3QOYA

Crystal structure of ribosomal protein l1 from aquifex aeolicus
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
242
structure length
242
Chain Sequence
MARRGKKYIEASKLVDRNKRYTLEEAVDLLKKMEEVLQRRFDETVELAMRLNVDPRYADQMVRGSVVLPHGLGKPIKVVVFAEGEYAKKAEEAGADYVGGDELINKILKEEWTDFDVAIATPEMMPKVAKLGRILGPRGLMPSPKTGTVTTNVEQAIKDAKRGRVEFKVDKAGNVHMPVGKISFEKEKLIDNLYAAIDAVVRAKPPGAKGQYIKNMAVSLTMSPSVKLDINEVLKKLQEKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L1
publication title Crystal Structure of Ribosomal Protein L1 from the Bacterium Aquifex Aeolicus
rcsb
source organism Aquifex aeolicus
total genus 76
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3qoyA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qoyA02
4REOA 1CJSA 4LQ4A 4F9TA 1DWUA 3FPNA 1ZHOA 4QVIA 4DFCB 1AD2A 5DM60 3UMYA 1U63A 1MZPA 3QOYA 3U56A 3U4MA 2HW8A 4QGBA 3ZQJA 4QG3A 1I2AA 3TG8A 5DM70
chains in the Genus database with same CATH superfamily
1C8BA 2Q6LA 4J16C 4MI9A 4OLAA 2ZU6A 3A6FA 3GN1A 3EA0A 4JH0A 2DUJA 5CH3A 1AA9A 1QC5A 2DZDA 2NOAA 1MJGA 3KJQA 4BFYA 3N8GA 5C8YB 1Z7EA 5C5CA 1DUSA 2QU7A 3R7WB 4LRSB 4R6WA 3J7AC 3TQTA 4C0WA 4GYKA 1FLAA 2QSUA 2XF2A 3GX1A 5EC8A 5HRCA 2ROQA 1JZTA 5JY1A 1XIVA 2OXCA 2HDNB 3WIDA 3A4MA 1QO9A 4U0JA 4E7OA 2BWJA 4YS6A 4D0SA 2PMBA 2I4IA 5IAGA 1LUAA 2I1QA 3H2JA 4UHDA 5TVKA 2F1IA 3DAFA 1OZFA 2B0CA 3KT3A 2G1UA 2R62A 3LDGA 4AL4A 1HEYA 4YMIA 1FJXA 3UICA 3MCWA 1FFAA 2NZ8A 4XA8A 1ODFA 2J3MA 4G9BA 4EG8A 5CB4B 3LX6A 1R88A 1EK2A 2XOKD 2ONJA 2CVFA 2CLCX 1IK6A 4DVJA 2X1VA 1E9DA 3AL2A 2H1HA 1GD1O 1SBTA 2D54A 3M1IA 4HTFB 3RS4A 2MSEB 3M4JA 2X6QA 3WADA 5C80A 3IQFA 1GGMA 4YH1A 3BGWA 4H3SA 4IHAA 4B2YA 2ZIEA 3RVQA 1XO1A 3DF7A 3OIGA 3T99A 1VP3A 3K72B 5CB4A 1BU8A 4FDMA 4OBEA 4ITUA 4L9SA 3GLGB 5CT9A 2VPQA 3KEGA 1JB9A 3V7NA 5ALUA 1OQAA 4CIDA 4E09A 5ES3A 1U0JA 1PDOA 1JSXA 1OC4A 1WZEA 2JPDA 2DBVO 4HTFA 4QQNA 3FMFA 1XLWA 2CZGA 3NLLA 1PQYA 1Q1AA 1DE0A 4P3XA 3TJMA 5E9WA 2KI5A 4J2TA 2PCJA 1UJ2A 2IYTA 5BSMA 3DWIA 3M4XA 4UEKA 1EGAA 3TRDA 3GLGA 1UK6A 3HWX1 1NUHA 1JP7A 4OJKA 1W4CA 2XKAA 1IZ0A 3VUFA 3L0SA 1RWXA 3HA5A 3OHPA 1VHTA 3K3PA 3VAZA 3ZQUA 3G6WA 3GK3A 2ZIXA 2ACKA 3C7TA 3ZY3A 3V4OA 2FPMA 5I7AA 3LCCA 1GFIA 4GKKB 3R8CA 2VT6A 4MI1A 2YWGA 5KAMA 1VECA 3T1TA 3T3OA 1L1FA 5AWFC 2ETXA 4R5MA 2YHIB 5EJ5A 3IMEA 4P3KA 1K7YA 3MEQA 3UGKA 3A31A 3B48A 3MCVA 2GEUA 1D2EA 3KTOA 4J7CA 1WO8A 4HZUB 1E9VA 1NATA 4G1FA 4YCJA 1ATIA 3MG9A 1IOLA 3ICVA 3OU7A 4LYEA 4X6XA 1TZMA 4QTYA 2QTMA 2XDQB 3F73A 2GR9A 2CVOA 5E38A 4B3RB 4A3SA 2F67A 4IMJB 3WC4A 1SBQA 1BX1A 2QG6A 2YHIA 2ZEJA 3GPBA 3IAAA 2UUCB 1U1CA 1L7PA 3CO0S 4LY0A 1EFPB 4R81A 1DCKA 2AG8A 4HZUA 3O8CA 1GL9B 2N1MA 3G8AA 1K4MA 1QU3A 1QIIA 4RPLA 4H3HB 2FAXA 3JQCA 2GBLC 2I5PO 2UYQA 1QHYA 1UZMA 1QTRA 2CWDA 2FK7A 3L4SO 2XDQA 3THOA 2AEJA 6LDHA 5C8ZA 1H6CA 4PO1A 2V4MA 1I9CA 2CC2A 2QN2A 4WPGA 3L6UA 4WMLA 1EFPA 1D6SA 4FFSA 2JAHA 4OQYA 3OLXA 4P0TA 4UPVA 4II2A 1TYCA 1A5SB 4I55B 2AEFA 2AFIE 3SYNA 3RYFB 1RWBA 4S1WA 3KCQA 3SZ3A 1PWHA 4C5CA 1C2TA 2RJ3A 4C88A 2CMGA 2EKQA 3N3BC 4RQUA 5HF9A 1JZQA 1P7WA 4JYPA 2Z6QA 1T6BY 1OX4B 1O77A 1EM8B 3LX8A 5GM2A 1Z68A 4KAJA 1LQUA 1W59A 3E3AA 3PRJA 4MS1B 4S35A 5B37A 4K86A 3JQBA 3GG2A 3I9LA 2UZAA 4I55A 4TM7A 2OV1A 4EBFA 1XTBA 2FCAA 3RYFA 1BO6A 1DG9A 3IPYA 3MMPA 3LVRE 1OYYA 3VOSA 3AVYA 3IDAA 1BXGB 1HQYE 5CG2A 2PZFA 3JZFA 3CVVA 4WFIA 2EWVA 5LZ2A 2ZRDA 2FN9A 3NHZA 2PGLA 1JR2A 1OX4A 1EM8A 1RWWA 3PQ5A 5T57A 2GM9A 4JUAA 3VSDA 4CFZA 3FUTA 4MS1A 4QTTB 4XAQA 1Y1TA 3TAUA 4ZJUA 3QLEA 4RTLA 1XDUA 1ZD9A 3GJRA 5AJUA 3NJ8A 2A0FA 5EZ5A 3EVCA 5CX4A 1DV2A 1CHDA 2NXWA 1BXGA 4EUNA 5JCJD 2XUFA 1QVZA 2OQVA 4YUVA 3TDMA 2EW2A 3NIGB 2VTEA 2ZBPA 4EUFA 3AU8A 1OTHA 3GLSA 5CVJA 5GVSA 1PDWA 1TGYA 3V8VA 3W5CA 2ZBUA 4CEJA 3CF2A 1SUAA 4QWMA 3WG9A 1JVNA 2WP8J 3PNQA 2CYCA 1BXNI 1HTTA 4BO9A 4ZEMA 3K5IA 1BDHA 3W34A 1NX6A 3N7TA 3L79A 3MCAA 3ZCSA 5FO0A 2P9EA 4MW5A 4PYKA 1GPDG 3VC2A 4BKMA 4C78A 3QMMA 5F7JA 2XQVA 3STTA 3OU6A 4HYEA 2PN1A 3ADPA 3GCZA 3E84A 4HWPA 2C04A 1EP3B 3UJDA 4F3NA 1FSPA 2PMCA 4MI6A 1MVOA 3UMYA 4FP9A 3GMTA 1S7GA 4C0LA 2DULA 4FFWA 4GAEA 3Q5GA 1XMIA 4KCGA 3VPDA 4C76A 1W2WB 4F3YA 3KS9A 3U1VA 3SKYA 4JB8A 1XAJA 3ZVLA 3I1JA 3OX4A 4ID9A 3K5WA 5DIZA 1GR1A 4F84A 3MB5A 3DEJA 3OTQA 5DHQA 1ICIA 1IVSA 1U9JA 4XPZA 2WJAA 4MUIA 2JCSA 5CEJA 5HNKA 2WUWE 3EXIA 1IHYA 5ALWA 1DB3A 1KQOA 3DE1X 1DIHA 4JOBA 2EARA 3I83A 1LU9A 4M21A 4OQZA 4F2PA 5GADl 1D3AA 5K0SA 2PSJA 2OC9A 3NKLA 3B20A 1JU4A 1GU0A 5DI3B 3TIGA 3ZCRA 5J23A 2AOWA 2YZMA 5JJLA 4AMBA 1KH3A 4O59O 3W5AA 5C0OE 3RJTA 1QAOA 3EODA 2GKSA 5ESRA 5K6AA 3QXCA 2ZVPX 3VFDA 2PSEA 5M7EA 4DANA 4UD2A 4B79A 4XDZA 4B3SB 3EIOA 1JJAA 2OSBA 4E15A 4KNYA 5DI3A 3AG6A 4LQ4A 3Q41A 3DEHA 1IE3A 4FC7A 5A3VA 4ZJPA 4X64B 2BBOA 4JVOA 3JQGB 4BGDA 3I9KA 3K9NA 3LQ2A 4JWTA 2HU2A 2F9MA 2P41A 2RFLA 1SQ5A 2QTFA 3P2KA 4AJ2A 3TI9A 4CM3A 1E9SA 3D8TA 3EW9A 2PHZA 4PSAA 5D6OA 5B64A 3RKUA 2PA3A 5JZMA 4M7WA 4D2IA 2AR7A 2PS0A 4GKJB 1E1KA 5KNDH 4FEYA 4RTMA 1S8OA 2B78A 1YC2A 3JQGA 1R2QA 5HMLA 1YMQA 2VKTA 2YJZA 4D9JA 2XGJA 2Q4BA 1MOQA 5C35A 4JJFA 2FETA 4BVKA 2OKCA 4MAFA 1XOIA 5AXCA 4EHFA 2IEDA 1N8SA 1EVEA 1UAGA 2NN3C 2ZWPA 3BSYA 3HLTA 4OOFA 3WGQA 3KE9A 3IRVA 1LWOA 5M29A 2CFSA 2I2WA 2CEAA 1XCLA 2R1TB 1CQPA 4HDNA 4YRTA 5DMHA 2FWRA 3HI6A 3K9LA 3R6WA 4OYYA 5ULLA 4EZBA 1KPHA 2G1KA 3O4HA 5K3FB 4DFDA 5FPKA 4FFMA 2NU9A 4WE3A 2H85A 5ALRA 2BZGA 2JDID 3BXZA 3B3GA 5LB2A 3OE7D 5JNVA 4JU9A 4QPZA 3VAYA 5DN9A 5CVVA 1Q57A 5DHUA 3VHXB 3OEYA 1M0WA 4FBMA 3WWCA 3G9ZA 3FF4A 1NHGA 5H3HA 5K3FA 1R12A 1QFYA 4WZ6A 3FSGD 2FWBA 4OHFA 4WAUA 2MYNA 2QSJA 2WYOA 2ADFA 1Y5IA 4XWAA 2QTAA 4YB8A 3PGVA 5KYWB 1FXWA 1XZDA 1KZYC 5J4YA 3D7NA 1IUKA 3KEFA 5BNWA 5B1IA 1Z47A 5IS2A 3AFIA 2HRDA 2R96A 2EX4A 2R4UA 3VHXA 1C80A 1ETUA 3T5AA 4JK3A 4O5OA 4FYKA 2NUAB 1UXIA 2WWRA 5B6PA 5JQWA 1F8XA 3IAEA 1TCBA 3GELA 2V0CA 2IW3A 5KYWA 2WZQA 4X3CA 1NYTA 4HDOB 3CKMA 4M49A 3GROA 3MMXA 4YRRA 1PUJA 3ADKA 4CGYA 4KREA 2GK4A 2J4CA 2V98A 4MMYB 4A5SA 1Z7WA 2N9UA 2X9QA 3ETJA 5T6BA 1P9OA 3KPVA 4BO1A 3DFFA 3V3KA 4BNTA 2NUAA 4BDSA 3CRZA 1GN8A 2XWSA 2VZ9A 2VTBB 3I32A 2IZOA 3Q3EA 4WACA 5ALMA 2VJLA 5GOTA 4AS2A 4NG4A 5TT0A 1CFJA 4OGKA 4UC0A 3NWJA 4ZRMA 2WG2A 4EKNB 3KAPA 3BFPA 1PZFA 4FR2A 4TZTA 3ZVKA 3MJVA 1IJBA 1OOEA 5DTRA 4RLHA 5AVXA 1JLMA 3KQKA 5C4MA 2QMHA 3TB6A 2EKPA 4L8YA 2O06A 1X2EA 4WLOA 5FBQB 2EV9A 3H5IA 3QLTA 1SOMA 5CLIA 2R86A 4I4CA 4GWKA 4D97A 4HNTA 2VTBA 4IXTA 3I2YX 1E5LA 3L49A 2WJJA 4V0SA 4EY5A 2DP4E 2P8SA 1IPEA 1QRAA 3HBAA 3LBHA 1NG9A 3VNUA 5LZ7A 2QTCA 4EY6A 4BKRA 3GFBA 5JS6A 1QF7A 1ZIOA 3GDWA 2OHGA 5H82A 4CEIB 3O6VA 2D5BA 4RTOA 2XUDA 4Q24A 4DLTA 2RHOA 4MWSA 4CMGA 3DBIA 4PVDA 3QVJA 2LPMA 4PLGA 1KVUA 1JMKC 1U28A 4MR8B 4IJWA 1GTJ1 5KKAA 5IJWA 2EZTA 2WVGA 4K6CA 2D06A 4L75A 2XTJA 4J6FA 4TRMA 4E0BA 4QYWA 2BGTA 4ENTA 3AYZB 3AHHA 3GH1A 2NP6A 2X8WA 4K03A 3D4NA 1WCV1 4CEIA 2H2HA 4BGUA 1S3GA 4MW1A 4HFRA 4BNIA 3A4NA 4QYSA 3RTBA 4BGVA 2JH9A 1BJRE 3F2IA 3C6YA 1RZVA 3ZQJA 4MR8A 4KPGA 1EFRA 4OH7A 5FAKA 1CY7A 2KYRA 2JLQA 2Y0DA 4H7FA 2HQSA 5DMXA 4OHVA 5HRUA 1A7JA 3NP7A 4I8IA 3VR2A 5AK4A 3N8IA 3LT4A 4IVNA 1WVGA 4Q1CA 4S1TA 5KREA 1WMDA 3RLFA 3BWCA 4UM8B 3FIUA 4NNOA 3PWKA 5EHXA 4BXOA 5EZYF 3F5DA 3SE7A 3Q85A 4I46A 4LXUA 4R8VA 4P7JA 2PX6A 1D2GA 5ALFA 1RYNA 2FG5A 3TTVA 2BKLA 1V6AA 2FZEA 5D86A 1ULTA 1USVA 3WIUA 2W42A 1VYTA 3JASB 1HA3A 2GTIA 2QTTA 5IYZF 1JA9A 3AH8A 5MN6A 1C3EA 1XK6A 2HCTA 1WU8A 4R1NA 4LCEA 1OV4A 3FVWA 4JJAA 4W9NA 3C48A 2BN4A 1DELA 1Y7IA 1O0BA 4ABYA 3NYWA 4KBFA 2Y1XA 2FMKA 2DLDA 4YI3A 3JASA 5JMWA 1EHYA 2OLEA 4PLZA 4OAOA 3EIHA 5A05A 5KC8A 5JATA 5EINA 4FGLA 2OG2A 3AQ4A 3BTVA 4HH4A 4P4LA 4LMPA 3S2UA 3HN7A 3ISVA 2E5LB 2IOFK 2JARA 3EC7A 3O73A 2JS7A 2QVLA 4NICA 1UWKA 3ABRB 3H8SA 1KJ9A 3EWSA 3H83A 3VH2A 5FXMA 3BPSA 4KPFC 1JPUA 1X42A 4H17A 3VR3A 4MA4A 5MFPA 1O0CA 1QGZA 3HM2A 4WNYA 3ZDFA 5AI9A 2H31A 4PBTA 1NBHA 5JRDS 1G38A 3FTFA 4Q9DA 1E4OA 4YLGA 4AROA 1E7YA 1T9GR 4KQ9A 5L9AA 2VF8A 2XTAA 4Q0MA 3STHA 2IODA 2D1QA 4MINA 3U61B 1H2WA 1JG4A 1K7XB 2VDII 4P81A 3U7GA 4QGHA 3CW8X 3UMMA 2QORA 3AM5A 1LW6E 2QI9C 2G4CA 2ZS9A 3IIEA 4XUEA 3VKWA 1AA6A 1CUCA 5DYIA 2WAMA 2RI6A 3MAGA 2WUGA 4DQKA 5TNXA 2HGSA 3OIFA 2Q99A 2QJWA 2O5VA 3K6SA 3OJ0A 4FS8A 1GSAA 1UKAA 4WBSA 3UPTA 1AHNA 2R9VA 2VHVA 3JZIA 3KR9A 4EHLA 2H52A 4HVTA 2PXCA 2XVAA 4YMLA 4Q1EA 5T64A 4B48A 3DOOA 1RM4A 2P4HX 3P5BA 4NU0A 5AHWA 2PNJA 4AMYA 1GTVA 3GDOA 4UOEA 5H8WA 1U0RA 1P4SA 3NFYA 4NPAA 5ADUS 5C53B 1U1DA 3QTTA 3AV0B 1NU6A 3C2QA 3OPMA 1T0HB 1UZLA 2HEGA 5L3QB 2BJWA 2NPIA 2QJRA 5FLEX 4CKXA 4AT1A 4URVR 3ZS8A 5CDFE 1X77A 1N6RA 2AHOA 4J0QA 2NTJA 1D0IA 4GRDA 3HP4A 5AM5A 4MKFA 1ABBA 3Q9UA 1GG5A 3H19A 3OTIA 1TA0A 3EPJA 3C74A 2IZZA 4DIEA 1U3UA 1WG8A 1T91A 2YV3A 1EDEA 4P58A 4ACAA 2CJYA 5FB3A 4C6HA 5BSFA 4TTTS 3HVJA 2IWRA 3WNBA 4MB2A 4URFA 3U7RA 1TKBA 2VYND 2CK3D 3JW8A 5L3QA 1N6HA 1JKFA 3CN9A 2L69A 5JH7F 3VU3A 5JV5A 2WIAA 4W6ZA 1XN4A 1E5TA 4ROSA 4EPXA 2V0GA 5CVCA 3DVLA 4ZARA 3RS2A 5EXEA 2P6NA 2XMGA 4BNFA 4RF3A 3RYHB 4L22A 5HZGA 3VDQA 5JJ5A 3IGFA 1EZ4A 3D3EA 4M1EA 3WNCA 4WNCA 2BMDA 2YN2A 3QHQA 3GGSA 4ZI7F 3SEAA 1KHTA 2V67I 4F4FA 1S3SA 3LX5A 3R6GA 2ZP1A 4HQ6A 3ODGA 3OI7A 1Y6QA 3MWKA 1SPBS 3NEPX 1Z8NA 1HL3A 2Y1GA 1U6KA 4NVRA 5GJWC 3GRVA 3RYHA 4E5DA 4JEUA 2AVNA 2B3DA 3B9BA 5K2MA 3R7NA 1TF7A 4W9MC 4OHYA 2BGKA 1EA5A 5BQXA 2XGOA 4M8NE 2AKAB 1IZ8A 4M99A 5HZMA 2XNKA 1ZY2A 3CNBA 3WDLA 1LZLA 2D1SA 3JV7A 1Z5OA 4DREA 3L6EA 1VTKA 1GM5A 3NO4A 4EJ0A 1CZKA 2ANCA 2X8BA 1BMFD 5TRTA 2C8KA 1P33A 2ZRQA 4M1QA 2Q2VA 5A2QA 2Z1DA 2ZCVA 1MV5A 3C45A 2GKGA 2E7ZA 2BP7B 3FZEA 2G77B 1D9XA 3RYIB 1PR0A 1YCFA 2BI7A 2UXDB 1VRWA 1RWPA 3GD5A 1MJ5A 2RHBA 1JLKA 1LXCA 3CLTC 4P08A 3WMWA 2COEA 3F6RA 2GCOA 2DR3A 3ELDA 4CLOB 1BHJA 1YOVB 3NIDB 1A5BB 3OMWA 5EEGA 3P71T 4I9NA 1QJ4A 3KJNA 4QHTA 4R2KA 3WQBA 5JWRA 1VHDA 2Q9UA 1CFZA 4OGFA 4RE5A 2A9KA 3LC7O 4RK6A 5D3KA 3ZV5A 2OVBA 4IH4A 5G41A 1NBIA 3IXMA 5K01A 1M1XB 3DFKA 3COJA 4G5OA 4DWWA 3E48A 2HFJA 2QPOA 1UK8A 2HB6A 1N6KA 2NO1A 4YLYA 4WBXC 5FOXA 1G6KA 2XUKA 4H3VA 3ULKA 1CVLA 4CG2A 1N5RA 1DKPA 3UUWA 4QVIA 3PXBA 4CLOA 2XMZA 3TR6A 1B41A 3TJZA 4B3CA 1VLMA 3DHNA 4CDNA 5EUQB 2JRCA 1Z2PX 1OXVA 3DMYA 3ZIUA 5BV1A 3CUSA 3E1SA 2GZ1A 2EEPA 2ZRAA 4U7DA 1Z5ZA 2ZRNA 4UDNA 2R3SA 1LTQA 5ESXA 1G41A 1PGNA 4DLVA 2B1RA 4IRUB 4QO7A 2DSTA 3DBLB 4OU5A 1M67A 4WADA 3S1SA 2SKCA 1XTJA 1JWLA 2R4QA 1HE8B 4AYWA 3CX6A 2XYRA 1MCZA 1A4XA 5EQJB 1WD5A 1FJGB 4JQSA 3HC7A 3PWTA 5ARCA 3RJZA 2O2IA 3GUVA 1NM5C 3OCZA 4KJXA 4FDVA 4EGSA 3ANMA 3LYHA 4X1KB 3M1LA 2GN6A 2R6JA 1X7XB 4E08A 1Z2EA 3SYKA 3DBLA 4MLZA 1B8UA 2IHYA 2C5BA 2HJSA 2P9CA 2VJCA 3F6SA 3FVQA 1M34B 1G9XA 1DT5A 2HLDD 4YP0A 5L45A 1C50A 2CYBA 3QTBA 4L4UA 4MIKA 1TIPA 4V0MA 2ENWA 4GHWA 5KBYA 1ORWA 2HX1A 1V95A 2ZIZA 1OREA 1TADA 2A30A 2B1GA 3ISTA 3UKDA 2P6MA 2QR3A 3W9BA 3GNLA 1J6UA 4QA9A 4X1KA 5EE3A 4BLQA 1ADFA 1L4YA 1SIOA 1BQ4A 1GRNA 2XQFA 1I2CA 3F47A 2OHOA 5L6MB 2PWAA 2AW5A 2KBFA 1T4DA 3PR1A 1GARA 1M34A 4XEUA 2QW0X 4RPCA 1R9GA 3AR4A 4BWGA 5BMVF 1DJLA 3JYHA 1KZ7B 2VDLB 3KDSE 4HHEA 3CIOA 5EPUA 1PJSA 4KLZA 3JQ7B 3PT9A 3TKYA 1M7HA 4NHOA 3JD3A 2X1HA 2JD0A 3OUUA 4LXQA 2OO5A 4UNPA 5DASA 3S1AB 1MFZA 2NZ2A 3D3KA 3Q6NA 2PTHA 4MVJI 3T5GA 4WQMA 4I1VA 4W5HA 5TV2A 1A1SA 2XA2A 4KNWA 4FJ2A 1TQ4A 1G42A 3C0KA 3DOHA 3H16A 4G07A 3AF5A 3WQQA 1GQOA 3IUSA 4PXAA 1ZSNA 3DC7A 3BSWA 3P9KA 1O54A 3JQ7A 4S3MA 4D74A 2ZRJA 1X94A 2GNPA 2CCJA 1KIAA 2VHJA 2B1QA 1KEPA 4H1UA 2VNSA 1CCWA 4K88A 3GWGA 4WKBA 3WP1B 4BFSA 1XVVA 1I6MA 2HUPA 3JU3A 4YQZA 1Z63A 1AV6A 1ZQ1A 1DJQA 1EP2B 2VUIB 1DKUA 2XVXA 5JMTA 2Z2YA 3MUNA 2Z09A 4XWGA 3W8DA 4CBVA 1DJNA 1A9YA 4B4WA 4NEQA 4RY8A 2CUNA 1CEQA 3QVKA 3OIUA 2ECQA 3ILXA 4YAEA 4ZAFA 3LWDA 4F56A 2C8JA 4PRZA 4TN1A 1UBGA 1NTRA 2WTNA 4HBGA 5CM9C 2Z5GA 1ZITA 4JKYA 1VIVA 3P0IA 1V37A 2IH2A 3QVMA 4QVGA 1DX4A 1EK6A 1S2IA 1CUYA 2V3WA 3LNTA 3X3HA 4QYIB 1DDGA 4ZKDA 1R0WA 4ZV7A 5IU6A 4JC0A 1HEUA 5EZQA 4CKYA 1OKKA 3CUTA 1T5OA 2IQ5A 5JI2E 2PU5A 3H5LA 1OE0A 3O2NA 5TGDA 4EYSA 1YRBA 3IULA 4P3YA 4R69A 1YNOA 3UBMA 5GZ1A 3U7HB 2ASVA 3I8SA 4DDWA 3RVRA 2EHDA 4YUAA 2IPXA 1XZHA 3MWFA 4IJUA 2DY0A 4W9RA 2BM1A 3KPWA 4NULA 2NYAA 4D8VA 1TA9A 1AQIA 4QYIA 3ILSA 1Z6QA 3RPEA 4LF9B 1U98A 2P1DA 1NVUQ 1M7GA 1YMVA 1OZAA 2ZPTX 3DZJA 3ZYZA 1E20A 4N12A 2DHQA 4BNKA 2DHDA 2P9HA 4C7BA 2O8BA 2PUJA 4NBUA 4RQAA 4AJEA 3OQPA 3KSDO 2NM0A 3AR6A 4YT8A 1SUSA 5EJGA 3COPA 3BFKA 4MVJA 4TSKA 3DBRB 4PV7A 3THWB 1E79D 1FF9A 3F8TA 2O0HA 3H86A 1JPVA 4BQIA 1NWCA 3A6ZA 3AF2A 4HVAA 1NUSA 2PYDA 4DMUB 1N25A 4HLUC 4A8HA 3G8DA 3W2GA 3M5PA 3SD7A 4BLUA 3DFUA 3HLYA 4E4RA 3UATA 3BTOA 3M6LA 3THWA 1UJBA 1YTUA 1FDOA 2YW2A 1UXGA 3AKCA 1GPYA 4PNHA 3M6WA 4YAIA 3B8HA 1I33A 2J3DA 2Z4RA 1Q1GA 3NNSA 2CDNA 4PYJA 4CXMA 1SIUA 2WIJA 5BWLA 5THQA 2BUAA 1OH5A 4K05A 4MHSA 4I9HA 2VBCA 4EHIA 3VZCA 2IXGA 1E77A 3LAWA 4YAOA 2REBA 1ZUWA 3M1YA 3SC6A 4UTVA 1PBNA 2DPGA 3A6KA 3N53A 3H2KA 1JZSA 3OM8A 1ES9A 2FV8A 4HAIA 2FFAA 4DV6B 2Z1NA 4MPPA 4QNNA 1AT1A 2W2PA 4CKBB 2FWMX 1GTL1 3UOWA 4AZSA 2P5UA 1QZXA 2W2OA 2ZT7A 3IHKA 1ZGHA 2HREA 4WN9B 5ALEA 5GVRA 1AK9A 3RK0A 3T54A 1PLLA 3Q9SA 2GUGA 1BCRB 4KWTA 3NWOA 3TQQA 4LZOA 2YWBA 5E95A 2I54A 3WNDA 3VZDA 1LY1A 1C4OA 2IHUA 1VRCA 1MA3A 2G70A 3HV2A 5HFAA 4DMLA 3Q8MA 3TTTA 4I1PA 3WMFA 4DA8A 4EGQA 3RJ5A 2BEWB 4GYYA 4HEA6 2HMYB 2D5CA 2P2LA 1RAGA 2PGXA 4ARVA 1U3CA 4ZK2A 4URHA 2XMBA 4WN9A 2REOA 1BCRA 2ZYWX 3DV9A 4KLCA 4TWZA 1QG6A 4YTEA 4KG7A 2Z30A 1IN7A 1Q7BA 3O03A 3IEUA 2K4MA 4DCJA 1U3FA 5HRAA 1NG1A 5C46F 4UOQA 5K20A 1ZK3A 1WE2A 4UEWA 2JIZA 4EKGA 2ZUSA 2ECPA 4TS9A 5FORA 2BEWA 3ANLA 3B6KA 2HWYA 4ND2A 1AGPA 1U7DA 2CJWB 1HGXA 3O0DA 4C7XA 4BRSA 5AW3A 3B1XA 3BSSA 5EJFA 1T5IA 3P2IA 1K6JA 1BW9B 2NO4A 4E32A 3OHSX 1BMDA 3OLQA 2GN9A 3TD6A 3VV3A 1A9ZA 1F2DA 1U80A 1ZH4A 3ICCA 4EG4A 3S4YA 5INTA 2CFIA 4D43A 5F1PA 3VNVA 2NW6A 3I8OA 4EG1A 3IQIX 4Y9SA 4XASA 4AZVA 4BFCA 1IQPA 1IATA 3C7DB 3LOPA 1XA4A 1VMKA 3EIUA 1XTKA 2J85A 4PLCA 3AI1A 3MGGA 1BIFA 1Z33A 2CJWA 2W6JA 1HURA 3I2GA 3FB4A 3QFRA 4RVUA 3RF6A 4C3UA 5LM3A 3W5DA 4IM7A 2IDZA 3R6LA 5IVIA 5DEIA 4ER6A 3G68A 3KUDA 1UJ5A 2CFCA 3ZE7A 1JDJA 2HU5A 4BS9A 2X40A 2ZAOA 4D42A 3G9XA 3MYRA 5ALQA 5CB0A 1BJTA 3T7RA 2VPZA 2OSVA 1QYCA 3NAZA 5EZYB 4GF5A 3DT9A 2QLLA 1J1IA 1ZI6A 3NRBA 4PC7A 4YEDA 2D7CA 3TX2A 3VOBA 3FWYA 2QRNA 3L5KA 4Z6KA 3SEFA 2IPAB 3TRIA 5AVRA 2HV8A 2VQEB 2UV8A 3W7AA 2C3UA 1IY9A 1URPA 3U3JA 1QSGA 2AYYA 5KSYA 3G2HA 4K26A 3GAZA 2I1VB 5IYZB 4LV6A 1RAEA 1L7MA 4HQRA 4MRNA 1SCUB 1GZDA 3SJ7A 2NWQA 1OGYA 2PEYA 1CR4A 3KEMA 1FSSA 3QIVA 4FXPA 4UNNA 5EZYA 2PUCA 1H6BA 1Z4KA 4AY4A 4JU8A 1SOVA 4S0ZA 3PA8A 4CMKA 4Z4CA 2PQ0A 5JHHB 4FKZA 3U3XA 3TZLA 1TCVA 3FGPA 1PAUA 2AWNA 3FFTA 1UEXC 2XE4A 3I58A 2C2OA 4H7PA 4TVSA 5EKUA 4TYQA 1JQDA 4D4IA 3AKEA 3CUWA 5IYZA 4KC0A 3E61A 4YP9A 3AI2A 1F20A 4YV2A 1RM5A 1AKYA 4RD4A 4RD3A 3B5IA 1C41A 5EMMA 5CXUA 3EGVA 3JQPA 3QU5A 3JSXA 4AJ9A 5KWVA 3VGJA 1JAZA 3BWXA 5CFQA 4KDFA 2HHLA 3RRFA 1O94C 5B1DA 2P8JA 3FSEA 5IXJA 2YZ2A 2O8DB 4QULA 3ANXA 1IBSA 3C24A 3ZE9A 3R40A 2PUFA 4NFHA 3IAXA 4TQGA 5KJCA 2JJ8A 3UJBA 5J3JA 1OH7A 3I92A 4JFAA 1XCMA 2WYUA 3KPYA 4ZHSA 1SU7A 3TLBA 1DC4A 3QQ5A 1R0RE 2DKFA 1ORDA 3M4NA 4DMRA 1XZPA 4DCUA 3UHJA 4CPDA 1T6YA 4ARZB 2GXQA 4IOKA 5E0OA 2GJSA 1YKFA 1E7MA 2O8DA 5BSHA 1LK0A 4ZO7A 4PNPA 3WDSA 1T35A 4MGHA 1PJ3A 3FMIA 3GVXA 1NLFA 4J0EA 1LD3A 1PG2A 4H18A 4OSEA 1R9NA 2QLBA 3ZK9A 3QBEA 2X3UA 1Q17A 3M83A 2HMWA 1NW7A 3SXJA 1CB7A 2QVCA 4IG9A 3RTAA 1J8YF 3HU1A 3KLMX 3CW9A 1A5TA 2RAUA 4L6IA 1GHTA 1ZK2A 3U17A 3VR5D 3WX0A 4BX3A 1U5BB 1T8UA 2QZ9A 3NVKI 4WJZA 1GRQA 5B7NA 1YFZA 3LVBA 4DHEA 621PA 4X62B 1BQEA 2JHAA 2WKPA 3GO4A 1FRQA 3OEED 3ZWCA 3WBBA 4M88A 3OQHA 3HHEA 2FHSA 1Y1KE 5HGJA 5AOBA 4OJTA 1UM9B 1D2RA 1PT7A 2JFQA 2ZJAA 3LYUA 4ARUA 1GZUA 4N7RA 5CYPA 3QLUC 3VI3B 4EPRA 2YNMA 4W5NA 3M6VA 1Y9ZA 2VSYA 2PS9A 3PUKA 4YDRA 5H5JA 1U5BA 5SV2A 4BP8A 4DM7A 1SUWA 5K3OA 1W4LA 4LHYA 4WZBB 3NETA 4X20B 2J45A 1J90A 4PQFA 5CTAA 2GN2A 3MCUA 4MEBA 5TPZD 3R5TA 3M6UA 4GSLA 2L18A 4BB5A 4AZTA 1J33A 4Y2VA 4PLVA 1AA1C 1E1YA 3FVVA 5EJ8A 1MOSA 5JH7B 3GFPA 1UFVA 4PQRA 4PSUA 3L4KA 4I9UA 5K8UA 4BQQA 2PMKA 1GKLA 1W0CA 1P7YA 2IA5A 2ZSJA 4WZBA 3SBXA 5AW6A 1V71A 2DTXA 2V4ZA 4M1ZA 4GECA 1CJCA 4UMVA 1C8KA 1MW9X 2ZIVB 2JFYA 2QT0A 3EBOA 3LI2A 2PS1A 2VHQA 4G9GA 5IVDA 4D9IA 1NYQA 3F5MA 3DW1X 5DBHX 5BORA 4LMRA 3WAGA 1VG8A 3KKNA 4HQLA 1ZM9A 1CY2A 2NQ8A 3G2OA 1GAWA 2BZSA 1GUFA 3P9CA 4IR7A 1G4UR 3LO5A 1WUJS 3NG1A 1MTZA 5D3MB 4ZI7B 4IDAA 2WVJA 2EHJA 3KT0A 4Y9TA 2GZ2A 4TTVA 4C3OB 5KYUB 2C7OA 3NJRA 1HR0B 2FR8A 5J43A 4WFQA 1YR8A 4OP1A 5L51A 1N6NA 4KE6A 5B30A 1L5HB 3AL3A 2E5FA 1RI5A 1RHKA 1NE2A 3K94A 5HE9A 4DV0B 5D3MA 2C2MA 5A9TA 4D9FA 1KVQA 4ZI7A 4C7JA 4RTPA 4DG8A 4F0HB 2NV2B 5AHRA 2EX1A 2WUVA 1Y5LA 1SHZA 5KYUA 3AXMS 4CYMA 4KQMA 1H8ED 4XUCA 1DIAA 1NZJA 2HJHA 3EMKA 1L5HA 1EFVA 1JG2A 4MTCA 5FPQA 2I8LA 3HDHA 4WLEA 1M8GA 1ISMA 4JI7B 3QPCA 4MVJP 3GNQA 1NVTA 1T2VA 4OSOA 2FPUA 2QJTA 5KNCH 1SK9A 1BYUA 3OOJA 5FA8A 4Y9RA 2K87A 3FKJA 5CVDA 4QM6A 4ERXA 1KQNA 4QRIA 4ZJYA 4DY4A 4IXDA 3EF3A 4PTYA 2JKVA 2VWHA 4ZCMA 2PBRA 2ODTX 4OP2A 4X7BA 3E2MA 3RUPA 2I3DA 2JLBA 1SZPA 4M9UA 4UARA 4CV1A 2YBEA 2WKRA 2Q3MA 1L9XA 3BRQA 1XKXA 3OU2A 2OHHA 4KQ1A 2FW8A 1NVAA 3NDBB 4OSPA 1RKUA 1R74A 4YR9A 1G55A 2W4IA 3D7RA 1FDUA 2O3QA 1P6QA 1E9AA 1YL6A 3A7DA 2UUAB 5EIBC 5K5EA 4R2WA 1XD2A 1FUEA 3DXZA 1CVIA 4C08A 4D8XA 1Z13A 5FV7A 4KH0A 4DT1A 3UCXA 4DRZA 5BWCA 5CLJA 1SBNE 2ZWAA 3A2MA 2DC1A 2DM6A 2VDUE 4XCVA 1ZOSA 1OY1A 2B1JA 3GEPA 2Q28A 2IGBA 1A2BA 1P9NA 1KP3A 3DPSA 4V1CI 1KGSA 3B1WA 1SVWA 5K3SA 2OCLA 4ZU3A 3RIEA 1V8DA 3GFVA 4Z9YA 1WDTA 1RCOC 2APJA 1V5GA 3V8BA 2AE2A 2X0IA 3X44A 2H07A 3OIDA 1ACLA 4FBGA 1XCOA 2IYPA 4CMEC 1ZAYA 1EBBA 3GHHA 1V5EA 4BCBA 2QXTA 5HYVA 4J0FA 3V1UA 1ZBDA 1MPXA 3KELA 4KXFB 2QRLA 1L7XA 1FPQA 2WIGA 4KQIA 3TS1A 4KVAA 1OHHA 4ESVA 4FN5A 1WB5A 2FMIA 5DHRA 5AUQA 5EQDA 4JQYA 3OTGA 4QQRA 3ZU3A 4LFBB 1QMGA 4ZEOA 4RO0A 1ECCA 1B6TA 3RR2A 3ZZMA 5KYGA 1Y7TA 2B7CA 2H08A 2Y05A 3TZEA 4MUAA 5BMVB 3R9XB 2Q1YA 1PHPA 2FP4B 3O1JC 5F9HA 2QRPA 3OQNA 5EUMA 4RZQA 1SA0B 2P3LA 3WY9A 2O23A 1SC1A 2FPOA 3OY7A 1QMPA 3SWWA 3LT5A 3EEQA 2JIDA 2JKZA 3C3AA 3H1BA 5IDXA 1ZONA 3B2NA 2X42A 3OMLA 4PANA 1D09A 1T2AA 2M6RA 3TZCA 1RQGA 2WSLA 1TJPB 1YJQA 2H9IA 4IDCA 3G2IA 5IJZA 1QO0D 1YQTA 4DIOA 5BMVA 3HUUA 2QIOA 3R9XA 3NBYC 1E3QA 2AFRA 2AFIB 2FP4A 3ZXIA 3E58A 1UEIA 1SA0A 2XWPA 3L6CA 1I6WA 3T5BA 4WJKB 4DTCA 1CC1S 5A5VA 2D5AA 5FOSA 3IHLA 1Z29A 1LBEA 2RJOA 4LVCA 4B74A 4EI7A 4AUNA 2PNFA 1T5BA 1J0XO 4G1MB 4BJ1A 5DM1A 4N3AA 1W36C 5FBHA 5K0LA 2QMEA 1LW7A 4P8RA 4BLSA 3OEHA 2QF7A 2AFIA 1SVMA 1XU7A 4FGWA 3TMYA 3EGDB 2W6QA 3ZGNA 1C3OB 1FUIA 4IDHA 1Q92A 3PUZA 4QO8A 5ALOA 1XUOA 3TKAA 3ZWOA 4YV1A 2ZI4A 1ZOLA 1RM0A 2Y4NA 4IGKA 5D85A 2R87A 3I1FA 5AJWA 4IIBA 3U26A 2EL7A 1E66A 3MBIA 5BSUA 5BSWA 3FZQA 3DVQX 4M0FA 2R8ZA 2PXXA 3GBVA 1C3OA 3IQXA 1AKEA 3Q8XB 4FSHA 5I9IA 4B76A 4OY3A 4DA6A 3ADOA 1SC9A 1X70A 2QENA 4KIWA 3ZE0B 1C2YA 2VWGA 4FTWA 3VXKA 3VO1A 2IXDA 2IEZA 4IH1A 3P8ZA 1H2BA 4Q3CA 4W5WA 5ENVA 3WGLA 5ICMA 1OBFO 4RZ3A 1ZBQA 1G5PA 2VP0A 2YOFA 3FOCA 4R4JA 5DLQC 5FHQA 4C7OB 4AYXA 3FFBA 4KV7A 1BFUA 1W5FA 1NXSA 2VNIA 2AXEA 1PYOA 2R6R1 4NV3A 4DJAA 4D46A 2OMEA 2VP3A 3QKRB 3OM0A 4BU1A 1CY1A 2RAPA 2HV9A 4Y2RA 1R50A 4DYHA 1BRTA 3GAMA 1A9RA 1YOBA 4O25A 2WJHA 2WSSD 3AR9A 3GMSA 2HHAA 3L0IB 2GN1A 2WPNA 4HS4A 4OAPA 4R31A 1UBLS 5C18A 3F67A 1Y6FA 3CU5A 4C7OA 4UM5A 4IVPA 3LCVB 3LBAA 4PCVA 1RWKA 2OOSA 2RCNA 1Y6ZA 3GBSA 3H5WA 3M5WA 3NDPA 3MS7A 4O33A 5AVOA 1IMJA 5LPNA 3QKRA 1ML3A 5AESA 3O8BA 4Y2TA 1L8OA 3WWOA 2NSLA 4MLCA 2EZ8A 4C01A 5JXHA 3ROMA 3NVMB 3ILVA 4ALKA 1M72A 5EIFA 1KJYA 5DM4A 1J70A 1IL0A 2EDAA 5A0FA 2POCA 3Q0TA 1S01A 2H4HA 1VLVA 2H4WA 1NVBA 3LDUA 1S2GA 3CURA 4JEMA 2V9PA 1EGMB 1ECJA 2C5AA 2C7BA 3M3PA 4XCQA 1VKRA 2HNAA 1S3FA 3H84A 2PL1A 4HZGA 4CM5A 4HG2A 4XYLA 5J58A 3KTDA 5DKFA 3RU9A 1GL3A 1SB8A 4ZV9A 2XBUA 4F85A 3BD6A 3NONA 1G1MA 4IHJF 3CKKA 4PW0A 1NBMD 5J40A 2JD2A 4HSEA 4W5TA 3NX4A 2R6ZA 4MKVS 1DFIA 1HLDA 3AJDA 4HWSA 2CNDA 2VBGA 4ZDIA 1YRLA 1IAVA 1Q7CA 1HRDA 1EI9A 2HL6A 3IB6A 4QU0A 4D41A 4ZTZB 2PUEA 2YVLA 2SKDA 5DDIP 1I24A 4NS1A 5DM2A 5BSTA 3WGNA 3CZRA 1KEEB 3IHWA 1TU3A 4LRTB 5ELXA 2QXUA 3NKFA 3ZK8A 5EJ6A 1ONPA 3E27A 3Q6MA 3RNLA 3KLNA 5K0CA 3ZVNA 4F11A 1MO6A 3IR6A 2OZVA 4NV0A 2C4UA 4GXRA 4W1QA 1LDEA 3TDKA 1H69A 2NO6A 1DIGA 3BCRA 1CTQA 4WZAE 3ME5A 4FMPA 4II7A 3G9TA 4NYMR 3AVWA 2GJ9A 4HRXA 1QFZA 5KMGB 1MG5A 1XHLA 1XZKA 3KBBA 2ZTLA 3WGUA 2GHRA 1KEEA 1GIAA 1QLHA 2AN1A 2N1BA 5IKEA 1DTWB 1KFEB 1ZOOA 2W7TA 3HNRA 3PIDA 2OLKA 4DQ0A 4XKJA 3EX7C 3FNQA 4OKIA 1EAYA 4JX9A 1KAEA 1RVDA 2XOEA 4WXYB 3SICE 3A37A 3USCS 4IFBA 4DAEA 3KZKA 1M0TA 3V8PA 4TV9F 3CV3A 1Z2NX 4H1HA 2VYVA 3NR2A 4Z0NA 1ZCAA 1Y4DE 5KMGA 4PF1A 1OWMA 2VDRB 3ZQ6A 5K8CA 1NVVQ 5KWJA 2X22A 3LIIA 1KWGA 1OIVA 1KYTA 2DOKA 1DTWA 1THTA 4IUBS 4JCCA 4QG7A 1NKVA 4R9VA 3L43A 4L27A 2QNBA 3E18A 1HL7A 4XVHA 2W70A 5A4DA 1FQKA 4P9NA 5FUQA 1VCIA 2VOJA 2GA8A 4ZCQA 1BOOA 4L02A 4DLNA 5JAPA 3TQCA 3NHWA 4CUZA 2G9ZA 4WV3A 1NOJA 2L82A 2UVQA 1GRVA 2ZUWA 3BWDD 1HT2E 1NDQA 3CZAA 3NUGA 1PG5A 2HBZA 4OCZA 1I5EA 5LUBA 1O5IA 4I50B 2V96A 4DQLA 2XRZA 1WHSB 1JGTA 3DVAB 3UMBA 5BV2P 4UAJA 5HKAA 1JQ3A 1DX9A 1PVDA 3LXUX 1N36B 4OKSA 1OI4A 3C43A 3IE2A 3G2KA 4QFCA 2IHBA 4FOOA 2O1WA 3WKBA 1RQ7A 1OX5A 3N7UA 3DUFB 3PHCA 2OBBA 2FNAA 3HJNA 2FN8A 2NT4A 1TQ2A 3ZZTA 1QH9A 1HDRA 1WMEA 1FFHA 4I50A 3UC5A 2V7WA 4JJ6A 5FWXB 1GTRA 5FOVA 4LS3A 3U1BA 1E1QA 1VYHA 1WHSA 3DVAA 3BKXA 1PTJC 3JY6A 3KU1A 3OSUA 4G23A 2PPVA 3PXEA 4JYCA 4UAUA 4UUBA 2Z5FA 5HCIA 4F45A 1NZFA 2P3QA 4S2UA 5M2QA 1E5DA 3KQSA 2HYDA 5JXWA 4KN9S 4RK4A 4HN9A 4EJSC 4GDFA 2O07A 3DUFA 3B78A 2QS9A 1EX6A 1VLHA 2OWDA 3F1KA 3H9QA 3HZRA 4KV9A 1KAQA 2WVAA 3TOCA 1H2HA 2BI4A 5FWXA 2JFWA 4C3ZA 2YJGA 1O6GA 2QN1A 4HDMB 3P9YA 1R0ZA 1QIEA 2FZGA 3AEYA 3INNA 1KJZA 5U4QA 4KK3A 1A2QA 3C8UA 5EP3A 4US0R 5JSQA 1BGVA 1T10A 4TQAA 4WUTA 5KSOA 2BEKA 3AHCA 4RK7A 1PJCA 3PFIA 4B75A 3KQLA 3GLRA 5A04A 1F4PA 4IIXA 4LDRA 4I4IA 4C43A 1CNFA 2Q2WA 4HDMA 3CKYA 3TTWA 5AVYA 4IIEA 3BMCB 1ZA2A 1ZMRA 3CQ9A 4ZMBA 5KHAA 3LLVA 1FFWA 3FTNA 3ZHRA 1A88A 5CFRA 4RDIA 2WYVA 2JFVA 3E6AA 4GXTA 1EWRA 3WBJA 3O8RA 2PUWA 3EMVA 2EFJA 1ID8A 3MC1A 3ZU2A 1FZTA 1NJ5A 2NTNA 4GYWA 3SC2B 3UT6A 3H04A 4LWPA 3IA2A 1RAHA 3BSFA 3IV6A 3BMCA 1DCFA 3U3DA 1Z26A 2GD0A 1N6PA 2IE8A 4HAYA 5FPPA 2XOKA 1N34B 3ETCA 4PN7A 1JQ5A 3HR4A 5I7UA 3OZCA 3RC8A 1KNQA 4GC5A 1TRHA 4Z4HA 1BAPA 1I6LA 2ZQ5A 5DGCA 2PWPA 5AOVA 5KYXB 2YV5A 2XYQA 1Q1EA 3SC2A 1NL3A 4OI4A 4AO8A 4CF7A 2NZJA 3GNTA 3UAGA 2ZWVA 3VTZA 5LB4A 3VNAA 1I3LA 2HWKA 2QDKA 2O7NA 4HB4A 3S5UA 2AR9A 4YMGA 2I2BA 1ENOA 2I0FA 3OE1A 4LXIA 4Q34A 3LFHA 3T8YA 5IDYA 4BYGA 3I53A 1EK1A 1IXRC 5EVCA 4M0EA 2M9MA 4IL5A 3RARA 4I3HA 2JCVA 3VPCA 4E1BA 3FTEA 1WCYA 4MUBA 4MSUA 4B35A 1ZEJA 2D8MA 3BAFA 3V2GA 1WCWA 2OCGA 3U6BA 2CXQA 1JSRA 3NBZC 4MZXA 3UT0A 1WW2A 3H2GA 1PR6A 1RZ3A 2FW6A 1NFRA 3ZV4A 2H17A 1T4CB 4OTZA 3QU2A 1F51E 3BJIC 2H9AA 1SHJA 3RVPA 5EHQA 2XQKA 2EF1A 3ZQ4A 4OQQA 3GWZA 1GRCA 1DNPA 4B7CA 4JR0A 2WIBA 1YH3A 2ZSFA 4IO1A 4XR4A 4BO5A 3TECE 1GL7A 3SQNA 4RH0A 1V8ZA 1B2LA 1CZUA 3AF3A 3CSDA 4WKPA 3GPCA 3AUKA 5JQGF 3IL2A 3TFWA 2J3HA 1KYQA 2X4IA 1T4CA 2MJLA 2P9BA 3AUUA 1W5SA 2IT1A 4QYXA 2P9GA 3FAZA 4GQIA 1P74A 1WP9A 1TZCA 1YBAA 3FPHA 4JD5A 3NIBA 4XX1A 5HM8A 3S8YA 1PS9A 2DQKA 3RREA 2C7PA 2DBYA 2BISA 3CPHA 1XN1A 3OT1B 4G0QA 3CNLA 1HNWB 1N1GA 5LQAA 1O1YA 4QE3A 3H65A 4D3SA 4KK4A 4Q18A 2D2FA 3LPCA 2ECFA 2FSHA 1JFSA 3HSSA 2BYTA 3CUVA 2Z9CA 2HLPA 4UNQA 1DARA 1RD4A 3T1QA 2VSFA 5BY2A 1KIMA 5KINB 2EG9A 1G63A 1XTIA 2WIFA 2PJZA 3D6JA 2OFPA 1ZC3A 2OESA 3T9AA 3DO8A 3K0SA 2WAAA 2QXYA 3LP5A 3HJTA 4OM7A 4DUGD 3VSBA 1L5QA 2C4HA 1DQNA 4L7VA 1LEHA 1OLSB 2GPYA 2CE7A 2PPLA 4ZGGA 2XQIA 3W5VA 5KDDA 4WWHA 4P22A 1TVCA 2ODNA 2AI1A 3HLKA 4PRKA 1D5CA 4Y1FA 1KDOA 2MOKA 2P67A 1YZGA 3IVAA 2QYOA 3O94A 1WXXA 1MFPA 1OTXA 4LZZA 3TAHA 2J9ZB 3O0TA 4P93A 2AD5A 3VVBA 3WYEA 5IUNC 2H4ZA 2FOXA 1OLSA 3LMKA 2ZE8A 3DDNA 4JSYA 1X9IA 3QUQA 1OF1A 2IDKA 1W85B 3TQIA 1SVUA 3WKAA 2XRMA 3DWEX 3IUBA 4KXQA 1Z4NA 3OLZA 2WM2A 2BEUB 1T8RA 3KC2A 3VDNB 3WTCA 4ZGWA 2V69I 4K28A 3L6DA 3F74A 1OB5A 4PGAA 4LPSA 1YA8A 1MJGM 2KJQA 1QKIA 2F3SA 3BRCA 2BI8A 3FYSA 3GXOA 5K0NA 3PHIA 2CLFB 2J6IA 1W85A 2FGJA 1HQCA 2HA7A 1GPH1 2QA5A 5ADHA 1H3EA 1R4ZA 1W0JD 5KUTA 2E6KA 5K8VA 2BGWA 2LV8A 2IBSA 3TKLA 2JEOA 4R2IA 4XM1A 2BGJA 2WW8A 3MS4A 1J20A 2Q5JA 1JVBA 4JOSA 4LZLA 5AKHA 3RT9A 1YDEA 1QQBA 2EG5A 2BE7A 3H87A 4JKOA 5JCJA 3P9IA 4M8LA 5LLSA 4E51A 2JLSA 1XEWY 5ALJA 2P7HA 1RIFA 2AK3A 2CY0A 4ZOBA 1IR21 3GA7A 3L3BA 1N0VC 3TVYA 4FHEA 4EEKA 1OAAA 1A8PA 2XDAA 4ZVKA 4Q6BA 3EVTA 5LBUA 1I2MA 5A4KA 4FB4A 4G2NA 3H2HA 1BD4A 4ITRC 1MVNA 1Y9DA 2CCKA 4FZ5A 5LQCA 3T3DA 4NXMB 3O2JA 1JLLB 1NT4A 1UT5A 4KVFA 1ODKA 3JZMA 2HNBA 1UBNA 3STVA 4K5QA 2J59A 1UKCA 2H1LA 4CCYB 4LJAA 1CLUA 2P1RA 4MRMB 1TW2A 4J2HA 5G1NA 3R74A 2DMRA 4DEYA 4GU5A 5T4BA 4BVFA 2PK3A 3KKQA 1ZH8A 1BS1A 2ZUTA 4JP2A 1VB3A 3OZUA 4AXBA 2C57A 3FDIA 4FI3F 1XTPA 1RQNA 4AY6A 2BSQA 3FJ1A 1AKTA 3GJQA 3O75A 3C3BA 5JFGA 3AWDA 1D8AA 3GF4A 4OIMA 1UZHC 4CCYA 2QZ4A 4EEXA 3BK1A 2OCBA 4MRMA 1DRWA 1E58A 3FXAA 2XB6A 4KXYA 3I23A 2Z57A 4BP9A 1JR3A 2NG1A 5LWQA 1NBME 1AQJA 2FRXA 1LA2A 2YQ5A 4WKGA 3EGOA 1JFFB 3AXSA 4O4LF 2W4MA 2ISQA 3FRHA 2QN6A 3PEFA 4K9PA 3ZDEA 4TMZA 2E3JA 3OZGA 2Q45A 3NATA 3RDPA 4BFTA 1PJTA 3VR6H 4Z2YA 1AMOA 3V80A 4AP9A 1YA6A 1AGXA 3ZGZA 3P0JA 4RGVA 3PC8A 3NNNA 1MAAA 1L4GA 5EJAA 1N0HA 1AN0A 4J4BA 2J9RA 2JCBA 4MKHA 4DRYA 2W71A 1OPRA 1JFFA 2ZSUA 2Z58A 4XQCA 4DJEC 3MAJA 4WBNF 1HBJA 1LRJA 3IILA 1G9TA 3L7AA 3NC1C 1ZRNA 1GG9A 1TM3E 2R5WA 1ZH2A 1RFLA 2GFIA 3KE8A 3ESQA 3RI3A 4DILA 1R64A 4LEIA 5DBEX 3AM4A 2QNRA 4P5EA 4M55A 4CIAA 4PNZA 3KQQA 3LVFO 4FEAA 4FGZA 2K2QB 3D3JA 1AO0A 1M6EX 4K6GA 4DCSA 4EK9A 3CJQA 5BW8A 4HXEB 1QB7A 3IBYA 1X1TA 2GPJA 3BD8A 3GARA 3QZUA 4K40A 2OHJA 4N9QA 4P4GA 4B6EA 4TYYA 3M3DA 2IYYA 1N4AA 1TUBB 2EJBA 2W6ID 5I8ZA 4NLLA 2ZSAA 4MJLA 1VLZA 1YB6A 1L7AA 3KKPA 3UANA 5DO9A 4HATA 4MLDA 1Z56C 1YU6A 3F5SA 4B2LA 2NACA 3JVUA 4NWIA 2HXSA 5IBPA 1KOLA 1FXUA 1P1IA 3GCXA 2YBDA 1K5GA 3I0MA 2ERCA 4N8SA 4RM3A 4YRLA 3VR5A 4I9GA 3R4VA 3TRKA 4E6EA 3PFHA 3HYNA 3ZC3A 1TUBA 2I7CA 1Q0RA 4XX0A 4D5EA 1NI5A 2ZB2A 1EDZA 1GDDA 2IYXA 3G5MA 3MF4A 3R5HA 4POAA 4X1YB 5BW4A 1B0AA 2C59A 2VT2A 1C7EA 4IDEA 3RUDA 1H8HD 1LLQA 2JDIA 4JQCA 3L93A 1G2OA 3K0CA 4GPD1 4DV4B 4DBLE 3OE7A 1Y7LA 5IARA 5JAHA 1UKEA 1I7PA 4RVGA 4BIIA 4G0UA 2JGKA 1CJKC 3SFTA 3FYHA 3HZHA 3UN1A 1CB0A 1PNOA 2I4MA 1HDYA 2HZBA 3LQ1A 4DLZA 4X1YA 2ZM6B 1PUIA 5K1ZA 3DL0A 1PKXA 3FSGA 3OX3A 4FIZA 3PNVA 4ZC8A 4ESOA 2X2PA 2B4YA 1X14A 3GGCA 1VL1A 3ZNNA 4UW9A 2IYZA 3N2IA 5H3CA 5K51A 4CIYA 4NZ9A 1W30A 3ZV7A 4TTRA 1MAHA 3LQYA 4ITVA 1SWWA 1GUYA 4LK3A 4G0OA 4TZ0A 1D5WA 3PPYA 3EVAA 1OFUA 1KS2A 3R0XA 1XZJA 4HUQB 4KFTA 3T38A 1FX0B 1FTQA 4UULA 4F0JA 3U09A 1C0PA 2Q9CA 2VJOA 5FTJA 1MXFA 2CHGA 3BVPA 1K7FB 2C3YA 3HKCB 3B7GA 2AUNA 1ECGA 4ERNA 2I2FA 4XOIA 3ZK7A 4AIRA 1CULC 2IYLD 4XYEA 4C0QC 3LXXA 3B89A 4E03A 1S5PA 1P2VA 2H11A 4HUQA 2E1RA 1W1IA 1FDSA 1FX0A 1IOWA 2A4KA 2JGDB 3CB2A 3S8EA 2FW1A 1F8YA 3OA0A 4LYFA 1LDNA 4HOYA 4QGSA 1SVSA 5G4LA 4KDEA 2Y99A 1I3CA 2G9RA 4QEDA 4B3TB 1VJCA 3U16A 1F3OA 4ZOQI 4FIDA 4DE5A 2GHIA 3Q2KA 4RYDA 3G79A 3JAWA 2OEPA 1E2PA 2GZDA 2JGDA 3DTVD 3LA6A 4J1SA 3L0DA 3ES9A 2BGRA 3FD8A 1T26A 2VDWB 2AN4A 2YRFA 3JQBC 1E2FA 3A1WA 4HEJA 4LVNA 3TEFA 4BFZA 1BROA 1H0SA 2J0VA 1KY5A 2ZR0A 3I9NA 4X44A 3WLSA 1WR8A 4RSRA 3L05A 4RF4A 5E4YA 1MQ9A 1T2DA 1M2OB 5P8WA 1A4IA 3WLNA 3F71A 2CSXA 4PYMA 1AGYA 2DPHA 4B3GA 4JUBA 3E2PA 4KTTE 1U3DA 1T36A 3G0GA 2R7MA 2JJ1D 1XQ9A 2NTEA 2VBIA 4JB3A 4YRIA 4PPGA 1RAAA 4TV9A 2VDWA 1B42A 5FBZA 1N2CB 3PQ4A 4MOWA 2PZBA 3KOMA 1SC6A 4RM2A 1KZ9A 5IMBA 1OFIA 1WXGA 3C15C 3CLRC 1KRWA 2ZJ2A 2F64A 2XB4A 3AM3A 3WGOA 1LLUA 1M2OA 2FB9A 4UAVA 1B23P 4J0HA 4KDRA 1QOZA 4RENA 4RV5A 5H4GA 3UJNA 2BW0A 3EGEA 3CH6A 4ZQCB 2UUBB 3B8EA 4BMNA 3KXDA 2E87A 4XARA 1L8QA 1N2CA 1JAHA 2RHJA 4W99A 4GC9A 9LDTA 1M8PA 1T0JB 1WQ4A 4HI0E 1GLNA 3HA3A 4YAFA 2ZBDA 5E6SB 3WL5A 1CSEE 3ONEA 1JEDA 4IDPA 1E2UA 1SCAA 1TM4E 3Q7RA 4RIEA 1L5OA 5G0UA 5EUCA 2A5JA 2PUTA 3ESCA 2UYYA 4TTJA 1OI3A 1CD5A 5BQOA 2PUDA 1GZ4A 2G76A 1PJ2A 4K1XA 1KP2A 4FEEA 4U2BA 4FDUA 3SZLA 4IMRA 4EHNA 4R1MA 3E8SA 3QMVA 4WXEA 1SOAA 2B92A 2ZBVA 3HN2A 2O0MA 2FSUA 2VK8A 3GW8A 2ZATA 1Y33E 1GTMA 2J5QA 4WOCA 7AT1A 3KUUA 4RSGA 8LDHA 1UKZA 1UOQA 2PH1A 2PLWA 4JMLA 4JP1A 4BV8A 1LZKA 1EBFA 3U5TA 1CIVA 4F3RA 3VH3A 1MAUA 1RC0A 3FGOA 4Q7EA 3ELBA 3RC3A 4E88A 1E18A 2JGRA 5LQRA 2XBMA 1G5RA 3RUBS 1RLUA 2HWUA 4L8FA 4WKOA 5BVHB 2WHEA 3KXPA 4MQBA 3NYIA 1TI7A 2A5DA 4JOCA 4WXRA 3SIPA 1GZVA 2BT4A 2WG1A 4DBZA 5FDFA 2GEJA 3LPAA 5K99A 2WU0A 3GUYA 3TQFA 2CXOA 1KDRA 4M89A 3FOEC 2Z95A 1IOVA 3FPLA 3QM1A 3IT2A 1JHMA 2FPKA 3DMTA 3RHFA 2AKYA 4DM3A 6GPBA 2CLLB 3QOXA 3V4LA 4KHPB 1XD9A 3W5UA 4PFKA 2DX7A 2Q3CA 5IC5A 5K6AC 4GOOD 1ACJA 1JXMA 1RRVA 5BSGA 3RK4A 4DMMA 3DZKA 1I5OA 3AY7A 3VJMA 2DWUA 3EUWA 1ZVQA 3LW7A 3I37X 3D5QA 3ZH9B 2WG0A 4DQDA 1L1QA 4PR0A 3OZEA 3DAPA 1EJ7S 5CK4A 2XNDD 4D3ZA 2FEXA 2AV6A 1QUEA 3V5NA 5ED4A 1FQWA 4G89A 1X8LA 1WZNA 5DNWA 2EFGA 2AZTA 3EN0A 3LBNA 4KPEC 2G72A 2I6QA 4KB5A 3CUUA 4IILA 3DWFA 3EOBI 5LMUB 5CW1A 1YASA 1JS1X 2DPYA 5KOHB 5IZCA 4FBLA 4Q1BA 1SD2A 4TYPA 1ZOIA 4CLEA 2G5CA 4CL0A 2WE8A 4B2PA 2IHNA 2HXGA 2LDBA 4I1YA 1XNQB 1PQWA 1N2OA 1I14A 4DLLA 4TLCA 1QBKC 1DHTA 1RTTA 2EERA 4PONA 1DO8A 1N75A 3IUJA 3EK2A 5HUQA 4DLKA 2R00A 1JKJA 1VYUA 1G6Q1 1FMLA 3ZU4A 1KI6B 7REQB 3MCZA 1PWYE 2VCYA 2VTDA 4I0WB 5A4FS 4A5OA 2I7XA 3VKHA 2VYNA 1OASA 2CK3A 1QNFA 2FU5C 4ZRDA 5EYPB 4FOTA 2C2KA 2ZRKA 4LX0A 2BDEA 1A5AB 3OZXA 3WLPA 2VNAA 5JQGB 4DLRA 3D0KA 2WHRA 3RJMA 7REQA 1K8YB 1Y98A 2QTBA 4KVZA 5HJ5A 4X94A 3LT1A 3MJFA 1I3NA 4PHTA 4AD8A 2ZSEA 1Y8RB 1Y4SA 1QYRA 1T0BA 4AN0A 5I4BA 3PWSA 4K9SA 1REQB 3LFTA 4Z7QB 1GRRA 1E9CA 5EYPA 2VQDA 3O83A 3UUGA 2A35A 3FKQA 5JQGA 3QP9A 4DQVA 1QS0B 1J5XA 3ENKA 2BMVA 2B98A 3AYXB 3MM4A 1H9BA 2RHWA 1PJ4A 3OM1A 3MJEA 2O1XA 3F8SA 4KL8S 4KVGA 3A1EA 4LPKA 3F9IA 2I71A 2P5TB 3RUFA 3T41A 1Y8RA 1XZQA 1NV9A 3PICA 4ZOEA 1AKUA 1LV8A 1M1YB 1P0PA 1Q6ZA 2Z43A 3GGJA 1REQA 5BUZA 1I1NA 5HKKA 1PLJA 4XYBA 5DLYA 4BWFB 1SQFA 2EF0A 4QYMA 4EDHA 3L8HA 2BGGA 4UBIA 4MMXB 1BMFA 2H1WA 2HRQA 5AHKA 1QS0A 3H1FA 2HSEA 2YUIA 3FHOA 1DG1G 1AKVA 5JEDA 2W2TA 1OFGA 3O3MB 2CZCA 4BMVA 1M1YA 3NPAA 3N86A 4TLAA 3CC8A 1MKYA 8MHTA 1Z74A 2X7XA 4IXWA 2OGSA 4NAUA 1KI1A 4PIVA 1P60A 4XB1A 5HG0A 3UO8B 3X2SA 3FW1A 2VHTA 3EPRA 4NOLA 3WIVA 4D4LA 1ULAA 1LPBB 1YB1A 4WY5A 4TVBA 3REOA 1WMBA 4UBLA 2PD6A 1JIUA 1RRKA 2YZKA 5KQSA 5ITWA 4W63A 1AN9A 3ICEA 5FKJA 2O52A 1NP7A 1JXOA 4WEQA 5JCPA 4HWGA 4YRMA 1SZCA 3HCRA 2X86A 1E2HA 1A7UA 5I7RA 1WETA 4K9QA 3PHHA 2DFKB 3H6HA 3IDQA 1AK1A 4Q9JA 4B84A 3CZQA 1K98A 3D3NA 2A86A 5K0EA 1U28C 4QYTA 3AONB 5DGHA 2FF7A 4DABA 1G8FA 2AMJA 1UH5A 4JJKA 4YAWA 3KHTA 3C4VA 1GNSA 3KXKA 1GXSA 3SHWA 1E1RD 1AD2A 3HXMA 4UNSA 5DM60 1UBJS 1KIFA 2CXHA 5EZ6B 1Z38A 1JHZA 3EQ8A 3RS5A 4A0GA 1UZDC 1N4DA 1QG0A 2AKEA 4L9AA 1G5TA 1N3LA 4M46A 3RF7A 4EPVA 1KH1A 1S8AA 3K4PA 4OI1A 1RU3A 2JLUA 2AYXA 3DOEA 4L57A 4TT8A 1L5GB 3OZVA 2IC5A 2C4VA 1KOFA 3CNOA 1CY8A 4LGMA 3STXA 2BLNA 1J2JA 2PG3A 3DL2A 3WAKA 2O4UX 1MMFB 1KDTA 2QN8A 3MPUA 3L4JA 4NBTA 5G1OA 3U39A 5A03A 3U80A 3RRMA 4OIFA 2K6GA 2Z0MA 4LNHA 1ZYUA 4YIKA 4A2QA 3RKSA 2HLDA 5KJFA 1NWHA 3RRZA 1N9KA 3E23A 4OJMX 5BO5A 2EZ9A 3ROKA 2WY2D 5BR7A 3VVLA 2QLJA 1XCPA 3N07A 3EZ2A 1IJEA 1ESZA 4N0PA 2EBHX 4M1WA 3EXHB 5EJ2A 4KQCA 1DDIA 2XTNA 3ASVA 4F5DA 4RVCA 1H4VB 1GUZA 1TM1E 2L19A 2O2YA 4W9NC 1YNSA 3HACA 2XXBA 1WZCA 3KPJA 3PXDA 4G86A 4F86A 4WECA 2BY4A 2FHPA 2B4RO 4X71A 3PUVA 3RC9A 4B45A 1MW8X 4C4TA 3BCHA 4HNGA 5FFMA 1XNGA 3NORA 3QOFA 3VYVA 1DMRA 3ONNA 5P21A 1VBNA 3COVA 3EXHA 2QTVB 4W8OA 4BTLA 5DK4A 1XSEA 5G4KB 2XZPA 4IZ6A 1L5LA 2RHCA 1DO2A 3BRWA 1WZIA 4FWIB 4ER7A 4NCXA 4E7PA 1GGFA 2IS1A 1TQDA 4EI8A 3LY7A 1IEQA 3C85A 2X0RA 4MZDA 2PZEA 3HKDB 4O4LB 4P1ZA 3SYMA 5B2FA 4OHUA 3QLJA 4F60A 1WQ1R 3DS8A 2I4OA 1O6CA 4O1HA 4BMSA 3U7FB 1CU1A 1SZDA 3OZIA 1H4QA 4PZAA 1R4NB 2YIMA 3I34X 2QWXA 2QTVA 4WLFA 4RNCA 2YFHA 4WCFA 3TLZA 5G4KA 2LKCA 3W2EA 4D3XA 3HEAA 3VSEA 3N0WA 4YPOA 3DDWA 3I12A 4HDSB 3FVTA 2A9FA 4B47A 3PUYA 4CODB 4O4LA 2OM6A 3HKDA 1TD9A 1Z5WA 1NIJA 3USES 1JI3A 2YV1A 3BEOA 1LPMA 2PSSA 3MWGA 4EB6B 2NYRA 5A02A 4DDMA 2A1TR 1QVRA 5KQRA 4C1NA 4BEVA 4EW1A 2WYIA 3CEMA 4L78A 2GJ8A 4ZGBA 1JEYB 3P7MA 5K8TA 1HT1E 1ZD4A 1TDJA 4HNAB 5BOSB 4HDSA 5JNRA 4D99A 4S05A 2ZUVA 5JNLA 1CQJB 4HFMA 2R2GA 3L0ZA 3OQIB 4PBRA 4TTQA 4HC4A 2MHCA 3LHFA 4ZMSA 1GFSA 4P0PB 4EB6A 4BYMA 3L4EA 4EHAA 4ILEA 2ZB4A 2P9QA 1KZ4A 3N75A 3BJEA 1CJMA 2MR6A 2LIVA 4N54A 2AR0A 4YBZA 5EWJB 1JEYA 3HDYA 2PTGA 4BKOA 4HNAA 3VMMA 5BOSA 1J2YA 2XGGA 3AR5A 4CM7A 1V9CA 1CQJA 1MX5A 3OQIA 1VFPA 4AY5A 1N92A 2R6DA 2X13A 2DWCA 2P6RA 2PYZA 1J8VA 5AK5A 4CFSA 4L50A 2QJFA 3SZGA 5JPDA 3O9MA 4FCCA 5EWJA 1TMKA 1EJBA 2RJNA 4NIMA 4RCVA 1HYHA 3BZWA 1PSWA 3EIWA 5KJ1A 2R1VB 3HMQA 1L4EA 3CLUD 3FTCA 3GUCA 4X6YA 3ADCA 1NQAO 3A25A 5F7XA 1E79A 3PNPA 2J3JA 3K0KA 4B6QA 1C1DA 4EHDA 5HWSA 1E8NA 2ZIAA 5LIPA 2PGDA 1DKLA 4JB2A 3TNLA 3KX2A 1ENPA 1J07A 1CNMA 4P3OA 1RHQA 1VE5A 2JGFA 1G20E 3DG9A 4GNRA 3UMVA 1JDTA 3OP4A 1MGPA 2MSDB 3PF8A 3GVCA 3DE6X 4XSHA 3L4BA 1UMKA 1GNVA 1Z3IX 1Z06A 3DWGA 3ZCTA 4YMHA 1L7QA 2ECKA 4NZPA 1R18A 1LBIA 2R1VA 4JKIA 1TFRA 2H5LA 2LGJA 3AVPA 4L8GA 4NYIQ 3ZCXA 2O8CB 2BGIA 5G3ZA 3G02A 2W6CX 3KTAB 3N2KB 2LTAA 5KC9A 3TX6A 3HABA 3UJ9A 3SM3A 1TL7C 3FX2A 3UC9A 1MB4A 2REXB 1BKDR 1X1QA 2ZJ3A 2VYCA 3U44B 3C97A 4LECA 4R2JA 3X1YA 4OU4A 1GJRA 4FWBA 1SPXA 4N7MA 3GFFA 2F8MA 3FUUA 4KQHA 3KTAA 2O7RA 2DFVA 4JLJA 1M2HA 4DNXA 1QCDA 4FFLA 4II3A 5EKDA 1KK2A 2ARKA 2NO5A 1RWVA 4D6PA 3INGA 2DQSA 4EW6A 4IGFA 4LSWA 1Z4OA 2C77A 5ALTA 4HAOA 1NNLA 2GN4A 1IHPA 1WMFA 3SIWA 4W5RA 3U44A 3SVLA 2WWWA 4NBRA 4PLWA 1AUXA 2C3PA 1EE2A 2G6BA 3S1LA 3ZUPA 5T4EA 2B99A 3IP5A 1N5IA 3F96A 1J4AA 4C7KA 4F12A 4DDTA 3DOCA 2FMXA 3ROGA 2XCRB 2IOHA 3MTAA 3NAGA 4TYMA 2Q2NA 4CEHB 1VSVA 3MWLA 2H1IA 4ND5A 2C31A 4HNSA 3TBFA 3PFCA 4PC3A 3TIXB 2NSJA 5IN4A 2PQ2A 1T43A 4RGBA 4ZHQF 3DDZX 2HN9A 2V7PA 4LYJA 3GYGA 3MLBA 1OXTA 3AOEA 3E05A 4DN6A 5BVGB 3FHCB 3PJGA 2HMAA 4JVLA 4D57A 5LLTA 3VU0A 4FILA 4BV2A 2JZOA 3INYA 5AKKA 1Z6TA 2W2KB 2PFGA 1XZ8A 2ZRPA 3MERA 4CEHA 3N9IA 1KY4A 2D13A 3UMSA 1GWNA 1L0BA 1ZM3A 1FC0A 2Y3IA 2CZQA 1ZWLA 3GAAA 3ECAA 3I9FA 2CXRA 2W6ZA 1PR4A 3N0RA 3A58B 4D4GA 4PZZA 1X80B 3G17A 1XPOA 3CPEA 1QFSA 3KOUA 5CNMA 3VR4H 3FNIA 1I32A 4Q00A 5BVGA 5IWAB 3ER9A 2C58A 1ZL2A 1T9HA 3ZLBA 4KE7A 1YR2A 2B37A 2UYGA 4N5DA 4G5YA 1XE3A 2W2KA 3LO8A 4NBVA 2Q3JA 4PZYA 3TPCA 2UUOA 3TMAA 3RSSA 4BNGA 3G1TA 5DISB 1C7QA 2VCEA 3NIWA 5DBGA 4CQJA 1UPFA 1X80A 3BICA 5EMJA 3NM5A 2GBCA 4MUNA 1ZN9A 4YRFA 3ER8A 2BF7A 1I5RA 2R60A 1AZWA 3K6RA 2II6A 5FJJA 1OWPA 2H5EA 1GY8A 2FHZA 2FH5B 3I2HA 3QU7A 4O4JF 4EOGA 2EQAA 4AWXA 1SOWA 2P9TA 2QUIA 1KEZA 4I1RA 3S81A 1GEGA 1EIWA 3A6HA 5KNBH 3T7JA 2YCBA 4OBWA 2ISSD 1NJGA 1YE5A 2A67A 3VSAA 2AC7A 3FNHA 3KEOA 3GRZA 3VYWA 4DLXA 3P9XA 3VYRB 1YE3A 3WNVA 3R9KA 2XF8A 2HKIA 2UZ1B 5C7OO 2C4WA 1CPYA 4REQA 1PR5A 3PU6A 4IGEA 1YUBA 2PO5A 4PYNA 1U4OA 2DBZA 3ND7A 4HH1A 4ID3A 5FCDA 3UWDA 4BFUA 4BX0A 1KO7A 1PGOA 1XROA 4NP6A 1G8YA 4RVSA 3ESAA 4ZVVA 3AEUB 1NKSA 5KTRA 2IEBA 3DKRA 4IGIA 2AF3C 4E2FA 4D9GA 1LLDA 1XV5A 2OO5C 2NU8A 2GRJA 4N9WA 2AGVA 2UZ1A 1EK5A 5H7XA 5REQB 4DA9A 1CEYA 1DC6A 4U7JA 4LJ4A 1ZK4A 1K75A 4WZAB 2YZGA 3R3JA 1H0HA 2ZYGA 4L07A 3W3ZB 4DSZA 4Z86A 2Y2UA 3GQBB 1FU4A 3PPXA 2VDJA 4MVJM 1YDGA 3AEUA 4EM6A 3NPMA 4NOJA 2XTMA 1ECFA 1ZIPA 4G36A 4JLMA 4ON9A 1DEHA 3L0PA 2CUZA 2RGRA 1WZUA 5KPJA 1YRWA 2O8FA 1X0VA 5B53A 1FNCA 2FPXA 3WL3A 2CKMA 5IAAA 3R8XA 2GETA 4KQ6A 1ISGA 1JPNA 1KI8A 5REQA 2V5VA 1TF2A 4EYKA 2XIJA 4WZAA 4BB6A 2XRYA 2XE7A 4G63A 5L3RA 3GQBA 2V0NA 4F8JA 4KODA 4NCBA 4QU8A 3DP9A 4HDKA 2UZ0A 3B51X 3EASA 1MEEA 3MWDB 3JPYA 3OCJA 4KQGA 3I2KA 1P62B 4YWJA 1MO2A 2F43B 3P9QA 1J0AA 4DTIA 3RW9A 1QHXA 3IX7A 4COOA 3OKAA 4BEJA 1OVGA 3LSTA 4QOHA 5DNEA 1DRJA 3A0UA 5BUCA 3ENQA 5DXJA 2GAOA 1DKOA 2O48X 3FMOB 3THXB 3DYVA 1D1SA 1YFKA 2AFHB 1GPLA 3ZZUA 3A4VA 2R1UA 4C14A 5JG7A 5AKGA 3WS7A 3MWDA 1PWEA 5SY6A 2F43A 4XQ9A 2FZ5A 3FMPB 1K2WA 2XB8A 4OA8A 1D07A 1RHRA 4A2CA 1OIWA 2XUQA 1GADO 2V7EA 4JGIA 821PA 4RZSA 3K0FB 4R7ZA 3MHTA 3PUXA 3BHMA 4Q4DA 2QMQA 3OEEA 1Q0SA 6Q21A 3C1TA 3H9GA 3QRWA 5K6TA 1PK9A 1VGQA 1ZD3A 2HSGA 3P2YA 4HPWA 2Q62A 3PPWA 2AFHA 2DFDA 4Y2GA 5JLAA 2FXIA 2R66A 2DWPA 3WSTA 3FNFA 4OQPA 4MX8A 1LK7A 1GO2A 3HSKA 3BT7A 3DDCA 1PSZA 7ADHA 1QIMA 4MQ4A 1UC8A 5J2TB 3T7TA 3U9LA 1BZYA 2VHYA 4ZODA 3K0FA 4PE5B 4M1OA 4DNFA 4EUSA 4K87A 2FSGA 2GK7A 4DCOA 1EVIA 2PVCA 1DUIA 5TPZA 3H8JA 1G9SA 3S27A 2AMFA 1AXRA 3T5TA 4CLRB 1VBFA 4CM4A 4NE7A 4W1SA 5HQ3B 4NMWA 4O1IA 3AHDA 3DZIA 4UU8A 1PO7A 1TAQA 3AUSA 2ACWA 2C92A 3HUEA 5J2TA 2O50A 1FMJA 1UR5A 3JQEA 2IRWA 2ZR7A 1PI3A 2WOJA 3SBDA 1FUKA 4XWKA 2HU7A 2XA1A 1JAXA 1FYEA 2OCKA 1EX7A 4I3GA 4N03A 4M9XA 3LRXA 4HCJA 4XFDA 4CLRA 1NSFA 3HXKA 5BUQA 2WC1A 3EVBA 5HQ3A 3M89A 1XCBA 3GR6A 5DCLA 2OBLA 2ZKIA 1XI2A 3CX8A 3MTIA 4UFOA 2OM2A 3HO6A 1IDN1 3U3OA 5CFMA 3HK2A 4N5IX 3KB6A 2X23A 1U8EA 5E2AA 4F21A 1RXEA 4N65A 3F4BA 2M1ZA 3KOXA 1D03A 1F14A 1K6IA 3QNMA 2OAEA 4LRYA 3A14A 1U1GA 2FZCA 4RVHA 4TWIA 5H0IA 2H4XA 3KSRA 2D0IA 2VIIA 3A2KA 1KKUA 3SVZA 2VYQA 2X0EA 3ESDA 3N28A 1K8QA 3CIFA 1SBYA 4PM4A 3BJZA 3OT4A 4ZFNA 1MRSA 2ZE7A 4M8SA 4RMJA 1T3LA 1LVHA 2P4QA 3LGAA 1VL5A 3PG5A 3T52A 3UA3A 4O3MA 4DA7A 2GN8A 2HO5A 4LV5B 3TW6A 3F46A 3OOSA 3W6NA 5C1BA 2AZMA 1H8EA 3P4XA 1S2LA 3O90A 1LBSA 2B5OA 4Q3NA 3V4PB 4M4SA 3UW3A 1F7UA 2F62A 5SY4A 1ZMTA 3W7VA 3ZY4A 5I7SA 3KJGA 4RZHA 3GLGE 2H54A 1DEKA 1ZHFA 4AKEA 4UUNA 2XPCA 4G1BA 1GA4A 1V39A 1DZ3A 4O4IF 2DT8A 4EHBA 5D6NA 1ZDMA 2TRSB 2C9DA 3OH8A 4C0AC 1BVYF 1THGA 1Z0DA 3AERB 2AQKA 3NHJA 3OTHA 3BFVA 3L7YA 3F5FA 4NHEA 2DH5A 1KMCA 2V58A 3OOHA 4GDMA 2GYUA 4M2LA 2DE0X 5SICE 1NJ6A 4D56A 4RNDB 3KQUA 2ZDGA 1G3RA 1RLOA 1Q12A 3P27A 2R84A 4YX9A 5B1EA 3H6KA 2Z98A 1P1HA 2FGKA 3KQYA 1MLDA 3N8KA 1YJ5A 3EPLA 5L3SB 1K6MA 3I5XA 4Y1GA 5UKDA 2QTWB 4UTRA 2I33A 1Y9AA 2J6CA 2G9QA 3AERA 3LIPA 1Q0LA 4MCHA 3ZGVA 1YR1A 2BDTA 4RPJA 3T94A 2YTZA 5CDUA 2PZMA 3ZN2A 1MX1A 5LNK6 2RIRA 1XB2A 3A9WA 4A4DA 2GPSA 1GYQA 4EGFA 4Y6LA 5A1JA 4JLUA 4MAMA 4JHLA 1IIRA 4CIVA 3VNRA 1AOXA 1R6TA 1NPTO 3KZCA 4R83A 3EXAA 5AIAA 3SS9X 5L3SA 1PZEA 1HSZA 3T9BA 1LC0A 1P5JA 4OGWA 4B5KA 3FOZA 2YJTD 1E7WA 2H6EA 4BQEA 2P9FA 5FTKA 4JJIA 5GGXA 1N0IA 2CLMB 1DLJA 1FFEA 4U4AA 1KFJB 5JCOA 3TLAA 2NVOA 4RJIA 4GMGA 3WAJA 1RJWA 1F06A 3F4LA 4LNUB 2QPAA 1V25A 2WF9A 1TMOA 4IOLA 4U8HA 5ITZB 4DS3A 2FR1A 1QONA 2RC6A 3B13B 5G53C 1TECE 1AMUA 2I1WA 3STYA 4HXFB 1KL7A 1QHFA 1VIAA 3VC7A 4TUYF 5I9NA 3CZCA 1BVUA 1ZNWA 2IBMA 4UU0A 5JYCA 1DJOA 4DDHA 2QZZA 1P9RA 1R5NA 1B00A 1XF1A 4ZEWA 3WFIA 3BWMA 1RLCS 4NE2A 5GV8A 1U0HC 3S2FA 2Z2ZA 4KQXA 1BMQA 2ODWA 4LNUA 3VOAA 4EJFA 1V6SA 1WKCA 1E3JA 5ITZA 2BUBA 2VNJA 2WU8A 3AEKB 3CZ4A 3V34A 5LDHA 2P2GA 3K0AA 4D6XA 2IVZA 1CXZA 3C3EA 4DW8A 4YCAA 1R6AA 5K3DA 5F1KA 2PH3A 4IH9A 5TMDA 1QFXA 3SDBA 4E4YA 5BV7A 1RPNA 1MDBA 3ZLUA 1HM5A 5FWAA 3TNDA 5HPYB 3SX4A 4WOJA 3T95A 2E2WA 3GUZA 1O89A 2ZI3A 1VFNA 4ARSA 3AEKA 1Q16A 5AVZA 4GOLD 1KMIY 1ATZA 3Q10A 4NYJR 1QO0A 3R0ZA 3U1TA 2VI5A 1HDIA 1TAHA 3PKJA 1CUEA 4X5OA 1DADA 1I2DA 4RTJA 4FYVA 4I9FA 1VA5A 4LHSA 1P0MA 2FLKA 2BGNA 1KFKB 4GT1A 5BQFA 1V2HE 3GVIA 2VT3A 3QITA 1J56A 2PX5A 3DYIA 1I80A 2EFHB 3A6JA 3I9MA 2YJ3A 4H7JA 4BO0A 2OK8A 2VJYA 2C0PA 4ALMA 3WR5A 5EMKA 3WK6A 4KACA 4LZJA 5AVWA 3OQVA 1GCIA 1Z2DA 2EQBA 1OYOA 2C2HA 3F6CA 1L7OA 2X2OA 1IUNA 2G04A 5ITVA 2F6RA 1ND5A 2LVBA 2X7JA 3ZDRA 3OCXA 3RAEC 1NSTA 2C20A 4CMHA 3AF0A 2JZCA 5DB4A 1OC2A 2CDAA 4DZZA 5JRZA 3NHPA 2Q4RA 5IP5A 4TMVA 2WKSA 1ISHA 2PSDA 1PFVA 3FHJA 3UAYA 3VTKA 1KAHA 1YR7A 3W5IA 4A8JA 1K1EA 3V00A 1XVAA 1U8FO 4JEHA 4URUR 1DMSA 4JJ4A 1TEXA 1UJNA 3SQXA 2YXPX 3JD2A 1TYBE 4L9RA 2YR0A 1ZC4A 1IWAB 4JBWA 3H1TA 3GEDA 2B8WA 3WL6A 2FQWA 1CE8A 2CBZA 2ZTHA 3L46A 4YP7A 4JY7A 3MOIA 3HM9A 4QIHA 3CXUA 4GQAA 3H6GA 1YRYE 1R10A 2WFMA 1XMXA 2YNMC 3I76A 1S9DA 1L4LA 5AUPB 2C8LA 3O4IA 4RKQA 5CR9A 1TXGA 1POWA 4CKCA 4EENA 4F1KA 5FFFA 3FJOA 2E4ZA 2OE2A 2XVMA 3AEZA 3CSSA 3G2QA 3QEOA 3V33A 3MGBA 3PE4A 4PPQA 3QY9A 3HXPA 1ZCJA 2GBIA 5DRYA 3WA6A 3U4IA 2YRXA 3CYFA 3C5VA 5TJ9A 2WSSA 2GI4A 4BWVA 3NM6B 4L28A 4QBHA 5HA5A 1Z34A 4P7GA 3ZY5A 3HA2A 4O2LA 3HMKA 5F2EA 2BKVA 5K3BA 1T8SA 4Z8XA 1YDFA 2X5OA 3IQZA 1HH4A 3PYXA 4KFSA 1T13A 2ZREA 4S12A 3W9YA 2J5XA 1KK3A 1LRKA 2J5BA 3KZVA 1NC3A 2H2IA 1WF3A 4MKRA 3KKOA 1M33A 2QK4A 2W2MA 1J8DA 4KRXA 2PGJA 3IESA 1SQ6A 4ZAVA 2I34A 3HGTA 4DMCA 3R2JA 2XKBA 3M4YA 5DWDA 2FR8C 5KPDA 3U49A 2HWXA 1ZN2A 4BBJA 3MTEA 3RGWS 4F97A 3T4XA 2YWCA 2Q1XA 1LVGA 1TJ3A 4B1FA 3LKVA 5AKZA 1P1CA 3C3PA 3JYLA 4UASA 1SM4A 1L3IA 3RIMA 3KJHA 4LY6A 5DYNA 1NBMA 4CIBA 1QIKA 4LQCA 2JCYA 2Q41A 1WS6A 2TMKA 5HSGA 5FQNA 2J9YB 5F7OA 5HZKA 3FPKA 3ZD9A 1AHHA 3FYCA 5HMMA 3GLKA 5HK9A 2ZS8A 3PX3A 3T3HA 4Y8VA 3JQ8B 1XRPA 5GTDA 1T9KA 3AY3A 1EJ6A 1ZWKA 4CF3A 1Z7GA 3AP2A 2ZAMA 2P1ZA 2VXBA 3DXYA 5TF4A 3SKVA 2X9NA 3KVOA 2HCRA 1IYZA 4ZIRB 4HAVA 1J09A 2FEKA 3SLGA 1XA0A 3PNKA 5IULC 1HI9A