 3IFRA 4H0XB 2GUPA 4NLCA 3TTFA 5C12A 4FL9A 2ZJPL 4IJNA 1Z6RA 4PKGA 5GAHP 3O9TA 2Q2RA 4CZEA 3I56N 1IG8A 3KHYA 3ZETB 3O4WA 5EXWA 4BC2A 2HBJA 4F9OA 2YHXA 3FGUA 3U9ZA 3I8BA 1ZBSA 3ZETA 3E9OA 5BRFA 1BA0A 1NGHA 4FO0A 4HTLA 4FWMA 2HBLA 3TPQA 2OANA 5HL7L 4JEPA 5EVZA 4FWQA 4E1JA 4BR2A 1KD1O 5AQWA 5AQHA 2I7PA 2OTLN 4CI6A 4DCHA 3H45C 2KKZA 3OA9A 3WXMB 1U6ZA 1N8RO 2ZJRL 4JK9A 3A5NC 4DB3A 3L4QA 4BVOA 3LDNA 1E4GT 3VEXA 3MN9A 4A5AA 4IO9L 2IVPA 1JCGA 3AGKA 1NBWA 1O13A 1T6CA 2GWJA 3IKMA 3KWIA 4I6MB 4WQ4C 4EIAA 4BR9A 5ADXA 1ILYA 2FF6A 3H3NO 4YDUC 5TKYA 1VQPN 4I6MA 3QFPA 1QQNA 3VEYA 3SAGA 3KVGA 4ILHA 4BR5A 3MN6A 3N4QA 4IOCL 3NVKA 1VQ9N 3LDOA 3LQUA 3HRGA 1VQ7N 2NRZA 3HBTA 4FWLA 5GIPA 3DAWA 3R6MA 4AF1A 4IOAL 3EO3A 1WOQA 3TTCA 1J6ZA 4WQ5C 1KAZA 2NRWA 3K9KA 1YI2N 4B1UB 1YAGA 1ZC6A 4NZRM 4DQ8A 2PAVA 4MLHA 4P8JA 1ATRA 4JN4A 4A5BA 3VPZA 2YHYA 1LCUA 2FSKA 3ATUA 4J8FA 5FPEA 3AJEA 1TYQB 2NRXA 3CQYA 3OBYA 4CD1A 4H0VB 4JNEA 1R59O 4K41A 3E1YA 5JVGL 1NGBA 1X3NA 3VETA 3CERA 5FPNA 2AP1A 3MN7A 3G6EN 4XH5A 1GLFO 1YJNN 3GDQA 4L3QA 3VGMA 2QWNA 3GG4A 4JKDA 4K42A 4BGAA 4BRNA 4CBXA 3OW2M 3CJ1A 2HF3A 2NZTA 3VERA 3WXKA 1D4XA 3C6HA 3KWGA 3M1FA 5C10A 5AQKA 3H1QA 2PFUA 1VQ8N 4BRQA 4GV3A 3CCSN 3F2KA 3FFKB 3T1IA 5ELZA 3MN5A 4FPBA 3UKRA 3ID6A 2E1ZA 1GLDG 3DWLA 4CZKA 2Q97A 3LDPA 3WXLA 3G4SN 3MIOA 3TSQA 4B1YB 5AQYA 3S41A 2D0PA 1M90O 2CGKA 1Q86O 3VTHA 1NGEA 1SZ2A 4E1BA 3G71N 1HRUA 1KAYA 2NRHA 5KPRA 1RFQA 3TSUA 3F5TA 4NLBA 4EHUA 4P6CA 4P6PA 4A2AA 1H1VA 4A59A 4BQZA 5AQQA 3N4PA 2A6AA 3EE9A 3SMSA 3VEVA 4BR4A 4FWOA 4FOIA 5KQDA 3OBWA 1NWKA 3GE1A 4M7YA 5DM6L 2ZJQL 2YJFA 3O9RA 1XUPO 5AR0A 3CMAN 1VQKN 1BA1A 1DKGD 1K9MO 3DLLL 2A40A 1QQOA 5GINA 1M1KO 1TUUA 3L0QA 3WUHA 2RISA 2HBMA 4FWSA 3HM8A 4PL7A 5AQOA 4H5NA 4IXCA 3J8AA 5AQMA 3VF6A 4CZMA 5BN9A 4YOTA 2GWKA 4NO7A 1VQ4N 4XEIA 2P9SB 3EL2A 1K4OA 1CZAN 4RCHA 3H07A 4JKBA 4FSVA 2P9SA 4BC3A 1YF5L 1WUAA 4WFNL 4OO1J 1NGCA 5FPMA 2A5XA 3ULEB 1VQON 1IEZA 4BRFA 4ISEA 4ILJA 1Q18A 3R3LA 1QHAA 1LOTB 3ULEA 4CZFA 4EAHD 2GELA 3E9PA 5AQGA 4A2BA 3QDKA 4BRHA 4WCEL 1RGIA 1YVNA 3ID8A 1U2VA 3VESA 3BF3A 3QB0A 2VGNA 2P9LB 3P39A 3O8MA 3G25A 3O1BA 4WQ4A 3SBTA 5BRHA 3CC2N 4NZTM 4BR7A 5M1QA 3D2FB 3MX5A 2P9LA 4YDUA 4H0OA 2RIUA 5AZIB 3SMPA 4IO8A 1W97L 2CH6A 5M1OA 3I33A 5E84A 5AZIA 3WQTA 3LL3A 5AQPA 3ATVA 2E2PA 4ILGB 4O8UA 3M6GA 1K7JA 3ZIHA 4H0YB 1GLBG 2QWPA 3H3OB 4BG8A 2QA4N 2F7TA 1BDGA 2J4RA 4FCXA 4WQ5A 3P4IA 5E26A 2WBNA 4BY9C 5HOOA 3MDQA 5JLHA 2D4WA 2ZWHA 3RVCA 2P9IB 1NGJA 5DM7L 4BRAA 4JKEA 2P9IA 5BR9A 1ESVA 3P04A 3FZMA 3MWPA 4R79A 5AQTA 1YHQN 3Q7BA 1K4PA 4MO4A 4M7XA 3SJHA 4WFAL 3OHRA 3C65A 1TKSA 1DGKN 1V4SA 3W0LA 5BPNA 3EE8A 5LJVA 4IEEA 2CH5A 3NVMA 3A5OC 3WQUA 3CD6N 1PVWA 3MMVA 4JHDB 1IJJA 4CZGA 5M1FA 4M63C 2ZF5O 2IIRA 4JHDA 4QS8A 4FWKA 1QZ6A 2Q1NA 2KLAA 3L4IA 4JKHA 4MDAA 4GV6A 3AAPA 3CCQN 4JD2B 2EQAA 3L6QA 2NRRA 3U8XA 4BG9A 3PLAA 4JD2A 4FBQA 3LDLA 3BEXA 2FSJA 3P38A 2HF4A 4BREA 3ZIIA 1K4LA 1TYQA 2V52B 4FWPA 4FOEA 2Q0RA 4U67L 4C23A 3VEOA 3DJCA 5JMVA 3ZEUB 1S3XA 3FZKA 4ISGA 1T44A 3IDHA 4K25A 3ZEUA 4BRKA 5AQUA 3ZX3A 1PVYA 1C0FA 4QS7A 2F9WA 3MCAB 4H5VA 5CE3A 2E2NA 1YJWN 4IDHA 2E2QA 4A57A 2ASMA 1KC8O 2WC9A 4WF9L 4AM7A 4H5TA 4CZLA 4YOVA 3E9LA 3O9SA 2WUSA 5EOYA 4YOWA 2QXLA 3CPWM 2E8AA 3C0BA 4P6DA 3CF5L 4ISFA 5AQSA 5BN8A 2NNWA 2P9BA 2PBDA 3VOVA 3J7ZO 3MK5A 2QI2A 3D2EB 3M3ZA 1TUYA 2QW9A 3CC7N 1K49A 3O6WA 4C1NK 3VF2A 1HJOA 1HKCA 2P9NB 2QWMA 3D2EA 4FBKA 3SBGA 2YX6A 2BH1A 1BWFO 5GADP 1Q82O 3F9MA 1KXPA 3LRJA 4BRIA 4BROA 1YITN 1VQNN 2I7NA 2P9KB 1NGDA 2ZGZA 4P8EA 1GLCG 4CD3A 4CBWA 5M1NA 2P9KA 4IFEA 4GNIA 1K73O 1NGIA 4Z94A 3CMEN 2HMPA 4H0TB 4H0PA 4CZHA 3CCUN 4RWTA 4RTFD 2QM1A 1Y64A 3C6AA 2NLXA 3FR0A 2QWQA 3AAQA 3AGRA 1RDWX 4JAXA 1NGAA 5GAGP 5KPZA 5C2FA 2UYTA 2A41A 3BF1A 4KBOA 3CCMN 4PKHA 2OTJN 4FBWA 1YUWA 2QEXN 1BOTO 1G57A 2ITMA 3LS6A 4P77A 3CHWA 3O08A 4DKWA 2VYPA 2FLOA 2NRVA 2V51B 3WXJA 4BRMA 3C7NB 1QQMA 4YOUA 1DEJA 3HOTA 4YKEA 1P90A 4NB4A 1S72N 3C7NA 5AZJB 3CIPA 2Q31A 3R9PA 5AZJA 3WXIA 1HPMA 4JK8A 2EWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTH A;  3VEX A;  3VEN A;  3VF2 A;  3TTD A;  3TTF A;  3TSP A;  3VEZ A;  3VEO A;  3TSQ A;  3VEW A;  3VET A;  3VTI A;  3VF4 A;  3TSU A;  3TTC A;  3VES A;  3VER A; 
#chains in the Genus database with same CATH topology
 3T69 A;  5FPD A;  4E7L A;  4CHP A;  1JLE A;  3WNF A;  1H0Y A;  4DS4 A;  4BRP A;  2P9U A;  3CCL N;  3GBT A;  1VQ5 N;  2A42 A;  3ZT2 A;  4BWM A;  4KB1 A;  2P9P A;  1A5V A;  5EU7 A;  1JLF A;  2D1K A;  1JKH A;  4W5Q A;  3HI0 A;  2JWL A;  2QXF A;  1WBD A;  5FRN A;  3AA5 X;  3HZ6 A;  1ATN A;  3JS6 A;  3RSE A;  2HBK A;  4CE9 A;  1Q9X A;  2O8B A;  3OYN A;  4DSJ A;  3ZIG A;  1VAZ A;  4PHT X;  5AQF A;  1SL2 A;  3MGZ A;  3VGK A;  5LMN K;  5AQV A;  1NK7 A;  3ISN C;  3R8E A;  1VQM N;  3OS2 A;  3CQX A;  1HQU A;  2O8D B;  3JXU A;  3VQA A;  2WFB A;  4G9Z A;  4CF8 A;  3CET A;  3HPH A;  1MDU B;  3A5L C;  5EY4 A;  4DV4 K;  3Q7C A;  3HT3 A;  5AQI A;  3UKU B;  4FWR A;  4BRG A;  1OKJ A;  4DQQ A;  2HOE A;  3LAK A;  2F8S A;  4JKG A;  1HQE A;  4Q15 A;  4N5S A;  4DUZ K;  3PUF A;  1GOC A;  4OLA A;  4JKF A;  1GLL O;  4CBU A;  4DMN A;  2F96 A;  3VQE A;  4O8K A;  2WTU A;  5AQL A;  2MX1 A;  2IFE A;  4K88 A;  1HYS A;  4WFB L;  2YHA A;  5AQR A;  4GVE A;  1SS6 A;  5HP1 A;  3EYZ A;  3TAP A;  4FVU A;  3TSP A;  1JCF A;  5KQ8 A;  4FJX A;  1MWK A;  3DXM B;  5D3G A;  5F2R A;  2Z1I A;  3V9Z A;  4O0J A;  2ASP A;  5A2Q O;  3CJ7 A;  1XEZ A;  5BRE A;  2QWR A;  1CLQ A;  1SAZ A;  3VF4 A;  5JIC A;  1UWB A;  1T6D A;  3LM2 A;  1BQN A;  2P9N A;  1Q9Y A;  5HRN A;  4K87 A;  3THY A;  4C8O A;  4KHY A;  3AO1 A;  1JLB A;  5I9E B;  1VSJ A;  3UKR B;  5IWA K;  1OVY A;  4DF8 A;  4DR3 K;  1LW0 A;  2O8C A;  3NF7 A;  1GLJ O;  1UOC A;  2YJE A;  3O5B A;  3GL1 A;  1NNE A;  2GTC A;  3H6E A;  2RE2 A;  1BG3 A;  5JVH L;  1NJY A;  3VEZ A;  2BKY X;  4Z9E A;  1XQS C;  5AQZ A;  4BC5 A;  3RWU A;  1W0H A;  3CJA A;  4DTN A;  2IVO A;  3ZX2 A;  3CCE N;  1S22 A;  2WON A;  1KAX A;  4CEZ A;  5CHI A;  3F9K A;  4C8L A;  4X66 K;  1VHX A;  4FM2 A;  1K4I A;  3CXC M;  3NGY A;  1WSG A;  3H46 O;  3SAF A;  3CFR A;  3QET A;  1XHX A;  2VCP A;  4LY7 A;  3NAE A;  3FZH A;  1EET A;  4ICL A;  4FJ9 A;  3ENH A;  1WN7 A;  1X3M A;  1YXQ A;  3DYA A;  4F2S A;  2GEM A;  1HLU A;  2BE2 A;  3VQB A;  3IAY A;  3ZYY X;  3SZ2 A;  1L3T A;  4CFC A;  1HJR A;  4PKG A;  1FXX A;  3HL8 A;  1Q8I A;  4CZE A;  5I42 A;  1IG8 A;  3KHY A;  3ZET B;  1S1T A;  1WSE A;  3O4W A;  5EXW A;  1SL1 A;  2HHW A;  2HBJ A;  5BRF A;  4M3X A;  2UXB K;  3ZT3 A;  1BA0 A;  4HTL A;  4BR2 A;  5AQW A;  1DTQ A;  4CI6 A;  4DCH A;  3OJS A;  3H45 C;  3VQC A;  3OA9 A;  1TK5 A;  3SPZ A;  3THW A;  4JK9 A;  2G8K A;  1LWF A;  4A5A A;  4IO9 L;  2IVP A;  3AGK A;  3IKM A;  1NK8 A;  4EIA A;  4BR9 A;  3H3N O;  4YDU C;  5TKY A;  2OZM A;  3F73 A;  3S3N A;  3SAG A;  1VSD A;  3MN6 A;  3N4Q A;  1VQ9 N;  3VQ9 A;  1UA0 A;  2D0C A;  3HBT A;  4FWL A;  3DAW A;  3R6M A;  4AF1 A;  3EO3 A;  1LN4 A;  4RW7 A;  1ZC6 A;  3J80 O;  3SYZ A;  5DK5 A;  4N76 A;  4M41 A;  4JN4 A;  3MXJ A;  1LCU A;  5J2M A;  5FPE A;  3NF8 A;  4DR5 K;  3V9U A;  1NFH A;  3DLG A;  1TYQ B;  1NMN A;  2NRX A;  1YTU A;  4CD1 A;  5CYM A;  4JNE A;  3PO5 A;  1D9D A;  5JVG L;  3ALY A;  2AP1 A;  3MN7 A;  4L3Q A;  3OW2 M;  4JKD A;  4K42 A;  2VG7 A;  2UXC K;  4F3O A;  2XRI A;  4KO0 A;  1D4X A;  3C6H A;  3M1F A;  5C10 A;  1NJ1 A;  3A2F A;  3C94 A;  3T1I A;  2HND A;  4CGG A;  4CZK A;  3MIO A;  3G4S N;  3TSQ A;  4B1Y B;  2DFE A;  4CIE A;  4K8X A;  5AQY A;  4X64 K;  2RKI A;  3G71 N;  1HRU A;  1WAF A;  1KAY A;  2NRH A;  5KPR A;  3TSU A;  4W5T A;  1SUQ A;  3SPY A;  3AVK A;  1N36 K;  4A2A A;  1H1V A;  4Z4H A;  4A59 A;  3DRR A;  4BQZ A;  3KLI A;  3VA3 A;  4FWO A;  1N34 K;  1NWK A;  4JYA K;  3O9R A;  4Q0B A;  3L2W A;  1VQK N;  4DR6 K;  1DKG D;  1NK0 A;  1M1K O;  1TUU A;  3NE6 A;  3WUH A;  2QKB A;  2HBM A;  4DV0 K;  4CJT A;  3CG7 A;  5AQM A;  3AVH A;  1VRU A;  4YOT A;  1K4O A;  3E01 A;  3MEE A;  3IRX A;  1VRT A;  3ULE B;  4BRF A;  4ILJ A;  3R3L A;  1LOT B;  4CFD A;  1S6P A;  1ASW A;  5FDL A;  4A2B A;  1BCO A;  3HM9 A;  2XHB A;  1S5J A;  3BF3 A;  2P9L B;  3P39 A;  4O4G A;  4FK0 A;  2IC3 A;  4BR7 A;  3D2F B;  4OPJ A;  3SCX A;  3ZSQ A;  5E84 A;  3WQT A;  2UUA K;  4E7K A;  3LL3 A;  3S3O A;  1K7J A;  4GMJ B;  4H0Y B;  4IG0 A;  2QWP A;  4BG8 A;  4FLW A;  4FCX A;  3PX0 A;  4E0D A;  3C6T A;  3MDQ A;  2Z1H A;  1RT1 A;  3ASM A;  4OKJ A;  4HUE A;  1NGJ A;  4BRA A;  1EKE A;  5BR9 A;  3P04 A;  4R79 A;  1A5X A;  3OYE A;  3ZSW A;  4W5N A;  3Q7B A;  4CJV A;  1K4P A;  4WFA L;  2KFZ A;  2DFH A;  4B08 A;  1DGK N;  3HPG A;  3P5J A;  4DV5 K;  5BPN A;  3EE8 A;  5LJV A;  4IEE A;  1HPZ A;  2F8T A;  2CH5 A;  4F4K A;  3WQU A;  1PVW A;  1D5A A;  1RT3 A;  1WSJ A;  4CZG A;  2XY6 A;  4FM0 A;  2ZF5 O;  4B8C A;  1L3V A;  4FWK A;  3VQ4 A;  4GV6 A;  1NU0 A;  1XMQ K;  4J2E A;  4RW4 A;  3QEX A;  4LF6 K;  3U8X A;  3L2R A;  4FVM A;  3LDL A;  1HNW K;  4OGE A;  4BRE A;  4DSE A;  4FWP A;  1T7P A;  2UU9 K;  3VEO A;  3C95 A;  3DJC A;  2HMI A;  1S3X A;  2FBY A;  1UDV A;  3VN5 A;  1C1B A;  3IDH A;  2W6K A;  3ZEU A;  4CJS A;  4BAC A;  4FW1 A;  2E2N A;  4IDH A;  3TAQ A;  1NJ5 A;  1JLA A;  1C0U A;  4H5T A;  1REV A;  1VR4 A;  2P1J A;  2WUS A;  2QXL A;  2E8A A;  3CF5 L;  3BZK A;  2IGI A;  3B6O A;  5AQS A;  3UIQ A;  3D2E B;  5AJ3 K;  1VM0 A;  1TUY A;  2QW9 A;  1K49 A;  3TR8 A;  3O6W A;  1JLQ A;  1HJO A;  3VF2 A;  3PO4 A;  4FBK A;  3SBG A;  1JL2 A;  1DTT A;  1VK0 A;  3F9M A;  1RT7 A;  4BRI A;  1Q82 O;  1J5E K;  2I7N A;  2P9K B;  3P83 D;  2ZGZ A;  4KKO A;  4P8E A;  3ZSX A;  4CD3 A;  4Z94 A;  4H0T B;  3K57 A;  1XC9 A;  2OZS A;  4B9V A;  1PAV A;  4RTF D;  4DTR A;  5KPZ A;  4HCC A;  3OYH A;  1OH8 A;  3THV A;  4ELV A;  4BE1 A;  3TAR A;  3VQ6 A;  3K2P A;  1G57 A;  4DG1 A;  2L8Y A;  4B3S K;  2KW4 A;  2ITM A;  4DKW A;  2NRV A;  4BRM A;  3C7N B;  1NOY A;  1IBL K;  5C42 A;  1TV6 A;  4PQU A;  1NOZ A;  1DEJ A;  5AZJ B;  3NH0 A;  4ELU A;  3ULD A;  3AO4 A;  5J2N A;  1U45 A;  2VWK A;  3L7V A;  4Z0U A;  3O1W A;  1E4F T;  3MEG A;  4MLE A;  2NRT A;  4YNQ A;  1EO1 A;  2FSN A;  4LC9 B;  3VQ5 A;  4AHV A;  3UE5 A;  1SL0 A;  3V1O A;  2Z7C A;  4H5R A;  2GTD A;  1OVQ A;  3ZCM A;  1G58 A;  3L2Q A;  1I39 A;  3HSC A;  3DLH A;  1IKY A;  2NUB A;  3FZL A;  2FF3 B;  4DQR A;  3AO2 A;  3SUO A;  4O55 A;  1RT6 A;  1TL3 A;  2JGU A;  1N32 K;  3WEE B;  3JSM A;  3A8Y A;  3LAN A;  3VQD A;  3UB5 A;  1NM1 A;  3VMF B;  1NJI O;  2Q3V A;  3QFU A;  3KD5 E;  4BVP A;  2O8D A;  4XIU A;  4CJK A;  3FLC O;  2CGL A;  3CJB A;  4LF7 K;  3UKU A;  1SNN A;  1HR0 K;  4C1N I;  3SI6 A;  4OPA A;  1V4T A;  3K9J A;  1JLC A;  2ZGY A;  1ZBL A;  4L8R B;  4I14 A;  3R1X A;  2E4L A;  2XY7 A;  4FLY A;  3V81 A;  4M42 A;  3U4L A;  1NMD A;  1I3A A;  2D0O A;  3ZSY A;  4OVL A;  1N33 K;  2X74 A;  1GOB A;  5M1P A;  3KLG A;  4BQL A;  1SQK A;  3LWL A;  3AVI A;  1LAV A;  4H03 B;  4GV9 A;  1O1W A;  3DXM A;  5BPM A;  3P31 A;  4DV1 K;  2O8F B;  1IKV A;  1B9F A;  1RT2 A;  4CEF A;  3LM9 A;  2M71 A;  3B8A X;  5F0X A;  2DFF A;  3AO3 A;  2A1S A;  4IJA A;  4CZJ A;  3ENO A;  1NLV A;  3D7E O;  1KLN A;  3O9U A;  4CED A;  2CRQ A;  4FLZ A;  1W7A A;  3O9Q A;  1QZ5 A;  3QBX A;  3MK6 A;  1II7 A;  3VTI A;  5F1X A;  4B3T K;  4OKK A;  4DFP A;  1LV5 A;  3KZB A;  5AQN A;  3CC4 N;  5KPT A;  1HKB A;  3DRP A;  4OLF A;  4BC4 A;  4B3R K;  1N5Y A;  1I94 K;  3ZSZ A;  4EFH A;  1LWE A;  3LWM A;  1WAJ A;  4JI4 K;  3FZF A;  3ITH A;  4PKI A;  5EX5 A;  4EO0 A;  1S1U A;  2H3G X;  3SLC A;  4NYF A;  3I55 N;  2HHQ A;  1WSI A;  3CJ9 A;  1VSI A;  4GKK K;  3T1A A;  3EKS A;  2ITG A;  4DTS A;  4PY5 A;  3NDK A;  4C8M A;  4A62 A;  4FJ5 A;  2E20 A;  2GX9 A;  1H4Q A;  1U2V B;  1KFS A;  5LJW A;  4DSI A;  2YHB A;  1NGF A;  2AA4 A;  4IZ9 A;  1DLO A;  4FWN A;  3THX B;  3IFR A;  4CF2 A;  4NLC A;  3TTF A;  4FL9 A;  4IJN A;  4YY3 K;  4LFB K;  4F8R A;  4N56 A;  1ZBU A;  3I56 N;  3I0S A;  3HPO A;  3ZET A;  3KIO A;  3BZC A;  2ZE2 A;  4AQY K;  3QEV A;  1NGH A;  3TPQ A;  4DWI A;  2OAN A;  4M3W A;  4E1J A;  5AQH A;  2I7P A;  4FJG A;  2P51 A;  4LFA K;  1VSL A;  4QCL A;  1N8R O;  2ZJR L;  2YNG A;  4DB3 A;  2Z1G A;  1VSK A;  3DOL A;  3LP3 A;  4BVO A;  3LDN A;  2GBZ A;  1QS4 A;  2KQ2 A;  1HYV A;  4WQ4 C;  2GWJ A;  4B9S A;  1VQP N;  3QIN A;  3QFP A;  3KVG A;  1QSS A;  4BR5 A;  1RTJ A;  4IOC L;  1OH7 A;  4R5P A;  4FJJ A;  3LDO A;  4H4O A;  3QNN A;  4CJ4 A;  5KGW A;  4WQ5 C;  2NRW A;  1YI2 N;  3S9H A;  4DQ8 A;  1WNS A;  2YHY A;  4LF9 K;  2FSK A;  4J8F A;  3AV9 A;  4WI1 A;  3AJE A;  3CQY A;  3OBY A;  1NJX A;  1R59 O;  4K41 A;  3IS9 A;  3G10 A;  3CER A;  4XH5 A;  2QWN A;  4DTP A;  4BRN A;  1TK8 A;  3CJ1 A;  4RW8 A;  3ZT1 A;  1XHZ A;  3CQ8 A;  2G8F A;  3VER A;  4J2D A;  3KWG A;  1ZBI A;  5AQK A;  4BRQ A;  3CCS N;  1VSH A;  3KLE A;  3MN5 A;  3LZI A;  4DU4 A;  1GLD G;  2Y1I A;  3S41 A;  3PX6 A;  1M90 O;  1Q86 O;  2YKM A;  1SZ2 A;  4JRQ A;  4FJM A;  1J53 A;  1RFQ A;  3F5T A;  4NLB A;  4P6C A;  1XMO K;  5AQQ A;  4C8N A;  2A6A A;  3SMS A;  3VEV A;  2EHG A;  4B8A B;  5KQD A;  4CF1 A;  5AR0 A;  1NK4 A;  3QKB A;  4FWS A;  1HRH A;  5AQO A;  2O4G A;  4H5N A;  4IXC A;  4CZM A;  5BN9 A;  2A1R A;  2GWK A;  4CHZ A;  4XEI A;  1L5U A;  2P9S B;  4RCH A;  3OVN A;  1RDB A;  2RPI A;  3MXI A;  4BC3 A;  2YNH A;  1N6Q A;  5FPM A;  2A5X A;  4GW6 A;  4DLE A;  1Y9X A;  1IO2 A;  1Q18 A;  3IG1 A;  3ULE A;  4CZF A;  4EAH D;  3IAB A;  5AQG A;  4KAZ A;  3QDK A;  1S1V A;  3ID8 A;  3L3V A;  2BAN A;  4N47 A;  3VES A;  4DFM A;  5BRH A;  1FKO A;  4KPY A;  3CC2 N;  4NZT M;  4KRE A;  2P9L A;  3QO9 A;  4H0O A;  1KVA A;  3RRG A;  5M1O A;  2HVH A;  4CEA A;  3U3G A;  2E2P A;  2ETJ A;  3BGR A;  1FKP A;  3BY5 A;  5E26 A;  1BIZ A;  4DTO A;  1HNX K;  3P4I A;  1TK0 A;  1RT4 A;  2O8B B;  4I9Q A;  4LF8 K;  3RVC A;  4CJL A;  3MED A;  1TKD A;  1RCH A;  1ESV A;  3FZM A;  3M8R A;  1VSE A;  1YT3 A;  4E7H A;  1YHQ N;  1WBB A;  4FJH A;  4MO4 A;  1TKX A;  3H08 A;  3C65 A;  4JI2 K;  2PYJ A;  3D0P A;  3MXM A;  1HNV A;  2D0A A;  1IJJ A;  4JHD B;  3M8Q A;  3J7A P;  4QOZ B;  2IIR A;  4W5O A;  4K8Z A;  1TAQ A;  1QZ6 A;  2E6M A;  3AAP A;  3CCQ N;  3NGZ A;  3OYK A;  4CJW A;  4DV6 K;  3P38 A;  2QK9 A;  3V4I A;  1K4L A;  1C1C A;  2V52 B;  3O3G A;  4FOE A;  2HB5 A;  4PUO A;  3AVG A;  4FJ8 A;  4BWJ A;  1C0F A;  4QS7 A;  2F9W A;  3MCA B;  5CE3 A;  4CEC A;  3KK2 A;  2ZQB A;  4CK3 A;  2ASM A;  3LVK B;  1JLG A;  4WF9 L;  4CZL A;  1JDQ A;  4YOV A;  3O9S A;  4YOW A;  3CPW M;  4CF9 A;  1KTQ A;  3QLH A;  2NNW A;  2P9B A;  1OH6 A;  3MK5 A;  2QI2 A;  2UUC K;  3RR8 A;  1IV0 A;  4FM1 A;  1HKC A;  3D2E A;  2P9N B;  2QWM A;  1XNR K;  2YX6 A;  3J7Y P;  1HC7 A;  2BH1 A;  1BWF O;  1VQN N;  1HNI A;  1NGD A;  3HXM A;  1GLC G;  4NCB A;  2P9K A;  4BDP A;  3D45 A;  4IFE A;  1NGI A;  2RF2 A;  2HMP A;  4CZH A;  1Z26 A;  1ASU A;  4RWT A;  4W5R A;  4EZ6 A;  3FR0 A;  3AAQ A;  5GAG P;  5C2F A;  1JE3 A;  1R0A A;  4YDQ A;  4PKH A;  4FBW A;  3OYG A;  4MQ3 A;  1D8Y A;  4DTX A;  3LS6 A;  3O08 A;  2X6N A;  4NYN A;  3K59 A;  4B3O A;  4JI1 K;  3C7N A;  1U47 A;  4LD0 A;  3CIP A;  5AZJ A;  3ZSV A;  2EWS A;  4CF0 A;  1T3V A;  3HYF A;  2Q36 A;  4IEI A;  4JK7 A;  1EX4 A;  4KHP K;  4DHY A;  4JI7 K;  3PIO L;  5AFU H;  3PIP L;  4BRD A;  1JXB A;  4JKA A;  1VSF A;  3GOI A;  3CJC A;  4DFJ A;  4EHT A;  5CY4 A;  3O80 A;  1IBK K;  1VQL N;  4DU3 A;  3QIC A;  4I2P A;  2VGM A;  3D6R A;  1OH5 A;  4BR0 A;  3EZ5 A;  3ENB A;  4B1W B;  4NXN K;  4ID5 A;  4HWI A;  1K8A O;  3AA4 A;  1BU6 O;  1G99 A;  1RTI A;  4RW9 A;  1EWR A;  3SNN A;  4FXD A;  5E41 A;  2YNI A;  4FJL A;  1GLA G;  3WEE A;  4LF4 K;  1HX1 A;  2KTQ A;  3KD1 E;  2IS3 A;  4CEB A;  1QVF M;  2W42 A;  3MWT A;  3OYC A;  4EP5 A;  2YCH A;  3EY1 A;  3OYB A;  3AVL A;  3MX2 A;  3T19 A;  3TAE A;  3EZW A;  4CK2 A;  1P8Z A;  2KHO A;  4LSN A;  1CZ9 A;  3OS1 A;  3LP1 A;  4UY8 O;  4KB0 A;  1K8K B;  2JWK A;  3EN9 A;  4BRC A;  4E1M A;  4AH9 A;  4J2A A;  3M8S A;  3CI5 A;  4NCX A;  1HUX A;  1KQS M;  3KK3 A;  1NJW A;  4B1X B;  4PL8 A;  3O4Q A;  4H5W A;  4AHS A;  3FFI A;  3ZT4 A;  2FC0 A;  4MDB A;  4CGH A;  2DPN A;  3DLB A;  4AHC A;  1BO5 O;  5BPL A;  3OTO K;  1EP4 A;  5C0Y A;  2YI1 A;  1KLM A;  3SJJ A;  3VEN A;  2YHW A;  4M3U A;  1QTM A;  1JCE A;  3DLK A;  3P1G A;  1SKS A;  4TSX A;  1NJ6 A;  4FZZ A;  4B9U A;  5DMR A;  4DQP A;  3T1Y K;  3PSF A;  4CW7 B;  1CZB A;  2O8F A;  5BRD A;  3ZSO A;  4IOX A;  5C2D A;  4LH4 A;  3HOS A;  3OYL A;  4KH5 A;  2E88 A;  3K5L A;  1S9G A;  1BI4 B;  3QBW A;  2ASO A;  3I0R A;  5ADX H;  2EH1 A;  3TTD A;  3LVJ C;  4KHN A;  2HHX A;  1SKR A;  2YKN A;  3HO1 A;  2FXU A;  4FJ7 A;  3BDP A;  3RTV A;  2HNZ A;  3HTV A;  5AFU A;  1C0G A;  3AVM A;  2F9T A;  3B6P A;  3FE1 A;  3A5M C;  3MCP A;  3CPE A;  1VQ6 N;  1JJ2 M;  5AQX A;  5LY3 A;  4B9Q A;  3CM6 A;  4CER A;  4Z4F A;  2LN3 A;  4CJ5 A;  4CGI A;  4OKE A;  4GY2 B;  4JI3 K;  1E3M A;  2KZM A;  5CR4 A;  2I5J A;  4YOY A;  5B8H A;  3QES A;  3TU5 A;  1ZXO A;  4B1V A;  4E19 A;  1ZBF A;  3DSD A;  4DV7 K;  1JCU A;  3KK7 A;  4LSL A;  4QS9 A;  4KV8 A;  3QEW A;  3BUZ B;  4QAG A;  5AQJ A;  3DXK B;  1ZYQ A;  2IVN A;  3ZLJ A;  4KH6 A;  1NJ2 A;  1KVB A;  3AY9 A;  3IUC A;  3SQ0 A;  4Y0W A;  4M3R A;  3BP8 A;  1GLE G;  2VWB A;  4DUY K;  5KRT A;  1CXU A;  1YIJ N;  1U4B A;  1MWM A;  1Q81 O;  1L3U A;  4JS5 A;  4DS5 A;  2GUP A;  2ZJP L;  3THX A;  1SV5 A;  3O9T A;  4BC2 A;  4F9O A;  1ZBS A;  3MAQ A;  3E9O A;  1RTH A;  4ID1 A;  3K58 A;  4FJI A;  4AIL C;  5FRM A;  4KRF A;  4FO0 A;  2HHV A;  4FWM A;  2HBL A;  1BHL A;  3VQQ A;  4JEP A;  3NF6 A;  5HL7 L;  3LZJ A;  3V1Q A;  4CJP A;  3WXM B;  4CJR A;  1VSM A;  4JI5 K;  3L4Q A;  1NH9 A;  1X9W A;  1J9A A;  3MN9 A;  2OCE A;  1LWC A;  1T6C A;  4I6M B;  4WE1 A;  4B9L A;  5ADX A;  2FF6 A;  3RMD A;  2O8E B;  3DMJ A;  1QQN A;  3VEY A;  3NVK A;  4ILH A;  3SUN A;  3LQU A;  4O0I A;  3OYF A;  3HRG A;  4M3T A;  1VQ7 N;  2NRZ A;  5GIP A;  1UAX A;  4LFC K;  1C6V A;  3OS0 A;  1J6Z A;  2BGG A;  3K9K A;  3OYM A;  1X9S A;  4B1U B;  1Y2I A;  1YAG A;  3SUQ A;  4NZR M;  4UQG A;  2PAV A;  4BE0 A;  4MLH A;  4A5B A;  3OYD A;  2XY8 A;  3ATU A;  1L3S A;  4MFB A;  1ITG A;  4JI0 K;  1G15 A;  5HRO A;  4DU1 A;  3NCI A;  1RT5 A;  1NGB A;  1X3N A;  5FPN A;  1YJN N;  2W6L A;  3GDQ A;  3VGM A;  4BGA A;  4CBX A;  2HW3 A;  3PX4 A;  2OYQ A;  2HF3 A;  2NZT A;  1C0M A;  3WXK A;  1KCF A;  3H1Q A;  2PFU A;  1VQ8 N;  4ZTJ A;  4OLB A;  3F2K A;  1XI1 A;  2B6A A;  5ELZ A;  3UKR A;  3ID6 A;  4FLV A;  3DWL A;  5HRR A;  2Q97 A;  3WXL A;  2D0P A;  3VTH A;  4E1B A;  3M8P A;  2EX3 A;  2HHT A;  1SKW A;  3K5N A;  4CJF A;  4P6P A;  1B9D A;  3K5M A;  2P5G A;  3N4P A;  3EE9 A;  4BR4 A;  4DV2 K;  4EZ9 A;  2KFN A;  3MEC A;  3OBW A;  2FBX A;  2ZJQ L;  5DM6 L;  1XUP O;  1BA1 A;  1RNH A;  1QQO A;  4K0K K;  3L0Q A;  1HMV A;  3KJV A;  3WBM A;  3J8A A;  3VF6 A;  4ZTF A;  4IDK A;  2G8H A;  1H4T A;  1CZA N;  3H07 A;  4JKB A;  4FSV A;  2P9S A;  1WUA A;  1RBR A;  1NGC A;  3RMC A;  3U6F A;  4KHQ A;  1QHA A;  1W9H A;  1X1P A;  4DR7 K;  2GEL A;  3TOE A;  1QSL A;  1RGI A;  1YVN A;  4CES A;  2XY5 A;  1D9F A;  5C24 A;  3QB0 A;  2VGN A;  3O8M A;  3G25 A;  3O1B A;  3SBT A;  3KLH A;  1NKB A;  5M1Q A;  1C0T A;  4YDU A;  4CIG A;  2RIU A;  5AZI B;  4IO8 A;  1W97 L;  2ZD1 A;  3I33 A;  3AVN A;  4CVN E;  4NXM K;  5AQP A;  4O8U A;  3M6G A;  3TAF A;  1K6Y A;  3H3O B;  2F7T A;  1BDG A;  2G8U A;  2WBN A;  3CFO A;  2PY5 A;  4B9N A;  4BY9 C;  1Y97 A;  3AA2 A;  3V9S A;  3IAL A;  3V9W A;  5JLH A;  2P9I B;  4OX9 K;  4JKE A;  1ZBH A;  4JV5 K;  5HRS A;  3ZT0 A;  1BIU A;  3SQ1 A;  4CK1 A;  1Z25 A;  3QEI A;  4CJQ A;  1WLJ A;  3G0Z A;  4M7X A;  3SJH A;  4CHO A;  3QIP A;  1V4S A;  1TKS A;  3LP0 A;  3W0L A;  2VWJ A;  1RBU A;  4BE2 A;  2WOM A;  3A5O C;  4YHH K;  1YVU A;  5M1F A;  4IFV A;  4M63 C;  3CM5 A;  1S8E A;  1J54 A;  4JHD A;  4FJK A;  1ASV A;  1NG9 A;  2HHS A;  2Q1N A;  2KLA A;  3L4I A;  4JD2 B;  3TAG A;  2EQA A;  3L6Q A;  2NRR A;  4BG9 A;  3PLA A;  2UUB K;  3BEX A;  4M3Z A;  2FSJ A;  2HF4 A;  1TYQ A;  2Q0R A;  4U67 L;  4Z4G A;  4N41 A;  4ISG A;  4HVJ A;  2A2Y A;  1NJZ A;  5AQU A;  3ZX3 A;  3V1R A;  1A5W A;  4H5V A;  3KKS A;  1YJW N;  5CZ1 A;  2E2Q A;  4A57 A;  3JYT A;  4AM7 A;  2X6S A;  3E9L A;  3HP9 A;  4FCY A;  3OYI A;  3C0B A;  4P6D A;  4ISF A;  1UA1 A;  5BN8 A;  4DSK A;  3J7Z O;  3RMA A;  5CYQ A;  3VOV A;  5C25 A;  3M3Z A;  5LL6 Z;  3CC7 N;  5JS2 A;  3NGI A;  4OGC A;  4C1N K;  5BR8 K;  3AVF A;  4B3M K;  2B5J A;  1KXP A;  3S3M A;  4BRO A;  4JI6 K;  4O44 A;  4CBW A;  2HNY A;  5M1N A;  4GNI A;  4OJR A;  2H9U A;  4PWD A;  5K14 A;  3WNG A;  3T3F A;  4I7F A;  2LXR A;  1X9M A;  1TGO A;  3C6A A;  3DRS A;  2QWQ A;  1RDW X;  3KTQ A;  3L2U A;  2F4V K;  2UYT A;  4X65 K;  1T03 A;  3BF1 A;  3CCM N;  3O3F A;  4I9L A;  2OTJ N;  1BOT O;  3CHW A;  2VYP A;  2V51 B;  3JAM O;  3WXJ A;  3NHG A;  3CFP A;  1QQM A;  4YKE A;  1P90 A;  4FZY A;  4NB4 A;  1S72 N;  4JLH A;  4KHW A;  1QSY A;  1JO0 A;  2D0B A;  3HST B;  2Q31 A;  3WXI A;  1HPM A;  1S1W A;  3PV8 A;  4JK8 A;  4ZHR A;  5JS1 A;  2YV0 X;  1JL1 A;  5I3U A;  2P9U B;  4HCB A;  3AVA A;  1TKU A;  1T05 A;  3D2F A;  5JLF A;  3I8D A;  1RBS A;  5GIO A;  1NKC A;  2OPQ A;  2QWL A;  1HKG A;  2R7Y A;  2P9P B;  1X9J A;  5M1K A;  4XH4 A;  1Z05 A;  4YOX A;  2B4J A;  2V7Z A;  1RDA A;  4U7B A;  1S6Q A;  3RSE B;  4KTW A;  4DR4 K;  3M5R A;  1LAW A;  1XC3 A;  2BTF A;  1FK9 A;  4K86 A;  4X62 K;  4F3T A;  1QVG M;  3OYA A;  3AAR A;  4JRP A;  3U9D A;  3O3H A;  1TL1 A;  5MLC Q;  4DTU A;  4DTJ A;  2V7Y A;  3CYM A;  4HVZ A;  2Y1B A;  2QWO A;  3WT0 A;  5HBM A;  1S1X A;  4E1N A;  3HZ7 A;  2VQE K;  3CCV N;  3EKU A;  3TAM A;  4CZI A;  2BDP A;  4TWA A;  5GAE P;  3SAH A;  2OPS A;  1DCJ A;  4Z4E A;  1QQC A;  2E2O A;  2QTD A;  4CJU A;  2UXD K;  2P5O A;  4DV3 K;  1RTD A;  4JKG B;  1YJ9 N;  5J2P A;  4DF4 A;  1K8K A;  3SQ2 A;  4YFU A;  3DLR A;  5C15 A;  1EQY A;  4EP4 A;  4MO5 A;  4KI4 A;  3PY8 A;  5J1E A;  4DR1 K;  2W40 A;  1WSH A;  3LPU A;  4AM6 A;  4Y1D A;  4CGF A;  3CCR N;  4H4M A;  3K5O A;  1RDU A;  4G1Q A;  2W41 A;  3NMU A;  4XH1 A;  3W3D A;  4E89 A;  2ATQ A;  2XO7 A;  1XNQ K;  1GOA A;  4B9T A;  4FFJ A;  2DY4 A;  2A3Z A;  4LF5 K;  3C6U A;  1QHT A;  1Q7Y O;  1BUP A;  3VA0 A;  4CGJ A;  4LH5 A;  4KH4 A;  4DR2 K;  4BGB A;  4OPH A;  3T7Z A;  2OA8 A;  4FLU A;  3VGL A;  1CXQ A;  2E1Y A;  1BL3 A;  5SWM A;  5TKW A;  3THY B;  2Q3S A;  4GVM A;  3ZX0 A;  5HRP A;  1BI4 A;  3SK3 A;  3TAN A;  3QML A;  4CGD A;  3QEP A;  2O8C B;  3RMB A;  3SV4 A;  3SUP A;  4CJE A;  3ZIE A;  3DOK A;  1F21 A;  2HHU A;  2ZM6 K;  3HP6 A;  2KZZ A;  2D5R A;  1LW2 A;  4FPA A;  5FRO A;  1KRP A;  3LDQ A;  4JKC A;  4K43 A;  4CEQ A;  1DT9 A;  2PYL A;  1IKW A;  3NF9 A;  3AVC A;  3VQ7 A;  3QNO A;  1RDC A;  2FBT A;  3ZSR A;  2RHK A;  1NJ8 A;  4CJ7 A;  4BRL A;  4CIF A;  1WB9 A;  3DSC A;  5KTQ A;  1KK9 A;  4A61 A;  1C1A A;  3E66 A;  3DLE A;  3AA3 A;  3A0I X;  5SZT A;  3NBP A;  3KLF A;  2LSN A;  3LAL A;  1IG9 A;  3LDS A;  1TKT A;  3L8B A;  4M45 A;  1ATS A;  3CCJ N;  1NK6 A;  3KK1 A;  1RBT A;  4YOR A;  5FLX O;  5H1S Q;  1TIG A;  4FYD A;  1NGG A;  4KI6 A;  2HST A;  3H1V X;  4B1Z A;  1W2B M;  3IMX A;  4IKF A;  2CGJ A;  3IAB B;  3VQ8 A;  3VEW A;  3DXK A;  4WYB A;  3V6D A;  2BUP A;  3DI6 A;  1MA9 B;  4DQS A;  4O5F A;  2Q0U A;  1U04 A;  1H0X A;  4IWV A;  4FZX C;  4OPK A;  4H0X B;  5C12 A;  1Z6R A;  3LP2 A;  5GAH P;  4E7I A;  3NFA A;  2Q2R A;  1BGX T;  4DSF A;  4J2B A;  2YHX A;  3FGU A;  3U9Z A;  3I8B A;  4KTQ A;  5EVZ A;  4FWQ A;  1KD1 O;  2OTL N;  3THW B;  4FK4 A;  2KKZ A;  1T8E A;  1U6Z A;  4F2R A;  3A5N C;  4FW2 A;  1E4G T;  3VEX A;  5T7B A;  4AHU A;  4FLT A;  4KHU A;  1JCG A;  3KWI A;  1NBW A;  1O13 A;  2O4I A;  4Q5V A;  4JI8 K;  1ILY A;  4I6M A;  1BQM A;  3LRJ A;  1JXE A;  2O8E A;  4CFB A;  1KFD A;  4HD0 A;  2VQF K;  4GKJ K;  4IOA L;  3NH1 A;  4AHT A;  4CJ3 A;  1WOQ A;  3TTC A;  1KAZ A;  4IFY A;  1NK9 A;  4I2Q A;  2QKK A;  1TKZ A;  1ATR A;  4P8J A;  3VPZ A;  4FK2 A;  2Z1J A;  3TWH A;  1NFJ A;  4H0V B;  1RDD A;  3E1Y A;  3VET A;  5J2Q A;  2JLE A;  3G6E N;  1GLF O;  2DTU A;  3GG4 A;  4FJN A;  4AHR A;  4RG8 A;  3QER A;  2G8W A;  4Y1C A;  4DQI A;  4GV3 A;  3WNE A;  3FFK B;  4FPB A;  3TI0 A;  1HYZ A;  4HTU A;  2E1Z A;  3O4N A;  3OY9 A;  1U48 A;  3LDP A;  5KI6 A;  5IT9 O;  3AVB A;  2CGK A;  1NGE A;  1EWQ A;  1B92 A;  4CHQ A;  4CCH A;  1QE1 A;  3U3Y A;  4EHU A;  1S9E A;  3V9X A;  2GV9 A;  2HHH K;  3OYJ A;  4FOI A;  4E3S A;  3GE1 A;  4M7Y A;  2YJF A;  4RW6 A;  3CMA N;  4BDZ A;  4O5B A;  1K9M O;  3DLL L;  2A40 A;  5GIN A;  3SV3 A;  4V19 S;  2RIS A;  4HVC A;  3HM8 A;  4PL7 A;  3HVT A;  3TAB A;  1WSF A;  1VQ4 N;  4NO7 A;  3EL2 A;  3VQP A;  3HVR A;  1YF5 L;  4WFN L;  4OO1 J;  5KGX A;  1VQO N;  3J81 O;  3KKR A;  4ISE A;  2VG5 A;  1IEZ A;  5CZ2 A;  4IBN A;  1NK5 A;  2OPP A;  3E9P A;  4BRH A;  4WCE L;  1U2V A;  4BDY A;  2E5L K;  3HJF A;  4WQ4 A;  5HLF A;  3MX5 A;  3SMP A;  2CH6 A;  4B9M A;  3SQ4 A;  2YNF A;  3LAM A;  5AZI A;  3AVJ A;  3K0S A;  3ATV A;  4ILG B;  3ZIH A;  2X78 A;  1GLB G;  2QA4 N;  4PA1 A;  3RRH A;  1HNZ K;  1TVR A;  2J4R A;  4WQ5 A;  1RQ8 A;  5HOO A;  2OPR A;  5LMU K;  1FJG K;  1U49 A;  3L2V A;  2D4W A;  2ZWH A;  4M3Y A;  2IAJ A;  1BCM A;  5DM7 L;  4KTZ A;  3RR7 A;  2P9I A;  3MWP A;  5AQT A;  1RBV A;  4CEE A;  4FLX A;  1NKE A;  3OHR A;  3T1H K;  1KVC A;  4CEO A;  3EEQ A;  4CFA A;  3NVM A;  3CD6 N;  3WNH A;  3MMV A;  4Z4C A;  4C8K A;  2G8I A;  3L3U A;  4QS8 A;  1IH7 A;  4JKH A;  4MDA A;  4NCG A;  4DLG A;  4JD2 A;  4FBQ A;  1IKX A;  4CHY A;  1TAU A;  3ZII A;  4KFB A;  4DTM A;  4HHT A;  4C23 A;  5JMV A;  3ZEU B;  3FZK A;  1T44 A;  4K25 A;  3PSI A;  4BRK A;  4CHN A;  1PVY A;  1YTA A;  1KC8 O;  2WC9 A;  3QIO A;  2GUI A;  1FW6 A;  4ELT A;  2PZS A;  2FBV A;  5EOY A;  1KSP A;  1IBM K;  4NCA A;  2PBD A;  2VG6 A;  4DSL A;  2RN2 A;  2HVI A;  3AO5 A;  4E7J A;  2EK0 A;  3LPT A;  5GAD P;  3HK2 A;  1YIT N;  4IG3 A;  2Y1J A;  1BIS A;  1K73 O;  3CME N;  4H0P A;  3CCU N;  1H4S A;  4HUF A;  2QM1 A;  1Y64 A;  2IDO A;  2NLX A;  3AGR A;  4JAX A;  1NGA A;  1EXQ A;  2A41 A;  4KBO A;  2IOC A;  1J5O A;  4Z4I A;  3OJU A;  1YUW A;  4HUG A;  2QEX N;  3DM2 A;  4P77 A;  2FLO A;  3NH2 A;  4DFK A;  5KRS A;  4YOU A;  3HOT A;  1MU2 A;  2E6L A;  4H8K A;  2G8V A;  2AJQ A;  3R9P A;  4JS4 A;  1RIL A;  4KHS A;  3U6Y A;  1XWL A; 
#chains in the Genus database with same CATH homology
 3L7V A;  1T3V A;  3O1W A;  3T69 A;  5FPD A;  1E4F T;  2Q36 A;  4IEI A;  4JK7 A;  2P9U B;  4MLE A;  1TKU A;  2NRT A;  4DHY A;  1EO1 A;  2FSN A;  3D2F A;  4LC9 B;  5JLF A;  4BRP A;  2P9U A;  5GIO A;  3CCL N;  3PIO L;  2QWL A;  5AFU H;  1HKG A;  3GBT A;  2P9P B;  4H5R A;  3UE5 A;  4BRD A;  2GTD A;  3PIP L;  1VQ5 N;  1X9J A;  2A42 A;  4JKA A;  2P9P A;  3GOI A;  3CJC A;  1G58 A;  5M1K A;  3HSC A;  4XH4 A;  1Z05 A;  4EHT A;  4YOX A;  3O80 A;  2V7Z A;  2D1K A;  1VQL N;  4U7B A;  3RSE B;  3FZL A;  3M5R A;  3QIC A;  2FF3 B;  1XC3 A;  2JWL A;  2BTF A;  2VGM A;  3HI0 A;  3D6R A;  3HZ6 A;  1ATN A;  3JS6 A;  3RSE A;  2HBK A;  4BR0 A;  3ZIG A;  1VAZ A;  1QVG M;  3ENB A;  4PHT X;  5AQF A;  4B1W B;  3AAR A;  3MGZ A;  3U9D A;  5MLC Q;  4HWI A;  3VGK A;  1K8A O;  5AQV A;  1BU6 O;  1G99 A;  2V7Y A;  3WEE B;  3R8E A;  1VQM N;  4HVZ A;  2QWO A;  3A8Y A;  3WT0 A;  1GLA G;  3WEE A;  1HX1 A;  3CQX A;  3VMF B;  3UB5 A;  1NM1 A;  3EKU A;  3CCV N;  1NJI O;  3JXU A;  1QVF M;  4CZI A;  3MWT A;  3QFU A;  5GAE P;  3SAH A;  4BVP A;  2WFB A;  4G9Z A;  3CET A;  2YCH A;  1MDU B;  3A5L C;  5EY4 A;  2QTD A;  2E2O A;  3MX2 A;  3FLC O;  2CGL A;  3EZW A;  3Q7C A;  1P8Z A;  2KHO A;  3CJB A;  4FWR A;  5AQI A;  3UKU B;  4BRG A;  1OKJ A;  4UY8 O;  2HOE A;  4JKG B;  1K8K B;  3UKU A;  1YJ9 N;  2JWK A;  3EN9 A;  4C1N I;  1SNN A;  4BRC A;  4OPA A;  1V4T A;  4JKG A;  1K8K A;  3CI5 A;  3K9J A;  2ZGY A;  5C15 A;  1HUX A;  1EQY A;  1KQS M;  4MO5 A;  4JKF A;  1GLL O;  3R1X A;  4B1X B;  4I14 A;  4PL8 A;  4H5W A;  4CBU A;  4MDB A;  2DPN A;  3U4L A;  1NMD A;  4O8K A;  5AQL A;  1BO5 O;  2W40 A;  5BPL A;  2D0O A;  2MX1 A;  3CCR N;  4AM6 A;  4WFB L;  5AQR A;  5C0Y A;  2YI1 A;  4GVE A;  1RDU A;  1SS6 A;  2W41 A;  3NMU A;  4XH1 A;  3VEN A;  2YHW A;  5M1P A;  3W3D A;  4BQL A;  4FVU A;  3TSP A;  1JCF A;  1SQK A;  5KQ8 A;  1JCE A;  1MWK A;  3DXM B;  5F2R A;  4H03 B;  4GV9 A;  3DXM A;  5BPM A;  3P31 A;  4FFJ A;  2A3Z A;  2ASP A;  3CJ7 A;  1XEZ A;  5BRD A;  2QWR A;  5BRE A;  4IOX A;  5C2D A;  1Q7Y O;  1BUP A;  1SAZ A;  3VF4 A;  4KH4 A;  5JIC A;  4KH5 A;  3HOS A;  4BGB A;  4OPH A;  2E88 A;  3T7Z A;  1T6D A;  3LM2 A;  3VGL A;  2E1Y A;  3QBW A;  2ASO A;  2P9N A;  5TKW A;  3LM9 A;  3ZX0 A;  5ADX H;  3TTD A;  3SK3 A;  3B8A X;  3QML A;  5F0X A;  5I9E B;  3UKR B;  3ZIE A;  1OVY A;  4IJA A;  4CZJ A;  2FXU A;  4FPA A;  3ENO A;  1NLV A;  3LDQ A;  4JKC A;  4K43 A;  3HTV A;  3D7E O;  1GLJ O;  5AFU A;  3O9U A;  1DT9 A;  1C0G A;  2YJE A;  3O5B A;  3GL1 A;  3O9Q A;  3H6E A;  2F9T A;  1QZ5 A;  2RE2 A;  3FE1 A;  3A5M C;  3MCP A;  3QBX A;  3CPE A;  1VQ6 N;  1JJ2 M;  1BG3 A;  3MK6 A;  2RHK A;  5JVH L;  3VTI A;  5AQX A;  5F1X A;  5LY3 A;  3VEZ A;  4B9Q A;  4BRL A;  4CJ7 A;  2LN3 A;  3KZB A;  1KK9 A;  4A61 A;  5AQN A;  3E66 A;  3CC4 N;  5KPT A;  1XQS C;  1HKB A;  5AQZ A;  4BC5 A;  4BC4 A;  3A0I X;  4GY2 B;  4EFH A;  3CJA A;  2IVO A;  3ZX2 A;  3CCE N;  1S22 A;  5CR4 A;  4YOY A;  5B8H A;  1KAX A;  3FZF A;  5CHI A;  3TU5 A;  4PKI A;  1ZXO A;  5EX5 A;  1ATS A;  4B1V A;  3CCJ N;  4EO0 A;  2H3G X;  4YOR A;  3SLC A;  3I55 N;  1K4I A;  5H1S Q;  3CXC M;  3KK7 A;  3H46 O;  3CJ9 A;  1NGG A;  4QS9 A;  3SAF A;  1JCU A;  3EKS A;  2HST A;  3H1V X;  3BUZ B;  2VCP A;  4B1Z A;  1W2B M;  3IMX A;  2CGJ A;  3FZH A;  5AQJ A;  4A62 A;  3DXK B;  2E20 A;  2GX9 A;  2IVN A;  3VEW A;  3ENH A;  3DXK A;  4KH6 A;  4WYB A;  1U2V B;  3AY9 A;  3IUC A;  2BUP A;  5LJW A;  4Y0W A;  1MA9 B;  3BP8 A;  1NGF A;  1X3M A;  1GLE G;  2AA4 A;  4O5F A;  1YXQ A;  2Q0U A;  2VWB A;  4IZ9 A;  2GEM A;  1HLU A;  4IWV A;  1YIJ N;  1Q81 O;  1MWM A;  4FWN A;  3ZYY X;  3IFR A;  4H0X B;  2GUP A;  4NLC A;  3TTF A;  5C12 A;  4FL9 A;  2ZJP L;  4IJN A;  1Z6R A;  4PKG A;  5GAH P;  3O9T A;  2Q2R A;  4CZE A;  3I56 N;  1IG8 A;  3KHY A;  3ZET B;  3O4W A;  5EXW A;  4BC2 A;  2HBJ A;  4F9O A;  2YHX A;  3FGU A;  3U9Z A;  3I8B A;  1ZBS A;  3ZET A;  3E9O A;  5BRF A;  1BA0 A;  1NGH A;  4FO0 A;  4HTL A;  4FWM A;  2HBL A;  3TPQ A;  2OAN A;  5HL7 L;  4JEP A;  5EVZ A;  4FWQ A;  4E1J A;  4BR2 A;  1KD1 O;  5AQW A;  5AQH A;  2I7P A;  2OTL N;  4CI6 A;  4DCH A;  3H45 C;  2KKZ A;  3OA9 A;  3WXM B;  1U6Z A;  1N8R O;  2ZJR L;  4JK9 A;  3A5N C;  4DB3 A;  3L4Q A;  4BVO A;  3LDN A;  1E4G T;  3VEX A;  3MN9 A;  4A5A A;  4IO9 L;  2IVP A;  1JCG A;  3AGK A;  1NBW A;  1O13 A;  1T6C A;  2GWJ A;  3IKM A;  3KWI A;  4I6M B;  4WQ4 C;  4EIA A;  4BR9 A;  5ADX A;  1ILY A;  2FF6 A;  3H3N O;  4YDU C;  5TKY A;  1VQP N;  4I6M A;  3QFP A;  1QQN A;  3VEY A;  3SAG A;  3KVG A;  4ILH A;  4BR5 A;  3MN6 A;  3N4Q A;  4IOC L;  3NVK A;  1VQ9 N;  3LDO A;  3LQU A;  3HRG A;  1VQ7 N;  2NRZ A;  3HBT A;  4FWL A;  5GIP A;  3DAW A;  3R6M A;  4AF1 A;  4IOA L;  3EO3 A;  1WOQ A;  3TTC A;  1J6Z A;  4WQ5 C;  1KAZ A;  2NRW A;  3K9K A;  1YI2 N;  4B1U B;  1YAG A;  1ZC6 A;  4NZR M;  4DQ8 A;  2PAV A;  4MLH A;  4P8J A;  1ATR A;  4JN4 A;  4A5B A;  3VPZ A;  2YHY A;  1LCU A;  2FSK A;  3ATU A;  4J8F A;  5FPE A;  3AJE A;  1TYQ B;  2NRX A;  3CQY A;  3OBY A;  4CD1 A;  4H0V B;  4JNE A;  1R59 O;  4K41 A;  3E1Y A;  5JVG L;  1NGB A;  1X3N A;  3VET A;  3CER A;  5FPN A;  2AP1 A;  3MN7 A;  3G6E N;  4XH5 A;  1GLF O;  1YJN N;  3GDQ A;  4L3Q A;  3VGM A;  2QWN A;  3GG4 A;  4JKD A;  4K42 A;  4BGA A;  4BRN A;  4CBX A;  3OW2 M;  3CJ1 A;  2HF3 A;  2NZT A;  3VER A;  3WXK A;  1D4X A;  3C6H A;  3KWG A;  3M1F A;  5C10 A;  5AQK A;  3H1Q A;  2PFU A;  1VQ8 N;  4BRQ A;  4GV3 A;  3CCS N;  3F2K A;  3FFK B;  3T1I A;  5ELZ A;  3MN5 A;  4FPB A;  3UKR A;  3ID6 A;  2E1Z A;  1GLD G;  3DWL A;  4CZK A;  2Q97 A;  3LDP A;  3WXL A;  3G4S N;  3MIO A;  3TSQ A;  4B1Y B;  5AQY A;  3S41 A;  2D0P A;  1M90 O;  2CGK A;  1Q86 O;  3VTH A;  1NGE A;  1SZ2 A;  4E1B A;  3G71 N;  1HRU A;  1KAY A;  2NRH A;  5KPR A;  1RFQ A;  3TSU A;  3F5T A;  4NLB A;  4EHU A;  4P6C A;  4P6P A;  4A2A A;  1H1V A;  4A59 A;  4BQZ A;  5AQQ A;  3N4P A;  2A6A A;  3EE9 A;  3SMS A;  3VEV A;  4BR4 A;  4FWO A;  4FOI A;  5KQD A;  3OBW A;  1NWK A;  3GE1 A;  4M7Y A;  5DM6 L;  2ZJQ L;  2YJF A;  3O9R A;  1XUP O;  5AR0 A;  3CMA N;  1VQK N;  1BA1 A;  1DKG D;  1K9M O;  3DLL L;  2A40 A;  1QQO A;  5GIN A;  1M1K O;  1TUU A;  3L0Q A;  3WUH A;  2RIS A;  2HBM A;  4FWS A;  3HM8 A;  4PL7 A;  5AQO A;  4H5N A;  4IXC A;  3J8A A;  5AQM A;  3VF6 A;  4CZM A;  5BN9 A;  4YOT A;  2GWK A;  4NO7 A;  1VQ4 N;  4XEI A;  2P9S B;  3EL2 A;  1K4O A;  1CZA N;  4RCH A;  3H07 A;  4JKB A;  4FSV A;  2P9S A;  4BC3 A;  1YF5 L;  1WUA A;  4WFN L;  4OO1 J;  1NGC A;  5FPM A;  2A5X A;  3ULE B;  1VQO N;  1IEZ A;  4BRF A;  4ISE A;  4ILJ A;  1Q18 A;  3R3L A;  1QHA A;  1LOT B;  3ULE A;  4CZF A;  4EAH D;  2GEL A;  3E9P A;  5AQG A;  4A2B A;  3QDK A;  4BRH A;  4WCE L;  1RGI A;  1YVN A;  3ID8 A;  1U2V A;  3VES A;  3BF3 A;  3QB0 A;  2VGN A;  2P9L B;  3P39 A;  3O8M A;  3G25 A;  3O1B A;  4WQ4 A;  3SBT A;  5BRH A;  3CC2 N;  4NZT M;  4BR7 A;  5M1Q A;  3D2F B;  3MX5 A;  2P9L A;  4YDU A;  4H0O A;  2RIU A;  5AZI B;  3SMP A;  4IO8 A;  1W97 L;  2CH6 A;  5M1O A;  3I33 A;  5E84 A;  5AZI A;  3WQT A;  3LL3 A;  5AQP A;  3ATV A;  2E2P A;  4ILG B;  4O8U A;  3M6G A;  1K7J A;  3ZIH A;  4H0Y B;  1GLB G;  2QWP A;  3H3O B;  4BG8 A;  2QA4 N;  2F7T A;  1BDG A;  2J4R A;  4FCX A;  4WQ5 A;  3P4I A;  5E26 A;  2WBN A;  4BY9 C;  5HOO A;  3MDQ A;  5JLH A;  2D4W A;  2ZWH A;  3RVC A;  2P9I B;  1NGJ A;  5DM7 L;  4BRA A;  4JKE A;  2P9I A;  5BR9 A;  1ESV A;  3P04 A;  3FZM A;  3MWP A;  4R79 A;  5AQT A;  1YHQ N;  3Q7B A;  1K4P A;  4MO4 A;  4M7X A;  3SJH A;  4WFA L;  3OHR A;  3C65 A;  1TKS A;  1DGK N;  1V4S A;  3W0L A;  5BPN A;  3EE8 A;  5LJV A;  4IEE A;  2CH5 A;  3NVM A;  3A5O C;  3WQU A;  3CD6 N;  1PVW A;  3MMV A;  4JHD B;  1IJJ A;  4CZG A;  5M1F A;  4M63 C;  2ZF5 O;  2IIR A;  4JHD A;  4QS8 A;  4FWK A;  1QZ6 A;  2Q1N A;  2KLA A;  3L4I A;  4JKH A;  4MDA A;  4GV6 A;  3AAP A;  3CCQ N;  4JD2 B;  2EQA A;  3L6Q A;  2NRR A;  3U8X A;  4BG9 A;  3PLA A;  4JD2 A;  4FBQ A;  3LDL A;  3BEX A;  2FSJ A;  3P38 A;  2HF4 A;  4BRE A;  3ZII A;  1K4L A;  1TYQ A;  2V52 B;  4FWP A;  4FOE A;  2Q0R A;  4U67 L;  4C23 A;  3VEO A;  3DJC A;  5JMV A;  3ZEU B;  1S3X A;  3FZK A;  4ISG A;  1T44 A;  3IDH A;  4K25 A;  3ZEU A;  4BRK A;  5AQU A;  3ZX3 A;  1PVY A;  1C0F A;  4QS7 A;  2F9W A;  3MCA B;  4H5V A;  5CE3 A;  2E2N A;  1YJW N;  4IDH A;  2E2Q A;  4A57 A;  2ASM A;  1KC8 O;  2WC9 A;  4WF9 L;  4AM7 A;  4H5T A;  4CZL A;  4YOV A;  3E9L A;  3O9S A;  2WUS A;  5EOY A;  4YOW A;  2QXL A;  3CPW M;  2E8A A;  3C0B A;  4P6D A;  3CF5 L;  4ISF A;  5AQS A;  5BN8 A;  2NNW A;  2P9B A;  2PBD A;  3VOV A;  3J7Z O;  3MK5 A;  2QI2 A;  3D2E B;  3M3Z A;  1TUY A;  2QW9 A;  3CC7 N;  1K49 A;  3O6W A;  4C1N K;  3VF2 A;  1HJO A;  1HKC A;  2P9N B;  2QWM A;  3D2E A;  4FBK A;  3SBG A;  2YX6 A;  2BH1 A;  1BWF O;  5GAD P;  1Q82 O;  3F9M A;  1KXP A;  3LRJ A;  4BRI A;  4BRO A;  1YIT N;  1VQN N;  2I7N A;  2P9K B;  1NGD A;  2ZGZ A;  4P8E A;  1GLC G;  4CD3 A;  4CBW A;  5M1N A;  2P9K A;  4IFE A;  4GNI A;  1K73 O;  1NGI A;  4Z94 A;  3CME N;  2HMP A;  4H0T B;  4H0P A;  4CZH A;  3CCU N;  4RWT A;  4RTF D;  2QM1 A;  1Y64 A;  3C6A A;  2NLX A;  3FR0 A;  2QWQ A;  3AAQ A;  3AGR A;  1RDW X;  4JAX A;  1NGA A;  5GAG P;  5KPZ A;  5C2F A;  2UYT A;  2A41 A;  3BF1 A;  4KBO A;  3CCM N;  4PKH A;  2OTJ N;  4FBW A;  1YUW A;  2QEX N;  1BOT O;  1G57 A;  2ITM A;  3LS6 A;  4P77 A;  3CHW A;  3O08 A;  4DKW A;  2VYP A;  2FLO A;  2NRV A;  2V51 B;  3WXJ A;  4BRM A;  3C7N B;  1QQM A;  4YOU A;  1DEJ A;  3HOT A;  4YKE A;  1P90 A;  4NB4 A;  1S72 N;  3C7N A;  5AZJ B;  3CIP A;  2Q31 A;  3R9P A;  5AZJ A;  3WXI A;  1HPM A;  4JK8 A;  2EWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...