3TSUA

Crystal structure of e. coli hypf with amp-pnp and carbamoyl phosphate
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Transcriptional regulatory protein
total genus 209
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tsuA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsuA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsuA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tsuA01
3VERA 3TSUA 3TSQA 3VEXA 3VESA 3VF2A 3VEWA 3VENA 3VETA 3TTFA 3VTIA 3VEZA 3TTCA 3VEOA 3TTDA 3VF4A 3TSPA 3VTHA
chains in the Genus database with same CATH superfamily
4QS8A 2F7TA 5AR0A 2VWJA 2B4JA 1XEZA 3ENHA 1SV5A 4H0OA 4DQ8A 4L3QA 4E19A 1YJNN 4ICLA 5HL7L 2QWQA 2JLEA 3MEDA 4CD3A 1KLNA 2G8HA 1BQMA 2VQFK 3ZT0A 1NFHA 5C42A 4CJUA 3D0PA 3V81A 4DQPA 3OJSA 5CZ2A 3C6AA 4OJRA 2HHVA 1G99A 3M5RA 4CESA 4O0IA 4LF4K 1NGBA 3QINA 1LN4A 3VEVA 1XUPO 4DSJA 3VQ7A 3FFIA 4CIFA 2HHTA 1L3VA 4GMJB 4LF9K 2GWKA 4A5AA 4RW4A 5F1XA 1EWQA 2NRXA 2QWOA 2E8AA 2ZQBA 4JKBA 2QXFA 4RW7A 3DRSA 2ZJQL 2FSNA 4DWIA 3H46O 1JXBA 3ASMA 5AFUH 3QEVA 3AARA 1WSJA 1C0FA 1ASVA 4FVMA 4FLUA 3H6EA 3V9XA 3D2EA 4JHDB 1SL1A 4M7YA 3DSDA 2HHHK 4CZJA 3QO9A 1NGGA 4A61A 3CYMA 1JLQA 4BC4A 3IABA 2OZSA 3PIPL 2D0PA 4DV6K 4J2EA 1IV0A 4E1MA 4B9MA 1HNXK 1QHAA 2YHAA 2NRRA 1EXQA 1GOAA 1E4GT 2VGMA 3GBTA 2YKNA 4JKCA 2WOMA 4KTQA 5C2DA 1LAVA 3DM2A 4H5TA 4HVJA 1WAJA 4WF9L 5HRSA 1HPMA 3VQQA 3QICA 5JLFA 5KGXA 1HJOA 3VGKA 3E66A 1KC8O 2XHBA 1OH8A 2YHYA 3C6UA 3OYDA 2F96A 3OJUA 5BRHA 3AO5A 3WQUA 1U45A 2VG6A 1OH7A 1VQ9N 4PA1A 4CZFA 4DR4K 1HPZA 5AQZA 1Q7YO 1YJWN 1QQOA 1V4TA 3SUNA 3J8AA 1TKZA 4NCXA 3E9PA 1GLBG 3EO3A 4CJPA 3SLCA 2FBXA 2P9SA 1LAWA 5GAHP 3OYMA 3HOSA 4DSFA 4B9SA 3SPZA 3THVA 3H08A 1RILA 4PKIA 4KI6A 3WT0A 5MLCQ 3THXA 3R1XA 5AQVA 4M3UA 2O8BB 4HTLA 2ZM6K 4F4KA 2LSNA 4AHSA 2YHBA 3U9DA 4YDQA 4W5RA 1X1PA 4G1QA 2MX1A 5AQXA 4OGCA 4HUGA 4YDUC 1JKHA 1SNNA 3TABA 3IALA 3V9SA 2OCEA 4X64K 3BP8A 3QBXA 3G4SN 5LJWA 3O80A 1VAZA 4B9QA 3HL8A 3MK6A 2FF3B 3ZCMA 3G0ZA 3O6WA 4IOAL 3P5JA 2IIRA 1K49A 4B1UB 1QSSA 2O8EB 3O9SA 1VRTA 4MDAA 3OYGA 3SQ1A 3TTFA 4PKHA 4HVCA 1XHXA 5TKYA 3R6MA 4B3MK 4RW8A 2P9KA 4KB1A 2IC3A 4P6CA 4H0YB 5AQHA 3TR8A 4MLEA 4NXNK 4A59A 3MX2A 4BVOA 2Q97A 1OH5A 4FLVA 1KQSM 4CJEA 2QWMA 5KPRA 4F2RA 3HJFA 3I55N 3QEPA 2IOCA 3T1YK 3E1YA 1LW0A 4DV1K 5AQJA 4LF7K 2VWKA 3VERA 3EL2A 2ASMA 1CXQA 4JK9A 4IEEA 2XO7A 3SUOA 1NK7A 2G8FA 4JK7A 3NH1A 3AVCA 3M6GA 4JI2K 3ZIHA 4MQ3A 5ADXH 3ISNC 4EP5A 4Q0BA 1XNQK 1NKEA 4FWKA 5BREA 4QS7A 4CVNE 4W5NA 3M8RA 1RT7A 4BROA 3QBWA 3TAPA 1WN7A 1HX1A 1BI4B 4I14A 1BA1A 1YTAA 1X3MA 5AFUA 2GEMA 2P9LA 4N41A 3K0SA 1DCJA 3I0SA 4FWNA 3HPOA 1O1WA 4CD1A 4LFAK 4DHYA 3W3DA 2V52B 3HRGA 4YOTA 3DRPA 3QB0A 4AF1A 1RDBA 4BE2A 2GX9A 4IZ9A 3LZJA 1TK0A 1S1VA 5BR9A 4FLXA 3JAMO 2W42A 1JCFA 3C95A 4GKKK 3LRJA 3RMAA 2P9SB 5GIOA 3RRGA 1UA1A 1VSJA 4NYFA 3SMPA 3VEOA 1S5JA 3HPHA 2QK9A 2VYPA 3LDSA 4CHNA 1C1AA 4HCCA 3ZX2A 3CFOA 1VSEA 4BRFA 2QKBA 4DUYK 3IKMA 4IO8A 1QTMA 3LM9A 4CFAA 4PL7A 3IG1A 4CJFA 4OKJA 4E7KA 4B1ZA 3RWUA 3ZLJA 3QKBA 3HZ6A 5E26A 3IABB 1B9DA 3ZSXA 3HXMA 4CGDA 1EX4A 4BRMA 2ZD1A 4BR7A 3OYCA 2BTFA 3JXUA 1A5WA 2XRIA 4F3OA 5AQIA 3I8BA 1NGIA 4GKJK 3P38A 3V9UA 3UKRA 3ZEUA 5CE3A 4CHQA 3E01A 3QEXA 4CEQA 5GIPA 1GLLO 3RMDA 1NH9A 4BRKA 4CHYA 2EHGA 5K14A 3H45C 3MECA 4DV0K 4NCBA 2HB5A 3WNEA 4IG3A 3CPEA 5AZIA 5BN9A 4CZIA 3F73A 3RRHA 1GLCG 4FJKA 1SKSA 3AVKA 5JLHA 4CGGA 3AVLA 1QQMA 4CJTA 4JI7K 2Y1BA 3OYHA 4FW2A 3EKSA 4ZTFA 4IG0A 3WEEB 4FJGA 4A5BA 5LJVA 1MWMA 2HBLA 5HLFA 1Z25A 3SK3A 3VF2A 4BDYA 4DFPA 2FSJA 4LSLA 5HROA 2PYLA 1QS4A 1XC3A 3GE1A 1L3TA 4K43A 4CK1A 3D2FA 3PSIA 3VF6A 4JD2B 3KLEA 1RT4A 3TOEA 3H1QA 4JKGA 4K8XA 3I56N 4DU1A 2EH1A 2A5XA 3G71N 4ILHA 3TSUA 1XHZA 1T8EA 2D0AA 4IOCL 3UB5A 1E4FT 3DMJA 1U6ZA 4CI6A 5BRFA 3FZFA 1TYQA 4CK2A 1HJRA 1WNSA 1RT2A 3BEXA 4EO0A 4ISFA 2JGUA 3AA3A 4M63C 1Q9XA 2YJEA 1BWFO 1QVGM 1H4TA 4YOVA 5BR8K 3DXKB 3NCIA 3IAYA 3CM5A 1RT3A 4DQSA 4FM1A 4FCXA 2ZF5O 2NRWA 3QERA 4ELTA 4B3OA 3AGKA 3JYTA 2EQAA 5T7BA 3V6DA 4CJ5A 2O4IA 2P9LB 4H5RA 1QVFM 2E1ZA 2F4VK 4BRNA 1T6DA 3WXLA 4Z0UA 3T3FA 2HNZA 1RT6A 3UE5A 1VQ5N 4QAGA 1S3XA 1TAQA 3A5NC 4M3RA 4GV9A 4WQ4A 3TAGA 5KGWA 1CXUA 3ZT4A 1LV5A 1IBLK 2Q3SA 1FW6A 4CBXA 1FKOA 3ZIGA 4DKWA 2I5JA 3OYIA 1NGAA 5I42A 1WBBA 3L2RA 2E6MA 3HP9A 1UAXA 1KD1O 4CZHA 2OPRA 3R8EA 3VETA 4CFDA 4GNIA 3S3NA 2CGKA 4FJ9A 3ZT3A 5CYMA 4M7XA 4H8KA 4RCHA 4B1YB 2V51B 4CGFA 4PUOA 1I3AA 5AQFA 3PX0A 3TARA 1RBTA 3MGZA 1P90A 3EN9A 3HVTA 5M1QA 2EWSA 3U9ZA 3HOTA 2A1RA 1QE1A 2P9NB 3OYEA 1YVUA 3OY9A 4E7IA 2DFFA 3DLKA 4UY8O 3RMBA 1NGFA 1HNZK 3AVFA 3DSCA 5CY4A 4DR6K 4DSIA 2WUSA 1U04A 4ID5A 4H0XB 2YJFA 3LWLA 2HHUA 1VQLN 1G57A 3SCXA 3GG4A 2GTCA 1KTQA 3O4WA 3VENA 4E89A 4K87A 3SQ4A 1S1XA 4IFYA 4JAXA 5LL6Z 3V1OA 1YUWA 1C0TA 4WYBA 3MXIA 1VSDA 3DLGA 1O13A 3WEEA 3LZIA 1ZBSA 4WFBL 4CF0A 3DOKA 4GV6A 3KD5E 3O3GA 3DLLL 4LD0A 4FJMA 3AV9A 4B3RK 3ZSQA 3SQ0A 4WQ5C 1CZAN 2VGNA 1LOTB 2Q36A 4IOXA 3S3MA 4FO0A 3U6FA 5M1PA 4FOEA 3VQDA 3SQ2A 2P9PB 1WSIA 3P04A 1NJ6A 3M8PA 1A5VA 2BGGA 5AQLA 3ULEA 1DEJA 4LH5A 2PY5A 2Q2RA 3DXMA 2HF3A 3AA5X 1VSMA 4YDUA 3L2UA 5J2PA 4OPKA 4FJ7A 1BQNA 3O3FA 1VQ6N 1G15A 3PY8A 1VSFA 3LP0A 1WSEA 4E1JA 2A2YA 4CERA 5AQRA 4JI8K 1L3UA 2A42A 4B8CA 4Q15A 3VEZA 1D4XA 3LALA 4DV4K 3MEEA 1LCUA 3LPUA 1RDDA 1FJGK 1HUXA 4W5OA 3TAEA 3IDHA 4X62K 1RBUA 4OPAA 2P9UB 4BRCA 4CGHA 4CJWA 3OTOK 1UWBA 4DR5K 3CIPA 3O1BA 1K73O 1NBWA 4X65K 4BDPA 1X9WA 1IEZA 3ZSVA 3D2EB 4JHDA 4OKEA 4DFMA 3SYZA 5I3UA 3VGMA 3TANA 4HCBA 3VQ5A 2FBTA 4B9TA 4NO7A 1YAGA 2QWNA 2H3GX 2X6NA 2I7NA 3E9OA 1B9FA 2VCPA 4KREA 3SUPA 4WE1A 2Q31A 1WSHA 4PWDA 5EVZA 4FJHA 5JVHL 4E7HA 3L2VA 1VQPN 4LFCK 3C6HA 1GLEG 1ZBUA 2DTUA 3FZLA 4JLHA 3O9RA 1JCEA 1Q8IA 4CCHA 2ZJPL 3QIOA 1YHQN 3PX4A 5IT9O 2L8YA 4KAZA 4DG1A 2G8IA 4LH4A 3VEYA 1J5OA 3VA0A 1HQUA 2BE2A 2YX6A 4HWIA 3RMCA 5KQ8A 4JRPA 4O8UA 2E2NA 3LP2A 4IJNA 3LVJC 3F5TA 4FLTA 1KCFA 5AQKA 4L8RB 4FCYA 4A62A 4FSVA 4CEBA 2E2PA 2A6AA 3GDQA 5KPTA 3QIPA 3T69A 3TTCA 3VGLA 1J53A 3Q7BA 3V9ZA 1UDVA 4NCAA 4P6PA 3DYAA 4GW6A 1BA0A 2UUAK 4OLBA 1VHXA 3DAWA 3L6QA 3DLHA 3NVKA 5HP1A 1K7JA 4N56A 2P5OA 1NM1A 3AO2A 2D0BA 1TKUA 2G8WA 3AO3A 2B6AA 1QQNA 3SBGA 2YNGA 5HRNA 3HT3A 4GY2B 2CGJA 1JO0A 2ITMA 3MN6A 5EXWA 1XMQK 2E2QA 1DKGD 4YORA 2IVOA 4KHYA 1K8KA 4FLWA 3SJJA 3L7VA 1J54A 4DSLA 2HVIA 3EE8A 2RPIA 3VQ8A 4DSEA 4ID1A 5CR4A 3I0RA 4E1NA 1BIZA 1H1VA 3QEWA 3OYFA 4EP4A 4A2AA 3NE6A 4M3WA 4M41A 4DTOA 2VG7A 3J80O 4Z4CA 1HNWK 1U2VB 3CC7N 4IDHA 1RBVA 5E84A 4BE0A 1TAUA 5H1SQ 1KAYA 3KJVA 2IVPA 3MN5A 4N5SA 5AQSA 4FM2A 3WXJA 2R7YA 1BL3A 3LS6A 5D3GA 3LDOA 4ISGA 4K25A 3OYKA 1SQKA 1NK8A 3C94A 3TSQA 2QEXN 4DV3K 5EX5A 1H4SA 2HHSA 3P83D 1S6QA 1PAVA 1IG8A 3U8XA 1OKJA 4P6DA 4JKDA 4LY7A 3OYAA 4CE9A 1TYQB 4KHSA 5M1NA 2VG5A 5M1KA 4JI3K 4Y0WA 4H0PA 3PO5A 5C0YA 2AP1A 4B8AB 2Q0UA 1HQEA 4XIUA 1NJ2A 1VSHA 2YV0X 4EZ6A 1LWCA 1ATSA 4Z4GA 2IDOA 4O5FA 4IXCA 1S1UA 3L4IA 4WQ4C 3N4QA 4OLFA 1YXQA 2FC0A 4DCHA 4J8FA 1RDCA 5JICA 3CCLN 4HD0A 3P31A 4FK2A 4J2DA 2QTDA 4LF8K 1QQCA 2E1YA 2Y1IA 4FYDA 2P9KB 2QWPA 4FK0A 4ISEA 2KZMA 2AA4A 2NUBA 4BE1A 1C1BA 3VEXA 4I6MB 5JS2A 2OYQA 3THWA 4Z9EA 3AVNA 2WTUA 3AO4A 3K9JA 3LAKA 4EHUA 4NZTM 1BCMA 1DT9A 1GLFO 3NF7A 4G9ZA 4I7FA 4KFBA 1EP4A 4BR5A 1NLVA 1YVNA 4CFCA 3OYLA 4CEDA 1HLUA 3OS1A 5C24A 1S1TA 5CHIA 4DR2K 3CQYA 1BIUA 2YHXA 2O8DA 1GLAG 3O9TA 4CF1A 1W9HA 3S41A 2CH6A 2EK0A 1BCOA 5AQOA 3K5LA 3WNGA 3K5OA 1W7AA 2QXLA 4ELVA 4JI0K 1C6VA 1J6ZA 4H5NA 4XH5A 3J7ZO 4CF2A 1KFSA 3HM9A 5KRTA 3BGRA 3FR0A 3QEIA 2WC9A 1XMOK 3CQXA 2IAJA 4E1BA 3NGIA 4HUFA 3O3HA 4E7LA 1NJ8A 3R9PA 4DU4A 4CGJA 2ZE2A 4DS5A 3VESA 3IRXA 1E3MA 5GAGP 2KZZA 4CJKA 2FXUA 3CFPA 4CJ7A 1F21A 4H4MA 2HMIA 4JD2A 4AM6A 4KTWA 3VQEA 1KFDA 3NAEA 4B1XB 5HOOA 3MXMA 3C7NB 3C7NA 5BRDA 3QETA 3CJ7A 3DJCA 4FWLA 5AQTA 4WFNL 1VQ4N 3MCAB 3HZ7A 4JS5A 2G8KA 1BU6O 3B6PA 4CIGA 3VOVA 4F9OA 1KAZA 4HUEA 4U67L 1KSPA 4J2AA 4I2PA 5AQMA 1S8EA 4BRHA 1NK0A 4XH4A 2E6LA 2P51A 3FZKA 2XY5A 5AQNA 3U3GA 3KKRA 4CHPA 1VSKA 1S6PA 4BRPA 1T05A 3FE1A 1BI4A 3RSEB 3HI0A 5DMRA 3LM2A 4N76A 2E2OA 4DTRA 5AJ3K 4FPAA 4KH6A 3FZMA 3HSTB 2HHXA 4FJNA 4HVZA 3KWIA 3J81O 1YIJN 4PY5A 2OPPA 4JI1K 2OPQA 4DTPA 3VPZA 3PIOL 5CYQA 4CIEA 1IH7A 4F3TA 3U3YA 2NRVA 4FWQA 1NGEA 4KKOA 1C1CA 2NZTA 2UYTA 3B8AX 4YFUA 5IWAK 4YY3K 2X6SA 3PSFA 1J9AA 2FBYA 1NMNA 2IFEA 1L3SA 1VRUA 4BRGA 1NFJA 1HKBA 1K4LA 1S9EA 3KK2A 2W6LA 3EEQA 4WCEL 3SNNA 1BISA 1NJYA 2O8FA 4H03B 4BQLA 3ZSYA 1YITN 1NJWA 4J2BA 1XQSC 3V1QA 1RTJA 4BRLA 3OYJA 2P5GA 1JE3A 3UKUB 1XNRK 4TSXA 1KVBA 3MDQA 4XH1A 4BC2A 3CJCA 3RSEA 2IGIA 3TAFA 5FRNA 2BKYX 3DI6A 1S72N 3PV8A 1RDAA 4KHQA 4DLEA 4CJ3A 3KLFA 4DS4A 2ZJRL 1RBRA 3T19A 3QNOA 4FBKA 2XY6A 2UUBK 1KXPA 3BZCA 4OLAA 5ELZA 3EZ5A 2LN3A 2CGLA 1TUYA 1NOYA 4C8OA 2J4RA 1JLFA 3AA2A 3ZIIA 4KV8A 2HHWA 3AGRA 3D6RA 3O4QA 3EYZA 3VQPA 4ELUA 4Z4EA 3ZSOA 4M45A 1TKSA 2YI1A 2ETJA 3O9UA 4BRIA 3GL1A 3H07A 4OX9K 1CZBA 4I9QA 1D9FA 3MAQA 4R5PA 5DM7L 1JCUA 3VTHA 2Z1JA 3ZSWA 3FGUA 1DTTA 2I7PA 2D4WA 4MFBA 3DXKA 5J1EA 1IBMK 1KVAA 2PYJA 2P1JA 2O8CA 3IMXA 1QHTA 4KPYA 4FPBA 3OVNA 3WNHA 4O5BA 4BREA 2QWLA 3AVJA 5JVGL 4CGIA 1NNEA 1JLBA 1L5UA 1Z6RA 1N36K 3PX6A 4JKFA 3AVAA 1NWKA 1BHLA 3KLIA 5HRPA 4KHPK 3HO1A 2PBDA 2B5JA 1TVRA 5C15A 4BGBA 1TL1A 3I8DA 3ATUA 1N8RO 4DR1K 2PAVA 3A0IX 3O5BA 1Y64A 4RW6A 4DU3A 4FBQA 3R3LA 1FK9A 3LDLA 3KVGA 4JK8A 2G8UA 3JSMA 2D5RA 2HF4A 3MK5A 1VQMN 4FZYA 3LP1A 4RG8A 3Q7CA 2QM1A 4O55A 2P9IB 2UU9K 3SV3A 3P1GA 3VQ4A 2OA8A 4JKHA 1LW2A 3SAHA 3VQCA 3KHYA 1SZ2A 3HVRA 3CD6N 1W0HA 2WONA 4DMNA 1BDGA 3K9KA 1YT3A 4FBWA 1K8AO 2ASPA 1NMDA 1WAFA 1SKWA 3L3UA 4CZLA 4YNQA 4M3TA 2UXBK 1NGDA 4K41A 4JS4A 3ITHA 3UIQA 1Y2IA 1RCHA 4CJQA 3F9MA 3B6OA 3C65A 4U7BA 1U4BA 4FW1A 3WUHA 5KRSA 4CZGA 3V4IA 4LF5K 3NVMA 4CHZA 4GVMA 1NG9A 2Q1NA 3BZKA 5AZJB 4AHCA 4AHRA 4KI4A 2RE2A 4K0KK 3CPWM 4DFJA 1ZC6A 4QCLA 2GBZA 4YOYA 2P9UA 2RF2A 1PVWA 4FWPA 5LY3A 4RWTA 3FLCO 3LWMA 4DUZK 2O8FB 3CCUN 1NOZA 3NHGA 4E7JA 4O44A 3MN7A 4CEFA 3M8SA 2O8BA 4B1WB 3G6EN 2GV9A 2KHOA 3ID6A 1I94K 2HVHA 3CCEN 4FWRA 2YNFA 3CMEN 1RDWX 3TAQA 2VQEK 4NLBA 4JEPA 2GUPA 4BC3A 4BG9A 4CBWA 1LWFA 3DLRA 3G25A 3MWPA 5AZIB 4MDBA 5SZTA 3HM8A 4LC9B 4C8LA 4FJ5A 2EX3A 1Q18A 2D1KA 4YKEA 2QI2A 2X74A 4PQUA 3WNFA 1ESVA 3AA4A 2OANA 4C8MA 4KHUA 2F8SA 1Q86O 3O1WA 1B92A 3QFPA 4Y1DA 2ZGYA 1DLOA 3QDKA 4BR4A 5GAEP 3ID8A 4TWAA 1N34K 5BPMA 2BUPA 3VQAA 4B3TK 4R79A 4DB3A 3OHRA 3VMFB 4BR2A 4RTFD 1WSGA 3M1FA 1RFQA 2UUCK 1TIGA 3MWTA 4CF9A 3DOLA 2KTQA 4W5QA 4MO5A 4PHTX 2GWJA 4EIAA 1Q9YA 4K42A 2NRTA 4LF6K 2O8CB 3KKSA 4DV7K 5AQUA 1ASWA 1VK0A 1ITGA 3U6YA 3L3VA 3ENBA 2BH1A 4K86A 5FDLA 4KHWA 3CJ1A 4FWOA 1OVQA 3CMAN 3HBTA 3CCSN 1D9DA 4JRQA 3ZETB 2O8EA 2HOEA 1S9GA 4DF4A 3TI0A 4OVLA 4CJLA 4YOWA 3O4NA 2D0CA 1X9MA 3ZSRA 3TAMA 1NJ5A 1Z26A 3F9KA 2GTDA 3CHWA 1W2BM 4BACA 4BC5A 1VQNN 3LAMA 3K57A 3K59A 1RTIA 4OGEA 3VA3A 3ATVA 4FOIA 1Z05A 3WQTA 4AHUA 4JI6K 4ILGB 1HYVA 5BN8A 2ATQA 3RVCA 2A40A 4BWJA 4DQRA 4JI5K 2FSKA 2DFEA 3W0LA 1QSYA 5C10A 1VQ8N 4E0DA 4FWMA 1UOCA 1EQYA 3O8MA 2OPSA 4JYAK 1ZYQA 3MMVA 5KTQA 5LMUK 4YOXA 1NK4A 1ATNA 3VF4A 3WXMB 3HSCA 2A3ZA 3CG7A 4BRAA 4KO0A 5E41A 3L8BA 1KRPA 4KRFA 4AHTA 2YNHA 4QS9A 4DF8A 2KKZA 4EZ9A 4NZRM 1SUQA 2E5LK 4PL8A 1J5EK 1M90O 1VR4A 4NLCA 1IO2A 1EWRA 2KLAA 4Z94A 4B9UA 1C0MA 4B9LA 2F9TA 4M3ZA 4KH4A 4C1NK 3A2FA 2NNWA 1CLQA 1HR0K 3DRRA 4EAHD 1D8YA 4JKAA 2HMPA 3K5MA 2JWKA 1BGXT 3J7YP 2F8TA 1SKRA 3O9QA 4HHTA 3BY5A 3TWHA 4JKEA 1VQKN 1IKXA 4FJLA 4BWMA 4BGAA 3G10A 5KPZA 5AQWA 4JI4K 1ZBHA 1WBDA 1GOCA 4JV5K 4CECA 5BPLA 5KQDA 3AAPA 4CEEA 4CF8A 4KTZA 1GLDG 5B8HA 5KI6A 4DTJA 4LFBK 1Y97A 4I6MA 5I9EB 1JLCA 2M71A 4C23A 1N5YA 4MO4A 3A5LC 3P39A 2O8DB 3IS9A 1LWEA 1NU0A 1SL2A 4DQQA 2W40A 4A2BA 4DQIA 1JCGA 5AQPA 2V7YA 5HBMA 4YHHK 3VQBA 3M3ZA 3S9HA 3NH2A 1ZBFA 1C0UA 3OS2A 5SWMA 5C12A 1YTUA 1T3VA 4IBNA 3ALYA 3CCRN 4AILC 4C8KA 3PLAA 2KFZA 3DWLA 4JKGB 3AAQA 2KW4A 3A5OC 1K8KB 1HMVA 3A8YA 5C2FA 1P8ZA 1HYSA 4NB4A 2OZMA 1HYZA 4O4GA 3CETA 1QZ6A 4FXDA 5C25A 1H4QA 1TKXA 4W5TA 2Y1JA 2E20A 3EKUA 4FK4A 4V19S 1WSFA 2O4GA 5GADP 2HSTA 3L0QA 2HNYA 5JMVA 5J2MA 3EZWA 4H5WA 3HK2A 1HNVA 5J2QA 2QWRA 4HTUA 1WB9A 4DTNA 1IKYA 3LDPA 2BANA 1T44A 4BG8A 2HBJA 1EKEA 3MEGA 2W41A 2LXRA 3L2WA 1RDUA 2KQ2A 4NCGA 4CZEA 1TKDA 4OO1J 2UXDK 4CZMA 5HRRA 3SAGA 2RHKA 2NLXA 1JLEA 4B3SK 2UXCK 4N47A 4M3YA 4OPJA 2ASOA 5FLXO 2Q3VA 4CJ4A 3IFRA 4FL9A 3NGYA 1KAXA 3THWB 4IKFA 4ILJA 3CF5L 3SI6A 1RT1A 4IFEA 3DLEA 1WLJA 1NJZA 4FJXA 4X66K 2GELA 4Y1CA 3CJ9A 3RR7A 1HC7A 3ENOA 4CJSA 3OA9A 2YCHA 2QA4N 1K4IA 1CZ9A 1KK9A 2H9UA 1BUPA 4FVUA 4EHTA 2FBVA 3U4LA 4BVPA 1NK9A 2W6KA 1BOTO 4BRDA 4DR7K 3UKRB 3TTDA 3T1AA 1X9JA 3VEWA 1HKCA 3SAFA 3NF9A 3THYB 3SZ2A 1VQON 2IVNA 1RT5A 3FZHA 3O08A 1EO1A 4BR0A 1SAZA 5FPMA 1EETA 1X3NA 4DFKA 1T7PA 4IWVA 3MX5A 3RR8A 3KWGA 3E9LA 4GVEA 5M1FA 1Q82O 3DLBA 3ZX0A 4CEOA 2NRZA 3OW2M 1NJ1A 4KBOA 4P8JA 3BF1A 3CERA 3MN9A 4OPHA 4B1VA 2QKKA 5AQGA 1QZ5A 5DM6L 1KVCA 4CBUA 2RISA 4LSNA 5DK5A 1ILYA 2HBKA 3MCPA 3KLGA 1VQ7N 4BY9C 3SMSA 2FF6A 2RN2A 4DTUA 4OKKA 4P77A 3QNNA 3HYFA 4DTMA 1VM0A 1K9MO 3P4IA 1KLMA 2E88A 1ZBLA 4JNEA 4DV5K 1HNIA 4C1NI 5FPDA 1IKWA 3AVGA 3EY1A 1Q81O 2YKMA 1T6CA 3NF8A 4CJVA 4EFHA 3ZETA 1U49A 2XY7A 1MDUB 4K8ZA 3T7ZA 4H4OA 3LP3A 4M3XA 2OTJN 5AQQA 4B08A 4QOZB 2ITGA 3DXMB 2Q0RA 2XY8A 4CFBA 3WXIA 5GINA 2BDPA 4BDZA 2YHWA 1JLGA 3ZIEA 2A41A 1TUUA 1IG9A 2RKIA 3PUFA 2GUIA 1BO5O 3RTVA 1TK8A 3V1RA 3AJEA 2HNDA 1QSLA 4Z4FA 1OVYA 4WQ5A 3WBMA 3K58A 1C0GA 1WOQA 5ADXA 3NFAA 3FFKB 4AM7A 1HRHA 4CEZA 5JS1A 1RBSA 1NK6A 2QW9A 3AVMA 4O0JA 4BRQA 3T1IA 5FRMA 1G58A 2V7ZA 1GOBA 5LMNK 1JJ2M 3QFUA 1IKVA 4DTXA 4NXMK 4FM0A 4WFAL 1TGOA 3SBTA 1ZXOA 1NKBA 1IBKK 3OBWA 3KD1E 4DTSA 1W97L 2FLOA 3HPGA 1V4SA 3JS6A 4O8KA 2IS3A 4PKGA 3C6TA 3CCMN 5FPNA 2P9BA 3NDKA 4XEIA 3TU5A 1Y9XA 3L4QA 4IFVA 3HP6A 4F2SA 3LVKB 4DSKA 4MLHA 4FLZA 3K5NA 4KB0A 4Q5VA 3AY9A 3T1HK 2P9IA 4H0TB 1BG3A 1YI2N 1XC9A 3CC4N 1FXXA 3CC2N 1JL2A 2HW3A 3QMLA 1X9SA 3C0BA 4FZXC 4I2QA 3OYBA 3BF3A 5AZJA 3ZT2A 1VSIA 3SUQA 3THYA 1NGCA 1NGHA 1XI1A 1ASUA 1NJIO 2HHQA 2VWBA 1VSLA 4IEIA 1K4OA 3LDNA 5M1OA 3KK7A 4FJ8A 5J2NA 4H5VA 3EE9A 3D2FB 1DTQA 3ZX3A 1RTDA 3N4PA 2WFBA 1RNHA 3ZSZA 4M42A 4K88A 1N32K 1NKCA 4RW9A 2PFUA 4Z4IA 2KFNA 3CI5A 3I33A 1HRUA 4IJAA 1H0YA 4I9LA 3IUCA 4Z4HA 3HTVA 5FPEA 3D45A 4CZKA 3SJHA 2NRHA 4H0VB 4DV2K 1TK5A 2Z1IA 4CJRA 4DR3K 2PZSA 3VTIA 4JN4A 1MU2A 1RGIA 3VQ9A 4FLYA 3F2KA 3V9WA 3K2PA 3MXJA 2HBMA 5EOYA 3BUZB 3CXCM 1SL0A 1K4PA 2RIUA 1M1KO 1JLAA 1II7A 1S22A 1OH6A 3CCVN 3H3OB 1ZBIA 1U47A 2E4LA 5F0XA 4ZHRA 1T03A 2Z1HA 4E3SA 4BQZA 1R0AA 3ZYYX 4UQGA 1U2VA 3VN5A 4AQYK 4B9NA 3AVIA 1UA0A 4B9VA 1N33K 3CQ8A 3SV4A 1JXEA 5BPNA 4KH5A 4KHNA 2JWLA 3NF6A 1YF5L 3QESA 5CZ1A 5EY4A 3WXKA 3KK1A 1K6YA 3OYNA 4ZTJA 5AQYA 2Z1GA 2ZGZA 3NGZA 1JDQA 3AVHA 3NBPA 3KTQA 3J7AP 3BDPA 1XWLA 3PO4A 2WBNA 1H0XA 2Z7CA 3H1VX 3CCJN 1YJ9N 1RQ8A 4AH9A 4A57A 3NH0A 1IJJA 3KK3A 1MA9B 2CRQA 3ULDA 3LPTA 3VQ6A 3QLHA 3LQUA 2DPNA 3KZBA 4CEAA 4CK3A 1NJXA 2G8VA 3CJBA 4P8EA 5EU7A 1GLJO 4NYNA 4CW7B 3H3NO 4IDKA 4AHVA 4FWSA 1NGJA 1FKPA 1S1WA 3GOIA 3A5MC 1NK5A 4FJIA 1REVA 1SS6A 3SPYA 2CH5A 4DLGA 2OTLN 4GV3A 2P9PA 2F9WA 3AVBA 1HKGA 3S3OA 1I39A 3CJAA 3ZEUB 3TPQA 2D0OA 1MWKA 1TV6A 3TSPA 1A5XA 4FJJA 1ATRA 1D5AA 2AJQA 2YNIA 1TKTA 4CHOA 3LANA 2P9NA 3UKUA 3MIOA 3NMUA 1RTHA 3AO1A 3D7EO 1JL1A 1TL3A 4FFJA 2ZWHA 1U48A 3KLHA 3LL3A 4YOUA 5F2RA 4IO9L 5TKWA 4WI1A 1WUAA 3CFRA 2DY4A 2A1SA 3M8QA 3ZT1A 1PVYA 3KIOA 3OS0A 2X78A 3CCQN 3THXB 4C8NA 1N6QA 5A2QO 1DGKN 4BR9A 3OBYA 4F8RA 1R59O 2DFHA 4FZZA 3L2QA 3LDQA 3CM6A 5FROA 3ULEB
chains in the Genus database with same CATH topology
3LM2A 4QS8A 2F7TA 5AR0A 2E2OA 2V51B 4FPAA 2E20A 3FZMA 4KH6A 1XEZA 3EKUA 3ENHA 4HVZA 3KWIA 4H0OA 4DQ8A 4L3QA 1YIJN 5AQFA 1YJNN 5HL7L 2QWQA 4CD3A 5GADP 2HSTA 3L0QA 4RCHA 1P90A 3EN9A 3VPZA 3MGZA 5M1QA 2EWSA 3U9ZA 5JMVA 3HOTA 3PIOL 3EZWA 3C6AA 4H5WA 1G99A 3M5RA 3ZETB 1NGBA 3VEVA 2P9NB 1XUPO 2NRVA 4FWQA 1NGEA 2QWRA 4UY8O 2NZTA 3RSEB 2UYTA 1NGFA 3B8AX 3LQUA 3LDPA 1T44A 2GWKA 4A5AA 5F1XA 2WUSA 4BRGA 2NRXA 1HKBA 2HBJA 4BG8A 1K4LA 2W41A 2QWOA 2E8AA 1RDUA 4CZEA 4OO1J 4H0XB 4WCEL 2YJFA 4CZMA 1G57A 1VQLN 4JKBA 4H03B 3SAGA 2RHKA 3GG4A 4BQLA 2ZJQL 1YITN 2NLXA 1XQSC 2FSNA 3O4WA 3H46O 3VENA 4BRLA 2ASOA 5AFUH 3UKUB 3AARA 4JAXA 1C0FA 3IFRA 4FL9A 1YUWA 3H6EA 1KAXA 3D2EA 4JHDB 4ILJA 3CF5L 4WYBA 3MDQA 4XH1A 4IFEA 4BC2A 4M7YA 3CJCA 3RSEA 4CZJA 1S72N 2GELA 1NGGA 1O13A 4A61A 3WEEA 4BC4A 1ZBSA 3CJ9A 3PIPL 4WFBL 2D0PA 3ENOA 2ZJRL 4FBKA 4GV6A 3OA9A 2YCHA 2QA4N 1K4IA 3DLLL 1QHAA 1KXPA 2NRRA 1KK9A 5ELZA 1BUPA 2LN3A 4FVUA 4WQ5C 2CGLA 1CZAN 2VGNA 1LOTB 4EHTA 2Q36A 1E4GT 1TUYA 2VGMA 3GBTA 4IOXA 4FO0A 3U4LA 5M1PA 4FOEA 4JKCA 2J4RA 4BVPA 2P9PB 5C2DA 3ZIIA 4H5TA 4WF9L 1BOTO 3P04A 4BRDA 1HPMA 3AGRA 3UKRB 3D6RA 3TTDA 3QICA 5AQLA 5JLFA 3ULEA 1DEJA 1TKSA 1X9JA 1HJOA 2Q2RA 2YI1A 3DXMA 3O9UA 3VEWA 1HKCA 3VGKA 4BRIA 3SAFA 2HF3A 3E66A 1KC8O 3GL1A 1VQON 2IVNA 2YHYA 3H07A 4YDUA 3FZHA 3O08A 5BRHA 3WQUA 1EO1A 4BR0A 1VQ6N 1SAZA 5FPMA 1X3NA 3NVKA 4IWVA 5DM7L 1JCUA 3VTHA 1VQ9N 3MX5A 3FGUA 4CZFA 4E1JA 3KWGA 2I7PA 2D4WA 3E9LA 4GVEA 5AQRA 5M1FA 3DXKA 1Q82O 2A42A 5AQZA 3ZX0A 3VEZA 1Q7YO 1D4XA 1YJWN 2NRZA 1V4TA 1QQOA 3IMXA 1LCUA 3J8AA 4KBOA 4FPBA 3E9PA 3OW2M 1GLBG 3BF1A 3EO3A 4BREA 4P8JA 2QWLA 5JVGL 3SLCA 1HUXA 3IDHA 3CERA 3MN9A 1Z6RA 2P9SA 4OPHA 5GAHP 4OPAA 2P9UB 4B1VA 3HOSA 4BRCA 4B1YB 4JKFA 5AQGA 4PKIA 3WT0A 5MLCQ 3CIPA 3R1XA 1NWKA 1QZ5A 3O1BA 5AQVA 1K73O 1NBWA 4HTLA 5DM6L 4CBUA 2RISA 1IEZA 3D2EB 4JHDA 3U9DA 1ILYA 2HBKA 3MCPA 3VGMA 1VQ7N 4BY9C 3SMSA 2PBDA 2FF6A 2MX1A 5AQXA 5C15A 4NO7A 1YAGA 4BGBA 4YDUC 1SNNA 3ATUA 1N8RO 3SJHA 4P77A 2QWNA 2H3GX 2I7NA 2PAVA 3E9OA 3A0IX 3BP8A 2VCPA 3QBXA 3G4SN 3O5BA 1Y64A 1K9MO 2Q31A 5LJWA 3O80A 3P4IA 4FBQA 3R3LA 1VAZA 4B9QA 2E88A 3MK6A 5EVZA 2FF3B 3LDLA 3KVGA 4JK8A 5JVHL 4JNEA 1VQPN 2HF4A 3O6WA 4C1NI 5FPDA 3C6HA 1GLEG 1VQMN 4IOAL 3MK5A 1Q81O 3Q7CA 2QM1A 3FZLA 2P9IB 1T6CA 2IIRA 1K49A 4B1UB 3O9RA 4EFHA 3ZETA 1JCEA 4JKHA 3SAHA 2ZJPL 1YHQN 1MDUB 3O9SA 4MDAA 3KHYA 1SZ2A 3TTFA 3CD6N 4PKHA 3T7ZA 5TKYA 3R6MA 1BDGA 2OTJN 3K9KA 5AQQA 3VEYA 1K8AO 4FBWA 2ASPA 2YX6A 3DXMB 4HWIA 2Q0RA 1NMDA 5KQ8A 4M7XA 2P9KA 3WXIA 4CZLA 4O8UA 5GINA 4P6CA 2E2NA 2YHWA 4H0YB 5AQHA 3ZIEA 1NGDA 4IJNA 2A41A 3F5TA 4K41A 4MLEA 1TUUA 5AQKA 1BO5O 4A62A 4A59A 4FSVA 3F9MA 3AJEA 3MX2A 2E2PA 2A6AA 3C65A 2Q97A 3GDQA 3T69A 4BVOA 3TTCA 3VGLA 5KPTA 4U7BA 1KQSM 3WUHA 2QWMA 3Q7BA 4CZGA 1OVYA 5KPRA 3NVMA 4WQ5A 4P6PA 3I55N 3E1YA 1BA0A 1C0GA 5AQJA 3DAWA 3L6QA 1WOQA 2Q1NA 5AZJB 5ADXA 3FFKB 3VERA 1K7JA 4AM7A 1NM1A 2ASMA 2RE2A 3EL2A 4IEEA 4JK9A 3CPWM 1TKUA 1ZC6A 4JK7A 2QW9A 4YOYA 2P9UA 1PVWA 3CETA 3M6GA 4FWPA 4BRQA 3FLCO 1QQNA 3T1IA 3SBGA 3ZIHA 5LY3A 5ADXH 2V7ZA 1G58A 3CCUN 1JJ2M 3QFUA 4GY2B 2CGJA 2ITMA 3MN6A 3MN7A 5EXWA 4FWKA 2E2QA 1DKGD 4YORA 2IVOA 4B1WB 5BREA 4WFAL 4QS7A 3G6EN 3SBTA 1ZXOA 1K8KA 2KHOA 3OBWA 3QBWA 3ID6A 4BROA 3CCEN 1W97L 2FLOA 4FWRA 1V4SA 3JS6A 4O8KA 3L7VA 4BR2A 4PKGA 1HX1A 3CMEN 1RDWX 4I14A 3CCMN 5FPNA 2P9BA 1BA1A 4NLBA 1X3MA 3EE8A 4JEPA 4XEIA 2GUPA 3TU5A 4BG9A 3L4QA 4BC3A 5AFUA 2GEMA 2P9LA 5CR4A 4MLHA 4CBWA 3G25A 1H1VA 4FWNA 3MWPA 5AZIB 3AY9A 4CD1A 4DHYA 4A2AA 3W3DA 2V52B 4MDBA 3HRGA 2P9IA 4H0TB 1BG3A 3QB0A 4YOTA 3HM8A 1YI2N 4LC9B 3CC4N 4AF1A 1Q18A 2D1KA 4YKEA 1U2VB 2QI2A 4IDHA 2GX9A 3QMLA 3CC2N 3CC7N 3C0BA 1ESVA 4IZ9A 2OANA 5BR9A 5E84A 3BF3A 5AZJA 3O1WA 5H1SQ 1Q86O 1KAYA 3QFPA 2ZGYA 1JCFA 2IVPA 3QDKA 3MN5A 4BR4A 3LRJA 5GAEP 3ID8A 1NGCA 5BPMA 1NGHA 5AQSA 2BUPA 2P9SB 1NJIO 5GIOA 4R79A 4DB3A 3OHRA 3SMPA 2VWBA 4IEIA 3VEOA 4RTFD 3VMFB 3WXJA 2VYPA 3LDNA 5M1OA 1K4OA 3KK7A 3M1FA 3LS6A 1RFQA 3LDOA 3MWTA 4ISGA 4H5VA 4K25A 3EE9A 3D2FB 3ZX2A 1SQKA 3ZX3A 4BRFA 3N4PA 2WFBA 3TSQA 2QEXN 4MO5A 4PHTX 2GWJA 3IKMA 4IO8A 5EX5A 4EIAA 3LM9A 4PL7A 4K42A 2NRTA 3U8XA 1IG8A 1OKJA 4B1ZA 3HZ6A 4JKDA 5E26A 4P6DA 5AQUA 1TYQB 5M1NA 3ENBA 5M1KA 4BRMA 4BR7A 4Y0WA 2BH1A 2PFUA 1HRUA 3CI5A 3I33A 4H0PA 5C0YA 2AP1A 4IJAA 2Q0UA 3IUCA 3CJ1A 2BTFA 4FWOA 3JXUA 3CMAN 3HBTA 3HTVA 3CCSN 5FPEA 4CZKA 1ATSA 2NRHA 4H0VB 5AQIA 4O5FA 2HOEA 3I8BA 1NGIA 3L4IA 4IXCA 4WQ4C 3N4QA 3P38A 1YXQA 4YOWA 3UKRA 4DCHA 3VTIA 3ZEUA 4J8FA 5CE3A 4JN4A 1RGIA 5JICA 2GTDA 3CHWA 3F2KA 1W2BM 3CCLN 3P31A 4BC5A 5EOYA 2HBMA 5GIPA 1GLLO 3BUZB 3CXCM 1VQNN 1K4PA 2RIUA 2QTDA 1M1KO 4BRKA 2E1YA 2P9KB 1S22A 3CCVN 3ATVA 2QWPA 1Z05A 3H45C 4FOIA 3H3OB 4ISEA 3WQTA 2AA4A 5F0XA 4ILGB 3CPEA 5AZIA 5BN9A 3VEXA 4CZIA 5BN8A 4BQZA 1GLCG 3RVCA 2A40A 4I6MB 3ZYYX 1U2VA 2FSKA 5JLHA 1QQMA 4RWTA 3W0LA 5C10A 3K9JA 3EKSA 1VQ8N 4FWMA 4NZTM 4EHUA 1EQYA 3O8MA 3WEEB 5BPNA 1DT9A 4KH5A 4A5BA 2JWLA 5LJVA 1YF5L 1MWMA 2HBLA 5EY4A 3MMVA 3SK3A 3WXKA 1GLFO 3VF2A 4YOXA 4G9ZA 1ATNA 2FSJA 3VF4A 3WXMB 3HSCA 2A3ZA 5AQYA 1NLVA 1XC3A 3GE1A 1YVNA 4BRAA 4BR5A 2ZGZA 4K43A 1HLUA 3D2FA 3VF6A 4JD2B 5CHIA 2WBNA 3CQYA 3H1QA 4JKGA 4QS9A 3H1VX 3CCJN 1YJ9N 3I56N 2KKZA 4NZRM 4A57A 2YHXA 4PL8A 1IJJA 1GLAG 1MA9B 3O9TA 1M90O 4NLCA 2A5XA 2DPNA 2CH6A 3KZBA 4ILHA 3TSUA 3S41A 4Z94A 2KLAA 3CJBA 5AQOA 4IOCL 4P8EA 1GLJO 3UB5A 1E4FT 1U6ZA 4CI6A 3H3NO 2QXLA 5BRFA 2F9TA 3FZFA 1TYQA 4FWSA 1NGJA 4KH4A 3BEXA 4C1NK 1J6ZA 4EO0A 3A5MC 3GOIA 4H5NA 4ISFA 4XH5A 2NNWA 1SS6A 3J7ZO 2CH5A 4M63C 2OTLN 2YJEA 4EAHD 1BWFO 4JKAA 2HMPA 1QVGM 4GV3A 3FR0A 4YOVA 2P9PA 3DXKB 2F9WA 2WC9A 2JWKA 3CQXA 4E1BA 1HKGA 3O9QA 3CJAA 3ZEUB 3R9PA 4FCXA 3TPQA 2D0OA 2ZF5O 4JKEA 1VQKN 2NRWA 3VESA 4BGAA 5GAGP 5KPZA 3AGKA 2EQAA 1MWKA 5AQWA 3TSPA 2FXUA 2P9LB 5BPLA 4H5RA 5KQDA 3AAPA 1QVFM 1ATRA 1GLDG 2E1ZA 5B8HA 4CJ7A 4BRNA 1T6DA 3WXLA 4I6MA 5I9EB 4JD2A 2P9NA 4C23A 3UKUA 4AM6A 4MO4A 3NMUA 3MIOA 3A5LC 3UE5A 1VQ5N 3P39A 3D7EO 1S3XA 4B1XB 5HOOA 3A5NC 3C7NB 4GV9A 4WQ4A 3C7NA 5BRDA 4FFJA 2ZWHA 3CJ7A 3DJCA 4FWLA 5AQTA 4WFNL 2W40A 4A2BA 3MCAB 1VQ4N 3LL3A 1JCGA 4YOUA 5AQPA 5F2RA 1BU6O 5TKWA 4IO9L 2V7YA 3VOVA 4F9OA 1KAZA 4U67L 1WUAA 3M3ZA 5AQMA 3G71N 4CBXA 4BRHA 5C12A 4XH4A 1PVYA 1T3VA 3FZKA 3CCRN 3CCQN 3ZIGA 5AQNA 4DKWA 3PLAA 1DGKN 1NGAA 3DWLA 4JKGB 4BR9A 3OBYA 3AAQA 1KD1O 4CZHA 3A5OC 1K8KB 3A8YA 1R59O 3R8EA 1P8ZA 3VETA 5C2FA 4GNIA 4BRPA 4NB4A 2CGKA 3LDQA 3FE1A 1QZ6A 3HI0A 3ULEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VER A;  3TSU A;  3TSQ A;  3VEX A;  3VES A;  3VF2 A;  3VEW A;  3VEN A;  3VET A;  3TTF A;  3VTI A;  3VEZ A;  3TTC A;  3VEO A;  3TTD A;  3VF4 A;  3TSP A;  3VTH A; 
#chains in the Genus database with same CATH topology
 4QS8 A;  2F7T A;  5AR0 A;  2VWJ A;  2B4J A;  1XEZ A;  3ENH A;  1SV5 A;  4H0O A;  4DQ8 A;  4L3Q A;  4E19 A;  1YJN N;  4ICL A;  5HL7 L;  2QWQ A;  2JLE A;  3MED A;  4CD3 A;  1KLN A;  2G8H A;  1BQM A;  2VQF K;  3ZT0 A;  1NFH A;  5C42 A;  4CJU A;  3D0P A;  3V81 A;  4DQP A;  3OJS A;  5CZ2 A;  3C6A A;  4OJR A;  2HHV A;  1G99 A;  3M5R A;  4CES A;  4O0I A;  4LF4 K;  1NGB A;  3QIN A;  1LN4 A;  3VEV A;  1XUP O;  4DSJ A;  3VQ7 A;  3FFI A;  4CIF A;  2HHT A;  1L3V A;  4GMJ B;  4LF9 K;  2GWK A;  4A5A A;  4RW4 A;  5F1X A;  1EWQ A;  2NRX A;  2QWO A;  2E8A A;  2ZQB A;  4JKB A;  2QXF A;  4RW7 A;  3DRS A;  2ZJQ L;  2FSN A;  4DWI A;  3H46 O;  1JXB A;  3ASM A;  5AFU H;  3QEV A;  3AAR A;  1WSJ A;  1C0F A;  1ASV A;  4FVM A;  4FLU A;  3H6E A;  3V9X A;  3D2E A;  4JHD B;  1SL1 A;  4M7Y A;  3DSD A;  2HHH K;  4CZJ A;  3QO9 A;  1NGG A;  4A61 A;  3CYM A;  1JLQ A;  4BC4 A;  3IAB A;  2OZS A;  3PIP L;  2D0P A;  4DV6 K;  4J2E A;  1IV0 A;  4E1M A;  4B9M A;  1HNX K;  1QHA A;  2YHA A;  2NRR A;  1EXQ A;  1GOA A;  1E4G T;  2VGM A;  3GBT A;  2YKN A;  4JKC A;  2WOM A;  4KTQ A;  5C2D A;  1LAV A;  3DM2 A;  4H5T A;  4HVJ A;  1WAJ A;  4WF9 L;  5HRS A;  1HPM A;  3VQQ A;  3QIC A;  5JLF A;  5KGX A;  1HJO A;  3VGK A;  3E66 A;  1KC8 O;  2XHB A;  1OH8 A;  2YHY A;  3C6U A;  3OYD A;  2F96 A;  3OJU A;  5BRH A;  3AO5 A;  3WQU A;  1U45 A;  2VG6 A;  1OH7 A;  1VQ9 N;  4PA1 A;  4CZF A;  4DR4 K;  1HPZ A;  5AQZ A;  1Q7Y O;  1YJW N;  1QQO A;  1V4T A;  3SUN A;  3J8A A;  1TKZ A;  4NCX A;  3E9P A;  1GLB G;  3EO3 A;  4CJP A;  3SLC A;  2FBX A;  2P9S A;  1LAW A;  5GAH P;  3OYM A;  3HOS A;  4DSF A;  4B9S A;  3SPZ A;  3THV A;  3H08 A;  1RIL A;  4PKI A;  4KI6 A;  3WT0 A;  5MLC Q;  3THX A;  3R1X A;  5AQV A;  4M3U A;  2O8B B;  4HTL A;  2ZM6 K;  4F4K A;  2LSN A;  4AHS A;  2YHB A;  3U9D A;  4YDQ A;  4W5R A;  1X1P A;  4G1Q A;  2MX1 A;  5AQX A;  4OGC A;  4HUG A;  4YDU C;  1JKH A;  1SNN A;  3TAB A;  3IAL A;  3V9S A;  2OCE A;  4X64 K;  3BP8 A;  3QBX A;  3G4S N;  5LJW A;  3O80 A;  1VAZ A;  4B9Q A;  3HL8 A;  3MK6 A;  2FF3 B;  3ZCM A;  3G0Z A;  3O6W A;  4IOA L;  3P5J A;  2IIR A;  1K49 A;  4B1U B;  1QSS A;  2O8E B;  3O9S A;  1VRT A;  4MDA A;  3OYG A;  3SQ1 A;  3TTF A;  4PKH A;  4HVC A;  1XHX A;  5TKY A;  3R6M A;  4B3M K;  4RW8 A;  2P9K A;  4KB1 A;  2IC3 A;  4P6C A;  4H0Y B;  5AQH A;  3TR8 A;  4MLE A;  4NXN K;  4A59 A;  3MX2 A;  4BVO A;  2Q97 A;  1OH5 A;  4FLV A;  1KQS M;  4CJE A;  2QWM A;  5KPR A;  4F2R A;  3HJF A;  3I55 N;  3QEP A;  2IOC A;  3T1Y K;  3E1Y A;  1LW0 A;  4DV1 K;  5AQJ A;  4LF7 K;  2VWK A;  3VER A;  3EL2 A;  2ASM A;  1CXQ A;  4JK9 A;  4IEE A;  2XO7 A;  3SUO A;  1NK7 A;  2G8F A;  4JK7 A;  3NH1 A;  3AVC A;  3M6G A;  4JI2 K;  3ZIH A;  4MQ3 A;  5ADX H;  3ISN C;  4EP5 A;  4Q0B A;  1XNQ K;  1NKE A;  4FWK A;  5BRE A;  4QS7 A;  4CVN E;  4W5N A;  3M8R A;  1RT7 A;  4BRO A;  3QBW A;  3TAP A;  1WN7 A;  1HX1 A;  1BI4 B;  4I14 A;  1BA1 A;  1YTA A;  1X3M A;  5AFU A;  2GEM A;  2P9L A;  4N41 A;  3K0S A;  1DCJ A;  3I0S A;  4FWN A;  3HPO A;  1O1W A;  4CD1 A;  4LFA K;  4DHY A;  3W3D A;  2V52 B;  3HRG A;  4YOT A;  3DRP A;  3QB0 A;  4AF1 A;  1RDB A;  4BE2 A;  2GX9 A;  4IZ9 A;  3LZJ A;  1TK0 A;  1S1V A;  5BR9 A;  4FLX A;  3JAM O;  2W42 A;  1JCF A;  3C95 A;  4GKK K;  3LRJ A;  3RMA A;  2P9S B;  5GIO A;  3RRG A;  1UA1 A;  1VSJ A;  4NYF A;  3SMP A;  3VEO A;  1S5J A;  3HPH A;  2QK9 A;  2VYP A;  3LDS A;  4CHN A;  1C1A A;  4HCC A;  3ZX2 A;  3CFO A;  1VSE A;  4BRF A;  2QKB A;  4DUY K;  3IKM A;  4IO8 A;  1QTM A;  3LM9 A;  4CFA A;  4PL7 A;  3IG1 A;  4CJF A;  4OKJ A;  4E7K A;  4B1Z A;  3RWU A;  3ZLJ A;  3QKB A;  3HZ6 A;  5E26 A;  3IAB B;  1B9D A;  3ZSX A;  3HXM A;  4CGD A;  1EX4 A;  4BRM A;  2ZD1 A;  4BR7 A;  3OYC A;  2BTF A;  3JXU A;  1A5W A;  2XRI A;  4F3O A;  5AQI A;  3I8B A;  1NGI A;  4GKJ K;  3P38 A;  3V9U A;  3UKR A;  3ZEU A;  5CE3 A;  4CHQ A;  3E01 A;  3QEX A;  4CEQ A;  5GIP A;  1GLL O;  3RMD A;  1NH9 A;  4BRK A;  4CHY A;  2EHG A;  5K14 A;  3H45 C;  3MEC A;  4DV0 K;  4NCB A;  2HB5 A;  3WNE A;  4IG3 A;  3CPE A;  5AZI A;  5BN9 A;  4CZI A;  3F73 A;  3RRH A;  1GLC G;  4FJK A;  1SKS A;  3AVK A;  5JLH A;  4CGG A;  3AVL A;  1QQM A;  4CJT A;  4JI7 K;  2Y1B A;  3OYH A;  4FW2 A;  3EKS A;  4ZTF A;  4IG0 A;  3WEE B;  4FJG A;  4A5B A;  5LJV A;  1MWM A;  2HBL A;  5HLF A;  1Z25 A;  3SK3 A;  3VF2 A;  4BDY A;  4DFP A;  2FSJ A;  4LSL A;  5HRO A;  2PYL A;  1QS4 A;  1XC3 A;  3GE1 A;  1L3T A;  4K43 A;  4CK1 A;  3D2F A;  3PSI A;  3VF6 A;  4JD2 B;  3KLE A;  1RT4 A;  3TOE A;  3H1Q A;  4JKG A;  4K8X A;  3I56 N;  4DU1 A;  2EH1 A;  2A5X A;  3G71 N;  4ILH A;  3TSU A;  1XHZ A;  1T8E A;  2D0A A;  4IOC L;  3UB5 A;  1E4F T;  3DMJ A;  1U6Z A;  4CI6 A;  5BRF A;  3FZF A;  1TYQ A;  4CK2 A;  1HJR A;  1WNS A;  1RT2 A;  3BEX A;  4EO0 A;  4ISF A;  2JGU A;  3AA3 A;  4M63 C;  1Q9X A;  2YJE A;  1BWF O;  1QVG M;  1H4T A;  4YOV A;  5BR8 K;  3DXK B;  3NCI A;  3IAY A;  3CM5 A;  1RT3 A;  4DQS A;  4FM1 A;  4FCX A;  2ZF5 O;  2NRW A;  3QER A;  4ELT A;  4B3O A;  3AGK A;  3JYT A;  2EQA A;  5T7B A;  3V6D A;  4CJ5 A;  2O4I A;  2P9L B;  4H5R A;  1QVF M;  2E1Z A;  2F4V K;  4BRN A;  1T6D A;  3WXL A;  4Z0U A;  3T3F A;  2HNZ A;  1RT6 A;  3UE5 A;  1VQ5 N;  4QAG A;  1S3X A;  1TAQ A;  3A5N C;  4M3R A;  4GV9 A;  4WQ4 A;  3TAG A;  5KGW A;  1CXU A;  3ZT4 A;  1LV5 A;  1IBL K;  2Q3S A;  1FW6 A;  4CBX A;  1FKO A;  3ZIG A;  4DKW A;  2I5J A;  3OYI A;  1NGA A;  5I42 A;  1WBB A;  3L2R A;  2E6M A;  3HP9 A;  1UAX A;  1KD1 O;  4CZH A;  2OPR A;  3R8E A;  3VET A;  4CFD A;  4GNI A;  3S3N A;  2CGK A;  4FJ9 A;  3ZT3 A;  5CYM A;  4M7X A;  4H8K A;  4RCH A;  4B1Y B;  2V51 B;  4CGF A;  4PUO A;  1I3A A;  5AQF A;  3PX0 A;  3TAR A;  1RBT A;  3MGZ A;  1P90 A;  3EN9 A;  3HVT A;  5M1Q A;  2EWS A;  3U9Z A;  3HOT A;  2A1R A;  1QE1 A;  2P9N B;  3OYE A;  1YVU A;  3OY9 A;  4E7I A;  2DFF A;  3DLK A;  4UY8 O;  3RMB A;  1NGF A;  1HNZ K;  3AVF A;  3DSC A;  5CY4 A;  4DR6 K;  4DSI A;  2WUS A;  1U04 A;  4ID5 A;  4H0X B;  2YJF A;  3LWL A;  2HHU A;  1VQL N;  1G57 A;  3SCX A;  3GG4 A;  2GTC A;  1KTQ A;  3O4W A;  3VEN A;  4E89 A;  4K87 A;  3SQ4 A;  1S1X A;  4IFY A;  4JAX A;  5LL6 Z;  3V1O A;  1YUW A;  1C0T A;  4WYB A;  3MXI A;  1VSD A;  3DLG A;  1O13 A;  3WEE A;  3LZI A;  1ZBS A;  4WFB L;  4CF0 A;  3DOK A;  4GV6 A;  3KD5 E;  3O3G A;  3DLL L;  4LD0 A;  4FJM A;  3AV9 A;  4B3R K;  3ZSQ A;  3SQ0 A;  4WQ5 C;  1CZA N;  2VGN A;  1LOT B;  2Q36 A;  4IOX A;  3S3M A;  4FO0 A;  3U6F A;  5M1P A;  4FOE A;  3VQD A;  3SQ2 A;  2P9P B;  1WSI A;  3P04 A;  1NJ6 A;  3M8P A;  1A5V A;  2BGG A;  5AQL A;  3ULE A;  1DEJ A;  4LH5 A;  2PY5 A;  2Q2R A;  3DXM A;  2HF3 A;  3AA5 X;  1VSM A;  4YDU A;  3L2U A;  5J2P A;  4OPK A;  4FJ7 A;  1BQN A;  3O3F A;  1VQ6 N;  1G15 A;  3PY8 A;  1VSF A;  3LP0 A;  1WSE A;  4E1J A;  2A2Y A;  4CER A;  5AQR A;  4JI8 K;  1L3U A;  2A42 A;  4B8C A;  4Q15 A;  3VEZ A;  1D4X A;  3LAL A;  4DV4 K;  3MEE A;  1LCU A;  3LPU A;  1RDD A;  1FJG K;  1HUX A;  4W5O A;  3TAE A;  3IDH A;  4X62 K;  1RBU A;  4OPA A;  2P9U B;  4BRC A;  4CGH A;  4CJW A;  3OTO K;  1UWB A;  4DR5 K;  3CIP A;  3O1B A;  1K73 O;  1NBW A;  4X65 K;  4BDP A;  1X9W A;  1IEZ A;  3ZSV A;  3D2E B;  4JHD A;  4OKE A;  4DFM A;  3SYZ A;  5I3U A;  3VGM A;  3TAN A;  4HCB A;  3VQ5 A;  2FBT A;  4B9T A;  4NO7 A;  1YAG A;  2QWN A;  2H3G X;  2X6N A;  2I7N A;  3E9O A;  1B9F A;  2VCP A;  4KRE A;  3SUP A;  4WE1 A;  2Q31 A;  1WSH A;  4PWD A;  5EVZ A;  4FJH A;  5JVH L;  4E7H A;  3L2V A;  1VQP N;  4LFC K;  3C6H A;  1GLE G;  1ZBU A;  2DTU A;  3FZL A;  4JLH A;  3O9R A;  1JCE A;  1Q8I A;  4CCH A;  2ZJP L;  3QIO A;  1YHQ N;  3PX4 A;  5IT9 O;  2L8Y A;  4KAZ A;  4DG1 A;  2G8I A;  4LH4 A;  3VEY A;  1J5O A;  3VA0 A;  1HQU A;  2BE2 A;  2YX6 A;  4HWI A;  3RMC A;  5KQ8 A;  4JRP A;  4O8U A;  2E2N A;  3LP2 A;  4IJN A;  3LVJ C;  3F5T A;  4FLT A;  1KCF A;  5AQK A;  4L8R B;  4FCY A;  4A62 A;  4FSV A;  4CEB A;  2E2P A;  2A6A A;  3GDQ A;  5KPT A;  3QIP A;  3T69 A;  3TTC A;  3VGL A;  1J53 A;  3Q7B A;  3V9Z A;  1UDV A;  4NCA A;  4P6P A;  3DYA A;  4GW6 A;  1BA0 A;  2UUA K;  4OLB A;  1VHX A;  3DAW A;  3L6Q A;  3DLH A;  3NVK A;  5HP1 A;  1K7J A;  4N56 A;  2P5O A;  1NM1 A;  3AO2 A;  2D0B A;  1TKU A;  2G8W A;  3AO3 A;  2B6A A;  1QQN A;  3SBG A;  2YNG A;  5HRN A;  3HT3 A;  4GY2 B;  2CGJ A;  1JO0 A;  2ITM A;  3MN6 A;  5EXW A;  1XMQ K;  2E2Q A;  1DKG D;  4YOR A;  2IVO A;  4KHY A;  1K8K A;  4FLW A;  3SJJ A;  3L7V A;  1J54 A;  4DSL A;  2HVI A;  3EE8 A;  2RPI A;  3VQ8 A;  4DSE A;  4ID1 A;  5CR4 A;  3I0R A;  4E1N A;  1BIZ A;  1H1V A;  3QEW A;  3OYF A;  4EP4 A;  4A2A A;  3NE6 A;  4M3W A;  4M41 A;  4DTO A;  2VG7 A;  3J80 O;  4Z4C A;  1HNW K;  1U2V B;  3CC7 N;  4IDH A;  1RBV A;  5E84 A;  4BE0 A;  1TAU A;  5H1S Q;  1KAY A;  3KJV A;  2IVP A;  3MN5 A;  4N5S A;  5AQS A;  4FM2 A;  3WXJ A;  2R7Y A;  1BL3 A;  3LS6 A;  5D3G A;  3LDO A;  4ISG A;  4K25 A;  3OYK A;  1SQK A;  1NK8 A;  3C94 A;  3TSQ A;  2QEX N;  4DV3 K;  5EX5 A;  1H4S A;  2HHS A;  3P83 D;  1S6Q A;  1PAV A;  1IG8 A;  3U8X A;  1OKJ A;  4P6D A;  4JKD A;  4LY7 A;  3OYA A;  4CE9 A;  1TYQ B;  4KHS A;  5M1N A;  2VG5 A;  5M1K A;  4JI3 K;  4Y0W A;  4H0P A;  3PO5 A;  5C0Y A;  2AP1 A;  4B8A B;  2Q0U A;  1HQE A;  4XIU A;  1NJ2 A;  1VSH A;  2YV0 X;  4EZ6 A;  1LWC A;  1ATS A;  4Z4G A;  2IDO A;  4O5F A;  4IXC A;  1S1U A;  3L4I A;  4WQ4 C;  3N4Q A;  4OLF A;  1YXQ A;  2FC0 A;  4DCH A;  4J8F A;  1RDC A;  5JIC A;  3CCL N;  4HD0 A;  3P31 A;  4FK2 A;  4J2D A;  2QTD A;  4LF8 K;  1QQC A;  2E1Y A;  2Y1I A;  4FYD A;  2P9K B;  2QWP A;  4FK0 A;  4ISE A;  2KZM A;  2AA4 A;  2NUB A;  4BE1 A;  1C1B A;  3VEX A;  4I6M B;  5JS2 A;  2OYQ A;  3THW A;  4Z9E A;  3AVN A;  2WTU A;  3AO4 A;  3K9J A;  3LAK A;  4EHU A;  4NZT M;  1BCM A;  1DT9 A;  1GLF O;  3NF7 A;  4G9Z A;  4I7F A;  4KFB A;  1EP4 A;  4BR5 A;  1NLV A;  1YVN A;  4CFC A;  3OYL A;  4CED A;  1HLU A;  3OS1 A;  5C24 A;  1S1T A;  5CHI A;  4DR2 K;  3CQY A;  1BIU A;  2YHX A;  2O8D A;  1GLA G;  3O9T A;  4CF1 A;  1W9H A;  3S41 A;  2CH6 A;  2EK0 A;  1BCO A;  5AQO A;  3K5L A;  3WNG A;  3K5O A;  1W7A A;  2QXL A;  4ELV A;  4JI0 K;  1C6V A;  1J6Z A;  4H5N A;  4XH5 A;  3J7Z O;  4CF2 A;  1KFS A;  3HM9 A;  5KRT A;  3BGR A;  3FR0 A;  3QEI A;  2WC9 A;  1XMO K;  3CQX A;  2IAJ A;  4E1B A;  3NGI A;  4HUF A;  3O3H A;  4E7L A;  1NJ8 A;  3R9P A;  4DU4 A;  4CGJ A;  2ZE2 A;  4DS5 A;  3VES A;  3IRX A;  1E3M A;  5GAG P;  2KZZ A;  4CJK A;  2FXU A;  3CFP A;  4CJ7 A;  1F21 A;  4H4M A;  2HMI A;  4JD2 A;  4AM6 A;  4KTW A;  3VQE A;  1KFD A;  3NAE A;  4B1X B;  5HOO A;  3MXM A;  3C7N B;  3C7N A;  5BRD A;  3QET A;  3CJ7 A;  3DJC A;  4FWL A;  5AQT A;  4WFN L;  1VQ4 N;  3MCA B;  3HZ7 A;  4JS5 A;  2G8K A;  1BU6 O;  3B6P A;  4CIG A;  3VOV A;  4F9O A;  1KAZ A;  4HUE A;  4U67 L;  1KSP A;  4J2A A;  4I2P A;  5AQM A;  1S8E A;  4BRH A;  1NK0 A;  4XH4 A;  2E6L A;  2P51 A;  3FZK A;  2XY5 A;  5AQN A;  3U3G A;  3KKR A;  4CHP A;  1VSK A;  1S6P A;  4BRP A;  1T05 A;  3FE1 A;  1BI4 A;  3RSE B;  3HI0 A;  5DMR A;  3LM2 A;  4N76 A;  2E2O A;  4DTR A;  5AJ3 K;  4FPA A;  4KH6 A;  3FZM A;  3HST B;  2HHX A;  4FJN A;  4HVZ A;  3KWI A;  3J81 O;  1YIJ N;  4PY5 A;  2OPP A;  4JI1 K;  2OPQ A;  4DTP A;  3VPZ A;  3PIO L;  5CYQ A;  4CIE A;  1IH7 A;  4F3T A;  3U3Y A;  2NRV A;  4FWQ A;  1NGE A;  4KKO A;  1C1C A;  2NZT A;  2UYT A;  3B8A X;  4YFU A;  5IWA K;  4YY3 K;  2X6S A;  3PSF A;  1J9A A;  2FBY A;  1NMN A;  2IFE A;  1L3S A;  1VRU A;  4BRG A;  1NFJ A;  1HKB A;  1K4L A;  1S9E A;  3KK2 A;  2W6L A;  3EEQ A;  4WCE L;  3SNN A;  1BIS A;  1NJY A;  2O8F A;  4H03 B;  4BQL A;  3ZSY A;  1YIT N;  1NJW A;  4J2B A;  1XQS C;  3V1Q A;  1RTJ A;  4BRL A;  3OYJ A;  2P5G A;  1JE3 A;  3UKU B;  1XNR K;  4TSX A;  1KVB A;  3MDQ A;  4XH1 A;  4BC2 A;  3CJC A;  3RSE A;  2IGI A;  3TAF A;  5FRN A;  2BKY X;  3DI6 A;  1S72 N;  3PV8 A;  1RDA A;  4KHQ A;  4DLE A;  4CJ3 A;  3KLF A;  4DS4 A;  2ZJR L;  1RBR A;  3T19 A;  3QNO A;  4FBK A;  2XY6 A;  2UUB K;  1KXP A;  3BZC A;  4OLA A;  5ELZ A;  3EZ5 A;  2LN3 A;  2CGL A;  1TUY A;  1NOY A;  4C8O A;  2J4R A;  1JLF A;  3AA2 A;  3ZII A;  4KV8 A;  2HHW A;  3AGR A;  3D6R A;  3O4Q A;  3EYZ A;  3VQP A;  4ELU A;  4Z4E A;  3ZSO A;  4M45 A;  1TKS A;  2YI1 A;  2ETJ A;  3O9U A;  4BRI A;  3GL1 A;  3H07 A;  4OX9 K;  1CZB A;  4I9Q A;  1D9F A;  3MAQ A;  4R5P A;  5DM7 L;  1JCU A;  3VTH A;  2Z1J A;  3ZSW A;  3FGU A;  1DTT A;  2I7P A;  2D4W A;  4MFB A;  3DXK A;  5J1E A;  1IBM K;  1KVA A;  2PYJ A;  2P1J A;  2O8C A;  3IMX A;  1QHT A;  4KPY A;  4FPB A;  3OVN A;  3WNH A;  4O5B A;  4BRE A;  2QWL A;  3AVJ A;  5JVG L;  4CGI A;  1NNE A;  1JLB A;  1L5U A;  1Z6R A;  1N36 K;  3PX6 A;  4JKF A;  3AVA A;  1NWK A;  1BHL A;  3KLI A;  5HRP A;  4KHP K;  3HO1 A;  2PBD A;  2B5J A;  1TVR A;  5C15 A;  4BGB A;  1TL1 A;  3I8D A;  3ATU A;  1N8R O;  4DR1 K;  2PAV A;  3A0I X;  3O5B A;  1Y64 A;  4RW6 A;  4DU3 A;  4FBQ A;  3R3L A;  1FK9 A;  3LDL A;  3KVG A;  4JK8 A;  2G8U A;  3JSM A;  2D5R A;  2HF4 A;  3MK5 A;  1VQM N;  4FZY A;  3LP1 A;  4RG8 A;  3Q7C A;  2QM1 A;  4O55 A;  2P9I B;  2UU9 K;  3SV3 A;  3P1G A;  3VQ4 A;  2OA8 A;  4JKH A;  1LW2 A;  3SAH A;  3VQC A;  3KHY A;  1SZ2 A;  3HVR A;  3CD6 N;  1W0H A;  2WON A;  4DMN A;  1BDG A;  3K9K A;  1YT3 A;  4FBW A;  1K8A O;  2ASP A;  1NMD A;  1WAF A;  1SKW A;  3L3U A;  4CZL A;  4YNQ A;  4M3T A;  2UXB K;  1NGD A;  4K41 A;  4JS4 A;  3ITH A;  3UIQ A;  1Y2I A;  1RCH A;  4CJQ A;  3F9M A;  3B6O A;  3C65 A;  4U7B A;  1U4B A;  4FW1 A;  3WUH A;  5KRS A;  4CZG A;  3V4I A;  4LF5 K;  3NVM A;  4CHZ A;  4GVM A;  1NG9 A;  2Q1N A;  3BZK A;  5AZJ B;  4AHC A;  4AHR A;  4KI4 A;  2RE2 A;  4K0K K;  3CPW M;  4DFJ A;  1ZC6 A;  4QCL A;  2GBZ A;  4YOY A;  2P9U A;  2RF2 A;  1PVW A;  4FWP A;  5LY3 A;  4RWT A;  3FLC O;  3LWM A;  4DUZ K;  2O8F B;  3CCU N;  1NOZ A;  3NHG A;  4E7J A;  4O44 A;  3MN7 A;  4CEF A;  3M8S A;  2O8B A;  4B1W B;  3G6E N;  2GV9 A;  2KHO A;  3ID6 A;  1I94 K;  2HVH A;  3CCE N;  4FWR A;  2YNF A;  3CME N;  1RDW X;  3TAQ A;  2VQE K;  4NLB A;  4JEP A;  2GUP A;  4BC3 A;  4BG9 A;  4CBW A;  1LWF A;  3DLR A;  3G25 A;  3MWP A;  5AZI B;  4MDB A;  5SZT A;  3HM8 A;  4LC9 B;  4C8L A;  4FJ5 A;  2EX3 A;  1Q18 A;  2D1K A;  4YKE A;  2QI2 A;  2X74 A;  4PQU A;  3WNF A;  1ESV A;  3AA4 A;  2OAN A;  4C8M A;  4KHU A;  2F8S A;  1Q86 O;  3O1W A;  1B92 A;  3QFP A;  4Y1D A;  2ZGY A;  1DLO A;  3QDK A;  4BR4 A;  5GAE P;  3ID8 A;  4TWA A;  1N34 K;  5BPM A;  2BUP A;  3VQA A;  4B3T K;  4R79 A;  4DB3 A;  3OHR A;  3VMF B;  4BR2 A;  4RTF D;  1WSG A;  3M1F A;  1RFQ A;  2UUC K;  1TIG A;  3MWT A;  4CF9 A;  3DOL A;  2KTQ A;  4W5Q A;  4MO5 A;  4PHT X;  2GWJ A;  4EIA A;  1Q9Y A;  4K42 A;  2NRT A;  4LF6 K;  2O8C B;  3KKS A;  4DV7 K;  5AQU A;  1ASW A;  1VK0 A;  1ITG A;  3U6Y A;  3L3V A;  3ENB A;  2BH1 A;  4K86 A;  5FDL A;  4KHW A;  3CJ1 A;  4FWO A;  1OVQ A;  3CMA N;  3HBT A;  3CCS N;  1D9D A;  4JRQ A;  3ZET B;  2O8E A;  2HOE A;  1S9G A;  4DF4 A;  3TI0 A;  4OVL A;  4CJL A;  4YOW A;  3O4N A;  2D0C A;  1X9M A;  3ZSR A;  3TAM A;  1NJ5 A;  1Z26 A;  3F9K A;  2GTD A;  3CHW A;  1W2B M;  4BAC A;  4BC5 A;  1VQN N;  3LAM A;  3K57 A;  3K59 A;  1RTI A;  4OGE A;  3VA3 A;  3ATV A;  4FOI A;  1Z05 A;  3WQT A;  4AHU A;  4JI6 K;  4ILG B;  1HYV A;  5BN8 A;  2ATQ A;  3RVC A;  2A40 A;  4BWJ A;  4DQR A;  4JI5 K;  2FSK A;  2DFE A;  3W0L A;  1QSY A;  5C10 A;  1VQ8 N;  4E0D A;  4FWM A;  1UOC A;  1EQY A;  3O8M A;  2OPS A;  4JYA K;  1ZYQ A;  3MMV A;  5KTQ A;  5LMU K;  4YOX A;  1NK4 A;  1ATN A;  3VF4 A;  3WXM B;  3HSC A;  2A3Z A;  3CG7 A;  4BRA A;  4KO0 A;  5E41 A;  3L8B A;  1KRP A;  4KRF A;  4AHT A;  2YNH A;  4QS9 A;  4DF8 A;  2KKZ A;  4EZ9 A;  4NZR M;  1SUQ A;  2E5L K;  4PL8 A;  1J5E K;  1M90 O;  1VR4 A;  4NLC A;  1IO2 A;  1EWR A;  2KLA A;  4Z94 A;  4B9U A;  1C0M A;  4B9L A;  2F9T A;  4M3Z A;  4KH4 A;  4C1N K;  3A2F A;  2NNW A;  1CLQ A;  1HR0 K;  3DRR A;  4EAH D;  1D8Y A;  4JKA A;  2HMP A;  3K5M A;  2JWK A;  1BGX T;  3J7Y P;  2F8T A;  1SKR A;  3O9Q A;  4HHT A;  3BY5 A;  3TWH A;  4JKE A;  1VQK N;  1IKX A;  4FJL A;  4BWM A;  4BGA A;  3G10 A;  5KPZ A;  5AQW A;  4JI4 K;  1ZBH A;  1WBD A;  1GOC A;  4JV5 K;  4CEC A;  5BPL A;  5KQD A;  3AAP A;  4CEE A;  4CF8 A;  4KTZ A;  1GLD G;  5B8H A;  5KI6 A;  4DTJ A;  4LFB K;  1Y97 A;  4I6M A;  5I9E B;  1JLC A;  2M71 A;  4C23 A;  1N5Y A;  4MO4 A;  3A5L C;  3P39 A;  2O8D B;  3IS9 A;  1LWE A;  1NU0 A;  1SL2 A;  4DQQ A;  2W40 A;  4A2B A;  4DQI A;  1JCG A;  5AQP A;  2V7Y A;  5HBM A;  4YHH K;  3VQB A;  3M3Z A;  3S9H A;  3NH2 A;  1ZBF A;  1C0U A;  3OS2 A;  5SWM A;  5C12 A;  1YTU A;  1T3V A;  4IBN A;  3ALY A;  3CCR N;  4AIL C;  4C8K A;  3PLA A;  2KFZ A;  3DWL A;  4JKG B;  3AAQ A;  2KW4 A;  3A5O C;  1K8K B;  1HMV A;  3A8Y A;  5C2F A;  1P8Z A;  1HYS A;  4NB4 A;  2OZM A;  1HYZ A;  4O4G A;  3CET A;  1QZ6 A;  4FXD A;  5C25 A;  1H4Q A;  1TKX A;  4W5T A;  2Y1J A;  2E20 A;  3EKU A;  4FK4 A;  4V19 S;  1WSF A;  2O4G A;  5GAD P;  2HST A;  3L0Q A;  2HNY A;  5JMV A;  5J2M A;  3EZW A;  4H5W A;  3HK2 A;  1HNV A;  5J2Q A;  2QWR A;  4HTU A;  1WB9 A;  4DTN A;  1IKY A;  3LDP A;  2BAN A;  1T44 A;  4BG8 A;  2HBJ A;  1EKE A;  3MEG A;  2W41 A;  2LXR A;  3L2W A;  1RDU A;  2KQ2 A;  4NCG A;  4CZE A;  1TKD A;  4OO1 J;  2UXD K;  4CZM A;  5HRR A;  3SAG A;  2RHK A;  2NLX A;  1JLE A;  4B3S K;  2UXC K;  4N47 A;  4M3Y A;  4OPJ A;  2ASO A;  5FLX O;  2Q3V A;  4CJ4 A;  3IFR A;  4FL9 A;  3NGY A;  1KAX A;  3THW B;  4IKF A;  4ILJ A;  3CF5 L;  3SI6 A;  1RT1 A;  4IFE A;  3DLE A;  1WLJ A;  1NJZ A;  4FJX A;  4X66 K;  2GEL A;  4Y1C A;  3CJ9 A;  3RR7 A;  1HC7 A;  3ENO A;  4CJS A;  3OA9 A;  2YCH A;  2QA4 N;  1K4I A;  1CZ9 A;  1KK9 A;  2H9U A;  1BUP A;  4FVU A;  4EHT A;  2FBV A;  3U4L A;  4BVP A;  1NK9 A;  2W6K A;  1BOT O;  4BRD A;  4DR7 K;  3UKR B;  3TTD A;  3T1A A;  1X9J A;  3VEW A;  1HKC A;  3SAF A;  3NF9 A;  3THY B;  3SZ2 A;  1VQO N;  2IVN A;  1RT5 A;  3FZH A;  3O08 A;  1EO1 A;  4BR0 A;  1SAZ A;  5FPM A;  1EET A;  1X3N A;  4DFK A;  1T7P A;  4IWV A;  3MX5 A;  3RR8 A;  3KWG A;  3E9L A;  4GVE A;  5M1F A;  1Q82 O;  3DLB A;  3ZX0 A;  4CEO A;  2NRZ A;  3OW2 M;  1NJ1 A;  4KBO A;  4P8J A;  3BF1 A;  3CER A;  3MN9 A;  4OPH A;  4B1V A;  2QKK A;  5AQG A;  1QZ5 A;  5DM6 L;  1KVC A;  4CBU A;  2RIS A;  4LSN A;  5DK5 A;  1ILY A;  2HBK A;  3MCP A;  3KLG A;  1VQ7 N;  4BY9 C;  3SMS A;  2FF6 A;  2RN2 A;  4DTU A;  4OKK A;  4P77 A;  3QNN A;  3HYF A;  4DTM A;  1VM0 A;  1K9M O;  3P4I A;  1KLM A;  2E88 A;  1ZBL A;  4JNE A;  4DV5 K;  1HNI A;  4C1N I;  5FPD A;  1IKW A;  3AVG A;  3EY1 A;  1Q81 O;  2YKM A;  1T6C A;  3NF8 A;  4CJV A;  4EFH A;  3ZET A;  1U49 A;  2XY7 A;  1MDU B;  4K8Z A;  3T7Z A;  4H4O A;  3LP3 A;  4M3X A;  2OTJ N;  5AQQ A;  4B08 A;  4QOZ B;  2ITG A;  3DXM B;  2Q0R A;  2XY8 A;  4CFB A;  3WXI A;  5GIN A;  2BDP A;  4BDZ A;  2YHW A;  1JLG A;  3ZIE A;  2A41 A;  1TUU A;  1IG9 A;  2RKI A;  3PUF A;  2GUI A;  1BO5 O;  3RTV A;  1TK8 A;  3V1R A;  3AJE A;  2HND A;  1QSL A;  4Z4F A;  1OVY A;  4WQ5 A;  3WBM A;  3K58 A;  1C0G A;  1WOQ A;  5ADX A;  3NFA A;  3FFK B;  4AM7 A;  1HRH A;  4CEZ A;  5JS1 A;  1RBS A;  1NK6 A;  2QW9 A;  3AVM A;  4O0J A;  4BRQ A;  3T1I A;  5FRM A;  1G58 A;  2V7Z A;  1GOB A;  5LMN K;  1JJ2 M;  3QFU A;  1IKV A;  4DTX A;  4NXM K;  4FM0 A;  4WFA L;  1TGO A;  3SBT A;  1ZXO A;  1NKB A;  1IBK K;  3OBW A;  3KD1 E;  4DTS A;  1W97 L;  2FLO A;  3HPG A;  1V4S A;  3JS6 A;  4O8K A;  2IS3 A;  4PKG A;  3C6T A;  3CCM N;  5FPN A;  2P9B A;  3NDK A;  4XEI A;  3TU5 A;  1Y9X A;  3L4Q A;  4IFV A;  3HP6 A;  4F2S A;  3LVK B;  4DSK A;  4MLH A;  4FLZ A;  3K5N A;  4KB0 A;  4Q5V A;  3AY9 A;  3T1H K;  2P9I A;  4H0T B;  1BG3 A;  1YI2 N;  1XC9 A;  3CC4 N;  1FXX A;  3CC2 N;  1JL2 A;  2HW3 A;  3QML A;  1X9S A;  3C0B A;  4FZX C;  4I2Q A;  3OYB A;  3BF3 A;  5AZJ A;  3ZT2 A;  1VSI A;  3SUQ A;  3THY A;  1NGC A;  1NGH A;  1XI1 A;  1ASU A;  1NJI O;  2HHQ A;  2VWB A;  1VSL A;  4IEI A;  1K4O A;  3LDN A;  5M1O A;  3KK7 A;  4FJ8 A;  5J2N A;  4H5V A;  3EE9 A;  3D2F B;  1DTQ A;  3ZX3 A;  1RTD A;  3N4P A;  2WFB A;  1RNH A;  3ZSZ A;  4M42 A;  4K88 A;  1N32 K;  1NKC A;  4RW9 A;  2PFU A;  4Z4I A;  2KFN A;  3CI5 A;  3I33 A;  1HRU A;  4IJA A;  1H0Y A;  4I9L A;  3IUC A;  4Z4H A;  3HTV A;  5FPE A;  3D45 A;  4CZK A;  3SJH A;  2NRH A;  4H0V B;  4DV2 K;  1TK5 A;  2Z1I A;  4CJR A;  4DR3 K;  2PZS A;  3VTI A;  4JN4 A;  1MU2 A;  1RGI A;  3VQ9 A;  4FLY A;  3F2K A;  3V9W A;  3K2P A;  3MXJ A;  2HBM A;  5EOY A;  3BUZ B;  3CXC M;  1SL0 A;  1K4P A;  2RIU A;  1M1K O;  1JLA A;  1II7 A;  1S22 A;  1OH6 A;  3CCV N;  3H3O B;  1ZBI A;  1U47 A;  2E4L A;  5F0X A;  4ZHR A;  1T03 A;  2Z1H A;  4E3S A;  4BQZ A;  1R0A A;  3ZYY X;  4UQG A;  1U2V A;  3VN5 A;  4AQY K;  4B9N A;  3AVI A;  1UA0 A;  4B9V A;  1N33 K;  3CQ8 A;  3SV4 A;  1JXE A;  5BPN A;  4KH5 A;  4KHN A;  2JWL A;  3NF6 A;  1YF5 L;  3QES A;  5CZ1 A;  5EY4 A;  3WXK A;  3KK1 A;  1K6Y A;  3OYN A;  4ZTJ A;  5AQY A;  2Z1G A;  2ZGZ A;  3NGZ A;  1JDQ A;  3AVH A;  3NBP A;  3KTQ A;  3J7A P;  3BDP A;  1XWL A;  3PO4 A;  2WBN A;  1H0X A;  2Z7C A;  3H1V X;  3CCJ N;  1YJ9 N;  1RQ8 A;  4AH9 A;  4A57 A;  3NH0 A;  1IJJ A;  3KK3 A;  1MA9 B;  2CRQ A;  3ULD A;  3LPT A;  3VQ6 A;  3QLH A;  3LQU A;  2DPN A;  3KZB A;  4CEA A;  4CK3 A;  1NJX A;  2G8V A;  3CJB A;  4P8E A;  5EU7 A;  1GLJ O;  4NYN A;  4CW7 B;  3H3N O;  4IDK A;  4AHV A;  4FWS A;  1NGJ A;  1FKP A;  1S1W A;  3GOI A;  3A5M C;  1NK5 A;  4FJI A;  1REV A;  1SS6 A;  3SPY A;  2CH5 A;  4DLG A;  2OTL N;  4GV3 A;  2P9P A;  2F9W A;  3AVB A;  1HKG A;  3S3O A;  1I39 A;  3CJA A;  3ZEU B;  3TPQ A;  2D0O A;  1MWK A;  1TV6 A;  3TSP A;  1A5X A;  4FJJ A;  1ATR A;  1D5A A;  2AJQ A;  2YNI A;  1TKT A;  4CHO A;  3LAN A;  2P9N A;  3UKU A;  3MIO A;  3NMU A;  1RTH A;  3AO1 A;  3D7E O;  1JL1 A;  1TL3 A;  4FFJ A;  2ZWH A;  1U48 A;  3KLH A;  3LL3 A;  4YOU A;  5F2R A;  4IO9 L;  5TKW A;  4WI1 A;  1WUA A;  3CFR A;  2DY4 A;  2A1S A;  3M8Q A;  3ZT1 A;  1PVY A;  3KIO A;  3OS0 A;  2X78 A;  3CCQ N;  3THX B;  4C8N A;  1N6Q A;  5A2Q O;  1DGK N;  4BR9 A;  3OBY A;  4F8R A;  1R59 O;  2DFH A;  4FZZ A;  3L2Q A;  3LDQ A;  3CM6 A;  5FRO A;  3ULE B; 
#chains in the Genus database with same CATH homology
 3LM2 A;  4QS8 A;  2F7T A;  5AR0 A;  2E2O A;  2V51 B;  4FPA A;  2E20 A;  3FZM A;  4KH6 A;  1XEZ A;  3EKU A;  3ENH A;  4HVZ A;  3KWI A;  4H0O A;  4DQ8 A;  4L3Q A;  1YIJ N;  5AQF A;  1YJN N;  5HL7 L;  2QWQ A;  4CD3 A;  5GAD P;  2HST A;  3L0Q A;  4RCH A;  1P90 A;  3EN9 A;  3VPZ A;  3MGZ A;  5M1Q A;  2EWS A;  3U9Z A;  5JMV A;  3HOT A;  3PIO L;  3EZW A;  3C6A A;  4H5W A;  1G99 A;  3M5R A;  3ZET B;  1NGB A;  3VEV A;  2P9N B;  1XUP O;  2NRV A;  4FWQ A;  1NGE A;  2QWR A;  4UY8 O;  2NZT A;  3RSE B;  2UYT A;  1NGF A;  3B8A X;  3LQU A;  3LDP A;  1T44 A;  2GWK A;  4A5A A;  5F1X A;  2WUS A;  4BRG A;  2NRX A;  1HKB A;  2HBJ A;  4BG8 A;  1K4L A;  2W41 A;  2QWO A;  2E8A A;  1RDU A;  4CZE A;  4OO1 J;  4H0X B;  4WCE L;  2YJF A;  4CZM A;  1G57 A;  1VQL N;  4JKB A;  4H03 B;  3SAG A;  2RHK A;  3GG4 A;  4BQL A;  2ZJQ L;  1YIT N;  2NLX A;  1XQS C;  2FSN A;  3O4W A;  3H46 O;  3VEN A;  4BRL A;  2ASO A;  5AFU H;  3UKU B;  3AAR A;  4JAX A;  1C0F A;  3IFR A;  4FL9 A;  1YUW A;  3H6E A;  1KAX A;  3D2E A;  4JHD B;  4ILJ A;  3CF5 L;  4WYB A;  3MDQ A;  4XH1 A;  4IFE A;  4BC2 A;  4M7Y A;  3CJC A;  3RSE A;  4CZJ A;  1S72 N;  2GEL A;  1NGG A;  1O13 A;  4A61 A;  3WEE A;  4BC4 A;  1ZBS A;  3CJ9 A;  3PIP L;  4WFB L;  2D0P A;  3ENO A;  2ZJR L;  4FBK A;  4GV6 A;  3OA9 A;  2YCH A;  2QA4 N;  1K4I A;  3DLL L;  1QHA A;  1KXP A;  2NRR A;  1KK9 A;  5ELZ A;  1BUP A;  2LN3 A;  4FVU A;  4WQ5 C;  2CGL A;  1CZA N;  2VGN A;  1LOT B;  4EHT A;  2Q36 A;  1E4G T;  1TUY A;  2VGM A;  3GBT A;  4IOX A;  4FO0 A;  3U4L A;  5M1P A;  4FOE A;  4JKC A;  2J4R A;  4BVP A;  2P9P B;  5C2D A;  3ZII A;  4H5T A;  4WF9 L;  1BOT O;  3P04 A;  4BRD A;  1HPM A;  3AGR A;  3UKR B;  3D6R A;  3TTD A;  3QIC A;  5AQL A;  5JLF A;  3ULE A;  1DEJ A;  1TKS A;  1X9J A;  1HJO A;  2Q2R A;  2YI1 A;  3DXM A;  3O9U A;  3VEW A;  1HKC A;  3VGK A;  4BRI A;  3SAF A;  2HF3 A;  3E66 A;  1KC8 O;  3GL1 A;  1VQO N;  2IVN A;  2YHY A;  3H07 A;  4YDU A;  3FZH A;  3O08 A;  5BRH A;  3WQU A;  1EO1 A;  4BR0 A;  1VQ6 N;  1SAZ A;  5FPM A;  1X3N A;  3NVK A;  4IWV A;  5DM7 L;  1JCU A;  3VTH A;  1VQ9 N;  3MX5 A;  3FGU A;  4CZF A;  4E1J A;  3KWG A;  2I7P A;  2D4W A;  3E9L A;  4GVE A;  5AQR A;  5M1F A;  3DXK A;  1Q82 O;  2A42 A;  5AQZ A;  3ZX0 A;  3VEZ A;  1Q7Y O;  1D4X A;  1YJW N;  2NRZ A;  1V4T A;  1QQO A;  3IMX A;  1LCU A;  3J8A A;  4KBO A;  4FPB A;  3E9P A;  3OW2 M;  1GLB G;  3BF1 A;  3EO3 A;  4BRE A;  4P8J A;  2QWL A;  5JVG L;  3SLC A;  1HUX A;  3IDH A;  3CER A;  3MN9 A;  1Z6R A;  2P9S A;  4OPH A;  5GAH P;  4OPA A;  2P9U B;  4B1V A;  3HOS A;  4BRC A;  4B1Y B;  4JKF A;  5AQG A;  4PKI A;  3WT0 A;  5MLC Q;  3CIP A;  3R1X A;  1NWK A;  1QZ5 A;  3O1B A;  5AQV A;  1K73 O;  1NBW A;  4HTL A;  5DM6 L;  4CBU A;  2RIS A;  1IEZ A;  3D2E B;  4JHD A;  3U9D A;  1ILY A;  2HBK A;  3MCP A;  3VGM A;  1VQ7 N;  4BY9 C;  3SMS A;  2PBD A;  2FF6 A;  2MX1 A;  5AQX A;  5C15 A;  4NO7 A;  1YAG A;  4BGB A;  4YDU C;  1SNN A;  3ATU A;  1N8R O;  3SJH A;  4P77 A;  2QWN A;  2H3G X;  2I7N A;  2PAV A;  3E9O A;  3A0I X;  3BP8 A;  2VCP A;  3QBX A;  3G4S N;  3O5B A;  1Y64 A;  1K9M O;  2Q31 A;  5LJW A;  3O80 A;  3P4I A;  4FBQ A;  3R3L A;  1VAZ A;  4B9Q A;  2E88 A;  3MK6 A;  5EVZ A;  2FF3 B;  3LDL A;  3KVG A;  4JK8 A;  5JVH L;  4JNE A;  1VQP N;  2HF4 A;  3O6W A;  4C1N I;  5FPD A;  3C6H A;  1GLE G;  1VQM N;  4IOA L;  3MK5 A;  1Q81 O;  3Q7C A;  2QM1 A;  3FZL A;  2P9I B;  1T6C A;  2IIR A;  1K49 A;  4B1U B;  3O9R A;  4EFH A;  3ZET A;  1JCE A;  4JKH A;  3SAH A;  2ZJP L;  1YHQ N;  1MDU B;  3O9S A;  4MDA A;  3KHY A;  1SZ2 A;  3TTF A;  3CD6 N;  4PKH A;  3T7Z A;  5TKY A;  3R6M A;  1BDG A;  2OTJ N;  3K9K A;  5AQQ A;  3VEY A;  1K8A O;  4FBW A;  2ASP A;  2YX6 A;  3DXM B;  4HWI A;  2Q0R A;  1NMD A;  5KQ8 A;  4M7X A;  2P9K A;  3WXI A;  4CZL A;  4O8U A;  5GIN A;  4P6C A;  2E2N A;  2YHW A;  4H0Y B;  5AQH A;  3ZIE A;  1NGD A;  4IJN A;  2A41 A;  3F5T A;  4K41 A;  4MLE A;  1TUU A;  5AQK A;  1BO5 O;  4A62 A;  4A59 A;  4FSV A;  3F9M A;  3AJE A;  3MX2 A;  2E2P A;  2A6A A;  3C65 A;  2Q97 A;  3GDQ A;  3T69 A;  4BVO A;  3TTC A;  3VGL A;  5KPT A;  4U7B A;  1KQS M;  3WUH A;  2QWM A;  3Q7B A;  4CZG A;  1OVY A;  5KPR A;  3NVM A;  4WQ5 A;  4P6P A;  3I55 N;  3E1Y A;  1BA0 A;  1C0G A;  5AQJ A;  3DAW A;  3L6Q A;  1WOQ A;  2Q1N A;  5AZJ B;  5ADX A;  3FFK B;  3VER A;  1K7J A;  4AM7 A;  1NM1 A;  2ASM A;  2RE2 A;  3EL2 A;  4IEE A;  4JK9 A;  3CPW M;  1TKU A;  1ZC6 A;  4JK7 A;  2QW9 A;  4YOY A;  2P9U A;  1PVW A;  3CET A;  3M6G A;  4FWP A;  4BRQ A;  3FLC O;  1QQN A;  3T1I A;  3SBG A;  3ZIH A;  5LY3 A;  5ADX H;  2V7Z A;  1G58 A;  3CCU N;  1JJ2 M;  3QFU A;  4GY2 B;  2CGJ A;  2ITM A;  3MN6 A;  3MN7 A;  5EXW A;  4FWK A;  2E2Q A;  1DKG D;  4YOR A;  2IVO A;  4B1W B;  5BRE A;  4WFA L;  4QS7 A;  3G6E N;  3SBT A;  1ZXO A;  1K8K A;  2KHO A;  3OBW A;  3QBW A;  3ID6 A;  4BRO A;  3CCE N;  1W97 L;  2FLO A;  4FWR A;  1V4S A;  3JS6 A;  4O8K A;  3L7V A;  4BR2 A;  4PKG A;  1HX1 A;  3CME N;  1RDW X;  4I14 A;  3CCM N;  5FPN A;  2P9B A;  1BA1 A;  4NLB A;  1X3M A;  3EE8 A;  4JEP A;  4XEI A;  2GUP A;  3TU5 A;  4BG9 A;  3L4Q A;  4BC3 A;  5AFU A;  2GEM A;  2P9L A;  5CR4 A;  4MLH A;  4CBW A;  3G25 A;  1H1V A;  4FWN A;  3MWP A;  5AZI B;  3AY9 A;  4CD1 A;  4DHY A;  4A2A A;  3W3D A;  2V52 B;  4MDB A;  3HRG A;  2P9I A;  4H0T B;  1BG3 A;  3QB0 A;  4YOT A;  3HM8 A;  1YI2 N;  4LC9 B;  3CC4 N;  4AF1 A;  1Q18 A;  2D1K A;  4YKE A;  1U2V B;  2QI2 A;  4IDH A;  2GX9 A;  3QML A;  3CC2 N;  3CC7 N;  3C0B A;  1ESV A;  4IZ9 A;  2OAN A;  5BR9 A;  5E84 A;  3BF3 A;  5AZJ A;  3O1W A;  5H1S Q;  1Q86 O;  1KAY A;  3QFP A;  2ZGY A;  1JCF A;  2IVP A;  3QDK A;  3MN5 A;  4BR4 A;  3LRJ A;  5GAE P;  3ID8 A;  1NGC A;  5BPM A;  1NGH A;  5AQS A;  2BUP A;  2P9S B;  1NJI O;  5GIO A;  4R79 A;  4DB3 A;  3OHR A;  3SMP A;  2VWB A;  4IEI A;  3VEO A;  4RTF D;  3VMF B;  3WXJ A;  2VYP A;  3LDN A;  5M1O A;  1K4O A;  3KK7 A;  3M1F A;  3LS6 A;  1RFQ A;  3LDO A;  3MWT A;  4ISG A;  4H5V A;  4K25 A;  3EE9 A;  3D2F B;  3ZX2 A;  1SQK A;  3ZX3 A;  4BRF A;  3N4P A;  2WFB A;  3TSQ A;  2QEX N;  4MO5 A;  4PHT X;  2GWJ A;  3IKM A;  4IO8 A;  5EX5 A;  4EIA A;  3LM9 A;  4PL7 A;  4K42 A;  2NRT A;  3U8X A;  1IG8 A;  1OKJ A;  4B1Z A;  3HZ6 A;  4JKD A;  5E26 A;  4P6D A;  5AQU A;  1TYQ B;  5M1N A;  3ENB A;  5M1K A;  4BRM A;  4BR7 A;  4Y0W A;  2BH1 A;  2PFU A;  1HRU A;  3CI5 A;  3I33 A;  4H0P A;  5C0Y A;  2AP1 A;  4IJA A;  2Q0U A;  3IUC A;  3CJ1 A;  2BTF A;  4FWO A;  3JXU A;  3CMA N;  3HBT A;  3HTV A;  3CCS N;  5FPE A;  4CZK A;  1ATS A;  2NRH A;  4H0V B;  5AQI A;  4O5F A;  2HOE A;  3I8B A;  1NGI A;  3L4I A;  4IXC A;  4WQ4 C;  3N4Q A;  3P38 A;  1YXQ A;  4YOW A;  3UKR A;  4DCH A;  3VTI A;  3ZEU A;  4J8F A;  5CE3 A;  4JN4 A;  1RGI A;  5JIC A;  2GTD A;  3CHW A;  3F2K A;  1W2B M;  3CCL N;  3P31 A;  4BC5 A;  5EOY A;  2HBM A;  5GIP A;  1GLL O;  3BUZ B;  3CXC M;  1VQN N;  1K4P A;  2RIU A;  2QTD A;  1M1K O;  4BRK A;  2E1Y A;  2P9K B;  1S22 A;  3CCV N;  3ATV A;  2QWP A;  1Z05 A;  3H45 C;  4FOI A;  3H3O B;  4ISE A;  3WQT A;  2AA4 A;  5F0X A;  4ILG B;  3CPE A;  5AZI A;  5BN9 A;  3VEX A;  4CZI A;  5BN8 A;  4BQZ A;  1GLC G;  3RVC A;  2A40 A;  4I6M B;  3ZYY X;  1U2V A;  2FSK A;  5JLH A;  1QQM A;  4RWT A;  3W0L A;  5C10 A;  3K9J A;  3EKS A;  1VQ8 N;  4FWM A;  4NZT M;  4EHU A;  1EQY A;  3O8M A;  3WEE B;  5BPN A;  1DT9 A;  4KH5 A;  4A5B A;  2JWL A;  5LJV A;  1YF5 L;  1MWM A;  2HBL A;  5EY4 A;  3MMV A;  3SK3 A;  3WXK A;  1GLF O;  3VF2 A;  4YOX A;  4G9Z A;  1ATN A;  2FSJ A;  3VF4 A;  3WXM B;  3HSC A;  2A3Z A;  5AQY A;  1NLV A;  1XC3 A;  3GE1 A;  1YVN A;  4BRA A;  4BR5 A;  2ZGZ A;  4K43 A;  1HLU A;  3D2F A;  3VF6 A;  4JD2 B;  5CHI A;  2WBN A;  3CQY A;  3H1Q A;  4JKG A;  4QS9 A;  3H1V X;  3CCJ N;  1YJ9 N;  3I56 N;  2KKZ A;  4NZR M;  4A57 A;  2YHX A;  4PL8 A;  1IJJ A;  1GLA G;  1MA9 B;  3O9T A;  1M90 O;  4NLC A;  2A5X A;  2DPN A;  2CH6 A;  3KZB A;  4ILH A;  3TSU A;  3S41 A;  4Z94 A;  2KLA A;  3CJB A;  5AQO A;  4IOC L;  4P8E A;  1GLJ O;  3UB5 A;  1E4F T;  1U6Z A;  4CI6 A;  3H3N O;  2QXL A;  5BRF A;  2F9T A;  3FZF A;  1TYQ A;  4FWS A;  1NGJ A;  4KH4 A;  3BEX A;  4C1N K;  1J6Z A;  4EO0 A;  3A5M C;  3GOI A;  4H5N A;  4ISF A;  4XH5 A;  2NNW A;  1SS6 A;  3J7Z O;  2CH5 A;  4M63 C;  2OTL N;  2YJE A;  4EAH D;  1BWF O;  4JKA A;  2HMP A;  1QVG M;  4GV3 A;  3FR0 A;  4YOV A;  2P9P A;  3DXK B;  2F9W A;  2WC9 A;  2JWK A;  3CQX A;  4E1B A;  1HKG A;  3O9Q A;  3CJA A;  3ZEU B;  3R9P A;  4FCX A;  3TPQ A;  2D0O A;  2ZF5 O;  4JKE A;  1VQK N;  2NRW A;  3VES A;  4BGA A;  5GAG P;  5KPZ A;  3AGK A;  2EQA A;  1MWK A;  5AQW A;  3TSP A;  2FXU A;  2P9L B;  5BPL A;  4H5R A;  5KQD A;  3AAP A;  1QVF M;  1ATR A;  1GLD G;  2E1Z A;  5B8H A;  4CJ7 A;  4BRN A;  1T6D A;  3WXL A;  4I6M A;  5I9E B;  4JD2 A;  2P9N A;  4C23 A;  3UKU A;  4AM6 A;  4MO4 A;  3NMU A;  3MIO A;  3A5L C;  3UE5 A;  1VQ5 N;  3P39 A;  3D7E O;  1S3X A;  4B1X B;  5HOO A;  3A5N C;  3C7N B;  4GV9 A;  4WQ4 A;  3C7N A;  5BRD A;  4FFJ A;  2ZWH A;  3CJ7 A;  3DJC A;  4FWL A;  5AQT A;  4WFN L;  2W40 A;  4A2B A;  3MCA B;  1VQ4 N;  3LL3 A;  1JCG A;  4YOU A;  5AQP A;  5F2R A;  1BU6 O;  5TKW A;  4IO9 L;  2V7Y A;  3VOV A;  4F9O A;  1KAZ A;  4U67 L;  1WUA A;  3M3Z A;  5AQM A;  3G71 N;  4CBX A;  4BRH A;  5C12 A;  4XH4 A;  1PVY A;  1T3V A;  3FZK A;  3CCR N;  3CCQ N;  3ZIG A;  5AQN A;  4DKW A;  3PLA A;  1DGK N;  1NGA A;  3DWL A;  4JKG B;  4BR9 A;  3OBY A;  3AAQ A;  1KD1 O;  4CZH A;  3A5O C;  1K8K B;  3A8Y A;  1R59 O;  3R8E A;  1P8Z A;  3VET A;  5C2F A;  4GNI A;  4BRP A;  4NB4 A;  2CGK A;  3LDQ A;  3FE1 A;  1QZ6 A;  3HI0 A;  3ULE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...