The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
129
|
structure length |
129
|
Chain Sequence |
MRITQGTFSFLPELTDEQITKQLEYCLNQGWAVGLEYTDDPHPRNTYWEMFGLPMFDLRDAAGILMEINNARNTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRTLRYSIESYA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The crystal structure of rubisco from Alcaligenes eutrophus reveals a novel central eight-stranded beta-barrel formed by beta-strands from four subunits.
pubmed doi rcsb |
| molecule keywords |
PROTEIN (RIBULOSE BISPHOSPHATE CARBOXYLASE LARGE CHAIN)
|
| molecule tags |
Lyase
|
| source organism |
Cupriavidus necator
|
| total genus |
23
|
| structure length |
129
|
| sequence length |
129
|
| chains with identical sequence |
J, K, L
|
| ec nomenclature |
ec
4.1.1.39: Ribulose-bisphosphate carboxylase. |
| pdb deposition date | 1998-10-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| I | PF00101 | RuBisCO_small | Ribulose bisphosphate carboxylase, small chain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase | Ribulose bisphosphate carboxylase, small subunit |
#chains in the Genus database with same CATH superfamily 1GK8 I; 3AXK S; 3ZXW B; 1RCO C; 1UZH C; 3RUB S; 4RUB S; 1BXN I; 2V6A I; 2V68 I; 1AUS S; 4F0H B; 1WDD S; 1RBL I; 1UPM C; 2V67 I; 1EJ7 S; 4HHH S; 2VDI I; 4F0M B; 1RXO C; 1RSC I; 3AXM S; 1RCX C; 1IR1 S; 1UW9 C; 2YBV B; 4MKV S; 1IWA B; 1AA1 C; 2V63 I; 1UWA C; 8RUC I; 1RLD S; 2VDH I; 2V69 I; 4F0K B; 1SVD M; 1RBO C; 1RLC S; 1UZD C; 1BWV S; 1UPP I; 1IR2 1; #chains in the Genus database with same CATH topology 1GK8 I; 4F0M B; 3AXK S; 3ZXW B; 3ZQJ A; 5DM7 0; 4QG3 A; 1RCO C; 1UZH C; 3RUB S; 4RUB S; 1BXN I; 2V6A I; 3U56 A; 3TG8 A; 2V68 I; 1AUS S; 4F0H B; 1WDD S; 1RBL I; 1UPM C; 2V67 I; 1EJ7 S; 4HHH S; 2VDI I; 4REO A; 2FHZ A; 1RXO C; 1CJS A; 4LQ4 A; 1RSC I; 5DM6 0; 3U4M A; 3AXM S; 1RCX C; 1IR1 S; 1UW9 C; 3QOY A; 3FPN A; 2YBV B; 1DWU A; 1ZHO A; 4MKV S; 1IWA B; 1AA1 C; 1AD2 A; 1I2A A; 2V63 I; 4DFC B; 2HW8 A; 1UWA C; 8RUC I; 1MZP A; 1RLD S; 2VDH I; 2V69 I; 4F0K B; 1SVD M; 4QVI A; 1RBO C; 1RLC S; 1UZD C; 4QGB A; 1U63 A; 4F9T A; 1BWV S; 2DFX I; 3UMY A; 1UPP I; 1IR2 1; #chains in the Genus database with same CATH homology 1GK8 I; 3AXK S; 3ZXW B; 1RCO C; 1UZH C; 3RUB S; 4RUB S; 1BXN I; 2V6A I; 2V68 I; 1AUS S; 4F0H B; 1WDD S; 1RBL I; 1UPM C; 2V67 I; 1EJ7 S; 4HHH S; 2VDI I; 4F0M B; 1RXO C; 1RSC I; 3AXM S; 1RCX C; 1IR1 S; 1UW9 C; 2YBV B; 4MKV S; 1IWA B; 1AA1 C; 2V63 I; 1UWA C; 8RUC I; 1RLD S; 2VDH I; 2V69 I; 4F0K B; 1SVD M; 1RBO C; 1RLC S; 1UZD C; 1BWV S; 1UPP I; 1IR2 1;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
