The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
116
|
sequence length |
321
|
structure length |
319
|
Chain Sequence |
SNADDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERGFTDALIKERGIGFAPDSSHFCHDFLQKKGYDIELAYEAGLLSRNEENFSYYDRFRNRIMFPLKNAQGRIVGYSGRTYTGQEPKYLNSPETPIFQKRKLLYNLDKARKSIRKLDEIVLLEGFMDVIKSDTAGLKNVVATMGTQLSDEHITFIRKLTSNITLMFDGDFAGSEATLKTGQHLLQQGLNVFVIQLPMDPDEYIGKYGNDAFTTFVKNDKKSFAHYKVSILKDEIAHNDLSYERYLKELSHDISLMKSSILQQKAINDVAPFFNVSPEQLANEI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Binding Mechanism of Metal-NTP Substrates and Stringent-Response Alarmones to Bacterial DnaG-Type Primases.
pubmed doi rcsb |
| molecule keywords |
DNA primase
|
| molecule tags |
Transferase
|
| source organism |
Staphylococcus aureus
|
| total genus |
116
|
| structure length |
319
|
| sequence length |
321
|
| ec nomenclature |
ec
2.7.7.-: |
| pdb deposition date | 2012-03-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08275 | Toprim_N | DNA primase catalytic core, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Pheromone ER-1 | Pheromone ER-1 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 | Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 | ||
| Alpha Beta | Alpha-Beta Complex | DNA primase DNAg catalytic core, N-terminal domain | DNA primase, catalytic core, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1EQN A; 1VDD A; 4EDT A; 4O6P B; 4JCV A; 1D3Y A; 4E2K A; 4EDR A; 1DDE A; 2AU3 A; 4EDG A; 2Q2E A; 4O6O A; 1DD9 A; 1T6T 1; 3VDU A; 4EE1 A; 4EDV A; 3VDP A; 3B39 A; 3VE5 A; 4EDK A; 2ZBK A; 5GUJ A; 2V1C A; #chains in the Genus database with same CATH topology 2I5R A; 1EQN A; 1ERC A; 1VDD A; 2JMS A; 4EDT A; 2B39 A; 4JCV A; 4O6P B; 1D3Y A; 2NSV A; 4E2K A; 2NSW A; 4EDR A; 1DDE A; 2FCJ A; 2AU3 A; 2KK2 A; 2LMK A; 4EDG A; 2Q2E A; 2ERL A; 1DD9 A; 4O6O A; 1T6T 1; 3VDU A; 4EE1 A; 3CU7 A; 4EDV A; 3VDP A; 3KXR A; 3KLS A; 2KC6 A; 3B39 A; 4EDK A; 3VE5 A; 2ZBK A; 5GUJ A; 2V1C A; #chains in the Genus database with same CATH homology 1EQN A; 1ERC A; 1VDD A; 2JMS A; 4EDT A; 2B39 A; 4JCV A; 4O6P B; 1D3Y A; 2NSV A; 4E2K A; 2NSW A; 4EDR A; 1DDE A; 2AU3 A; 2KK2 A; 2LMK A; 4EDG A; 2Q2E A; 2ERL A; 1DD9 A; 4O6O A; 1T6T 1; 3VDU A; 4EE1 A; 3CU7 A; 4EDV A; 3VDP A; 3KXR A; 3KLS A; 2KC6 A; 3B39 A; 4EDK A; 3VE5 A; 2ZBK A; 5GUJ A; 2V1C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
