4QGBA

Crystal structure of mutant ribosomal protein g219v tthl1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
KVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMVPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L1
publication title Protein-RNA affinity of ribosomal protein L1 mutants does not correlate with the number of intermolecular interactions.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 47
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4qgbA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qgbA02
4F9TA 3U4MA 4QG3A 1MZPA 3U56A 4LQ4A 4DFCB 4QVIA 1U63A 3QOYA 1DWUA 1AD2A 1I2AA 3UMYA 5DM60 5DM70 2HW8A 1CJSA 1ZHOA 3FPNA 3ZQJA 4REOA 4QGBA 3TG8A
chains in the Genus database with same CATH superfamily
1N6IA 1CIPA 1GCIA 2A3RA 5J5AA 3ZXYA 4UNPA 1Z9BA 1NYLA 5AVOA 4L8VA 3EYWA 1ENOA 3K0AA 2Y68A 4LOJA 3LT5A 2JGLA 4F5YA 4UU1A 3OEEA 4AD8A 4E2WA 3GJQA 4HGYA 5K03A 3KE9A 2PUGA 2OZPA 1UJ6A 3WYDA 1RWPA 1CY4A 4LSWA 1CZRA 3DOJA 1RBOC 2E2WA 4QPCA 4A2QA 1ZH4A 5DYNA 1DMRA 2B4KA 1DP4A 1GUAA 1UK9A 1NBIA 1M6YA 2DUUA 3L6RA 4M60A 1YS4A 3B5EA 3PRYA 4BKOA 4DV5B 4PLGA 1Y8ZA 4CDNA 3LWDA 3J81k 4O2AB 3LTEA 1SXJD 1NV8A 1X1BA 2QT9A 4N5IX 4W6QA 4RHCA 3CVXA 1JQ5A 4ZT7A 5SZIA 2V59A 1YDGA 3ASUA 4S2UA 4PNHA 5CR9A 3ZGLA 4C4SA 5AYVA 2WFZA 2VDNB 3E9MA 3TE7A 3TH5A 4N6GA 1MZPA 1I24A 4OBXA 4QU9A 1MB4A 3V2HA 4MUBA 1EG7A 1JAYA 4OP3A 5CVJA 2W6ZA 3ZDQA 4TSFD 1UPBA 3MWEB 3C3CA 1OIXA 3UAYA 4OAQA 3SNHA 1P8JA 2LIVA 5KYYA 1O08A 1OMOA 1Y9DA 4W7SA 1XA3A 2VNAA 4UBOA 4BLTA 3RU3A 1ZINA 4E03A 3N7TA 1SBIA 1LZKA 3PPYA 3MTEA 5TS2A 4ASUD 1RI5A 1RQRA 2AUNA 3DM5A 2FGKA 3BJZA 4F93B 5HZMA 3DPIA 2CUTA 1Z4JA 1GOTA 3OZUA 5EZ5A 3WGOA 5E3HA 5JYBA 1ZUHA 1C4XA 1CD5A 2FNAA 3VOSA 4II2A 2RGDA 4RD0A 3ZHTA 4E0BA 1BYIA 2FJ0A 3PB3A 1WE2A 5GM2A 2GT1A 2P2NA 5DDIP 2DQYA 3RVDA 2P4EA 2JLRA 1I36A 2VZ8A 1DPGA 5E95A 4RE6A 3E5HA 3F5MA 2O2GA 1UL1X 4DQXA 4YO8A 3OEHA 3E22A 4QTTB 3KOUA 4N8SA 2QRZA 4BS9A 4ARAA 3KSBC 2KLHA 3JQQA 4I4TF 1T2CA 1VXOA 1U1DA 3KWFA 4AN4A 4RO0A 5FI5A 4GXQA 2BWJA 1T4GA 1H4VB 1KRHA 4Q66C 2H48A 3GEIA 4INJA 4KQEA 3PUHA 2NV0A 1UOEA 2B0JA 3LDAA 1G5IA 3AVQA 4L9AA 4M9ZA 4UEKA 1QV6A 3I28A 2WUGA 4F2DA 3VR2D 4JP8A 5ALLA 3CISA 2ZPAA 3LY9A 4D1YA 1OWLA 4L72A 1TQ6A 4MYSA 2Y1EA 2NUPB 4PR3A 1R0XA 4TSKA 4WOKA 4DHWA 1QP8A 3OP1A 1XCOA 1QH9A 1QRTA 1JVNA 3DW3X 4PRLA 3E0QA 2HPAA 1C4KA 3L0PA 1LD3A 3JQFA 4O2AF 3LK6A 1EIWA 2W8ZA 2CNLA 1GTZA 3MS7A 2LZ0A 5M34A 3SNKA 5LQSA 2H1SA 5DXAA 1AA9A 4AK9A 1TJ4A 1IG3A 1UFRA 4YAUA 3HSYA 2W48A 4WZBA 1QQTA 3VHLB 4D45A 1J4AA 1AZTA 2DFPA 1WY5A 4KWCA 5E7JA 1JBKA 3LUBA 4HY3A 4N7JA 4NU8X 3RWMB 2YQ4A 5JAZA 1UBGA 4L5BA 3MERA 3WLQA 4X20A 4AUEA 3EB9A 3UT5A 3VR3A 3DEIA 1Y7LA 2ZJ0A 3AHCA 4DNFA 3CEMA 2GVDC 1U3TA 3JAMA 2O7SA 2ZIZA 3GGGA 2UKDA 1EX6A 1SUWA 1MV5A 2QTLA 3MB5A 1RTTA 3H5VA 3KKOA 4M1KA 1O03A 4TS3A 1SCDA 4M7OA 1HTTA 4WDRA 5HF6A 4JZKA 3ZXSA 3T5MA 2IOFK 4KQXA 5CDHA 1JBEA 3U3XA 1X1TA 4M9CA 5BSFA 2WHPB 4P4SB 5ICEA 4B73A 1CE8B 1AS2A 1CY1A 4QQ8A 2PHZA 1R0ZA 3CO5A 3DE3X 3P2IA 2H9AA 3A04A 3JQBC 2HSZA 3H05A 3ABZA 3NOQA 3FKSA 3L2OB 1YA6A 2I87A 4XOIA 1VZ2A 1K7XB 2KS6A 2YWDA 3G9TA 3Q9UA 5LP6C 2QW1A 1S89A 5IC4A 3IOYA 3Q98A 5FUYA 5K0SA 1C8BA 1OI3A 2PLAA 3L4BA 1K2WA 4RVSA 4LJKA 1GNRA 2REQA 1BKDR 3AFOA 4JBHA 2ZCUA 3VAZA 1Z5PA 1RR6A 4ZYXA 4RKFA 1SBHA 1TCAA 1IUPA 3IV7A 1WU8A 4M1MA 5KC9A 1XQ6A 3VYUB 3QKUA 4KO2S 4WASA 3DSRA 3K35A 1JR3E 2RHCA 1ZI8A 4KIWA 4XQ9A 1Z8FA 3DL7A 1JVSA 1ORDA 3E7WA 1GLGA 1XZLA 2W7TA 1UKYA 3C7KA 4LQCA 2O2EA 1ZXLA 4P4NA 3SWWA 4X8OA 5D1NA 4ZQIA 2Z6VA 2ZU0C 5ITWA 3AR4A 4S1NA 1QOPB 4FCCA 4RK5A 2GEDA 2HA6A 3BYZA 4RVHA 4JDPA 4MEBA 4AN0A 5CXQA 1IAVA 4PIPA 2BRUC 4MV7A 2HLNA 2QN3A 2VNIA 3G13A 2B1GA 4EVIA 3IFSA 4YCCA 5HXAA 2HNAA 5KYWB 4P34A 4PO1A 2ON6A 2YIVX 5DIZA 4MGZR 4B75A 3GLFE 4AXXA 4C6HA 1MVNA 7MDHA 1EM8B 3JARA 4UTXA 2JLUA 4OG2A 1XZ8A 3WGYA 2C03A 4B5KA 3AVPA 3L0YA 3CEPB 2FVYA 4AJ1A 2YBVB 5DIFA 4UPEA 2JIRA 4JA0A 3EMKA 1NBHA 2X0FA 2PUTA 2RGAA 4UU7A 2QMOA 1O5IA 1WCIB 5ECDA 2Y92A 4PHCA 3GDGA 4YONB 3GJSA 4L5AA 1KQNA 2I3AA 5FDFA 1QZZA 3EIWA 4KHZA 4RZXA 4BKPA 3J81A 3H8VA 1JMKC 4L6IA 4K0KB 2C2GA 3FI0A 1UPMC 3FWNA 4UE6A 5BUZA 3IMEA 5TQJA 1UP4A 1JE0A 1TYDE 3SLGA 5JZMA 5EZYB 3D02A 4ZI3A 4H2DA 3C3JA 1JLHA 3DP9A 3ZD8A 1XMSA 3OU7A 3HRHA 1TW3A 1Y5MA 3VH4A 1MF7A 4N6NA 4TM8A 2QK4A 3WV4A 4R16A 1JB9A 5AK0A 2QUIA 2CKMA 4WXYB 5F35A 4B4WA 3DKIA 3CNEA 2J7PA 1CQIA 4U8HA 2HCJB 3KOXA 5IC5A 5KB3A 1S8FA 1USVA 3UPDA 4CM8B 1KO7A 1CQJB 2G63A 3OZAA 1CR2A 5DT2A 1SQSA 3WHKA 4NS1A 2DPHA 3PGA1 1LVGA 3OZSA 3WB0A 2BCEA 4M1WA 4MW7A 1QTRA 1QRAA 4ZYTA 1UJBA 3HJUA 1S7CA 2QNBA 3LIIA 3RQSA 4NEHB 4QO8A 4O2BB 3WY9A 5B1EA 5JS1A 3AEXA 3L8ZA 4BTLA 4MVJI 4UEQA 5LB4A 3GR6A 3UTCA 3U19A 2D5IA 1KKUA 2JRLA 5B7PA 1P3Y1 4J0GA 3JYPA 5BSMA 4P81A 4DZTA 4E5SA 4GZ5A 4UHEA 5CNJA 4A2PA 3F7NA 1V25A 2VJYA 3HDTA 4KRGA 3LFHA 2F9LA 4JQCA 5BWMA 1JFSA 2J3DA 3PC7A 4CKEB 3EMBA 4QBGB 3DO8A 3FMOB 3GRZA 3M49A 5BWLA 2TMYA 4JR2A 3VO2A 3QXSA 3FYSA 2OGUA 4LY3A 2OXIA 3ECAA 4XWOA 1GPLA 4BNFA 2R1UA 3GN1A 1QFYA 2DOKA 3CIFA 2ZIGA 1KK3A 3G3EA 1C0LA 1LF0A 3KM0A 3A1EA 4G81A 5C8DA 5JAUA 3INNA 4KN9S 4CEIA 5LZ2A 2FMTA 1X19A 3C14C 1KJYA 1V9SA 3UFXA 4X7RA 5DGTA 5I45A 3AUKA 5IJWA 4BMDA 1SOAA 3THWB 3COVA 3KEOA 1ZCZA 2YBEA 3CH4B 4IIVA 2PO5A 1WF3A 3MGCA 5C3UA 1R5OA 2QL6A 3WLSA 1GPNA 1MA0A 5K3CA 3HKEB 1E8MA 5G1NA 1HDOA 3THSA 4HNHA 2BHLA 3KZVA 1DIHA 1UMCB 1JHOA 2C4WA 1QQAA 4GP7A 4NOKA 1PZHA 1H6DA 2A9VA 1L5ZA 1UINA 1V7QA 2JFQA 2EOAA 4B2YA 3AM1A 1OLOA 5HE8A 3KAQA 3GFOA 2HLHA 7REQB 4H3KB 4UOZA 3S4YA 1SU4A 3ISVA 4JR1A 3MMPA 3JVVA 1GD1O 2D1SA 4YJHA 1LVUA 4IIJA 3BWDD 1IBRA 5EZYF 1P80A 1UBRS 3VR5H 4BC0A 2VRCA 2YHIB 3F6RA 3FPBA 2MIIA 4I9NA 4JLMA 1WU7A 4NPCA 4UVIA 2JI4A 2ZRNA 3JQ7A 4FKBA 2XNKA 4MINA 4B34A 5CT5A 1AY0A 3O3NB 3VSCA 5CCBA 4OO3A 4R8SA 4HWGA 4RF4A 5CUQA 1T0HB 1HDZA 4B6OA 1N78A 4L85A 3QMMA 2ZJOA 5EESA 5ARCA 5HCUA 1OH8A 1J8VA 3DP7A 4XFJA 4C2AA 2FQQA 2PXXA 4NZMA 2GNOA 5B58C 3QWBA 5CJPA 4PNPA 4IF6A 4LK2A 1YVPA 1X1SA 3I1IA 5C3MA 2IRWA 2WHRA 1CWUA 4O2BF 4A5OA 4G1BA 2BFCB 2E4UA 1UANA 5MDHA 1U1CA 3TQSA 1RM5A 1ZA2A 4AM8A 4CT0A 3IAUA 3MELA 3ORQA 2WFLA 3AJ9A 3O94A 4ENWA 3WWEA 2EKLA 3O0DA 4P86A 1FLAA 3TEJA 4R1OA 4FYJA 4AJ9A 1Q15A 1Q11A 1WLYA 2EYUA 3AKYA 4QXPA 4RETA 5EHZA 3IPLA 5JSUA 5K6RA 1I2BA 2RH4A 3SM3A 3AR3A 5JRJA 2FEWB 3ILYA 4RULA 3L7IA 3FFWA 1O6GA 1N1EA 2O20A 4FD3A 1JHVA 1SVOA 5CDSA 3HM2A 3FFXA 1NHWA 5EERA 4AECA 4M53A 4QULA 1HT0A 5HJEA 2Q2VA 2XF2A 3D1LA 1IWBB 4W1RA 1LRLA 4YTEA 2DPMA 4LRXA 3DOCA 1Z74A 3GARA 1VBMA 4TLLB 4X1YA 5IDWA 2R5FA 3IL2A 2F1JA 4L8YA 3CRRA 4R9SA 1OROA 4UVEA 1L4BA 2OKGA 4PY2A 2QMQA 3LO5A 2GR9A 1XEAA 2FQWA 4B6SA 4R7TA 3T15A 2J5RA 3QX8A 3Q15C 1FLVA 1FUIA 3RKRA 1MAHA 4KDCA 4N0MA 3WE7A 5C2JB 2ZPTX 1DAFA 3OWHA 1UT5A 1ZM9A 2O23A 1H2ZA 3M34A 4HZUA 4ON9A 1GNVA 4OV6B 3L7YA 4FZRA 5CVUA 3ST7A 4G1EB 4Z8XA 3N0TA 1IPEA 3ZWWA 5JO0A 6ABPA 3BPSA 2QN6A 4HDSA 3CUEF 4NCJA 3OO1A 1BGVA 4MVCA 1A50B 3P2MA 1BD4A 4DM4A 2G1AA 2IJGX 2BT4A 4UTPA 1UPAA 1JA1A 2DZDA 2FRDC 4A23A 3HJFA 4ER0A 5DV9A 2W6PA 1GG5A 3T3NA 5EP4A 3Q8LA 4DY6A 5AXCA 1ZVKA 3KUUA 4B44A 2WTXA 4OJTA 1J2TA 3IXMA 4B7CA 2EGGA 3HL4A 3UHOA 4K9KA 3WGLA 4EELA 1TMKA 4L6AA 5BV1A 3QKIA 1PD1A 1KEPA 2R6GA 4R0MA 5COQA 4XTRA 1U1GA 1B3RA 1G0NA 2JA2A 2Q1UA 2W6JA 1LEHA 3BZBA 3NJRA 4EJSA 5DSTA 2BGIA 2GRJA 2VPQA 5A9SB 1DTEA 3GLIE 5GJWC 2ZYVX 1MMFB 2RK3A 2VOEA 4XSVA 1IY2A 1ZLXA 4R8RA 4FEYA 2G83A 5DKFA 2A59A 3RNOA 5CFZA 5AM3A 3U6KA 2C5FA 4B7UA 1MEOA 4CDRA 2AJLI 1PL6A 2C3YA 1UC9A 1XU7A 3GXOA 4JY7A 4DS3A 4Y6SA 4ZI2A 1P1HA 1UAGA 1TMYA 2W2XA 5CGQB 1ZRMA 5A5EA 3NNSA 3D5TA 5BYJA 2I0FA 4GNRA 1KK1A 4C0JA 3GAZA 2YUIA 3DHVA 3ZQKA 1EX1A 2EFEB 4UBLA 1CY8A 2X8JB 2ADOA 3PHGA 3R0VA 3E9NA 3GEHA 3GUUA 4I55A 2Z9DA 4PLYA 4RANA 4U5XA 4BP1A 1IHUA 4PINA 3ML1A 4Y9UA 4AUNA 1CP2A 5K05A 3RTAA 4F8JA 3CWZA 1V16B 3EIOA 3R6WA 3EIXA 4ER3A 2HWXA 3MMNA 1N4DA 4TTIA 3UHAA 1FTGA 2OEPA 3ZWNA 2O8EB 1HT2E 3NG1A 4B85A 4HDRB 2B4AA 2BFEA 2WMOB 4MVJP 2P1RA 4AY3A 4ZZ0A 1M67A 1QFZA 4V03A 4D02A 2FZWA 1HC7A 1N9KA 4F2GA 1QYIA 3ESQA 2W6QA 4HVLA 5AJHA 2HOQA 4JL5A 4RL4A 3AVTA 3WLAA 1LQUA 4RHYA 4JL8A 4MJ3A 1YZVA 4CMEC 3H0CA 3MQFA 3Q2IA 4LNUA 3GJZA 4M0FA 2OL4A 4FBGA 4DMLA 2XRMA 1HKHA 2HO4A 3NKFA 4D9EA 4IUBS 1FEZA 4M87A 4YR7A 5BSUA 1EUZA 1JAIA 1KE2A 1YQDA 2XBLA 1ITZA 4OHYA 4Z53A 3M33A 3WHLA 2F3TA 1JEJA 4WUVA 2IV3A 1EFUA 4A91A 2QOEA 2Y4NA 4B81A 2VYFA 1TQHA 2K4MA 2BI4A 4KE6A 3U4CA 4OHRA 2VAVA 1CU1A 5TXGA 3MCTA 2IITA 2O9JA 2R6CA 4KKXB 4PLZA 3SQDA 4BNIA 2TS1A 1Z63A 1A7KA 2V74B 5HOQA 2QTVB 4MDYA 4V0MA 1AB5A 2KBFA 2H1RA 3B6ZA 4GYKA 4IMJB 1EGVB 3EVAA 2Q6LA 5K99A 3RU9A 3DPSA 4IVNA 2VEDA 1WD7A 5AO9A 5F78A 4EA6A 2P11A 3C5VA 1R15A 3GCWA 5K3BA 2IUYA 3RSZA 3PXDA 5A4DA 1T2NA 4D80A 4Z4IA 1K8QA 2WWRA 3PDIA 1MX9A 5C7OO 1JHPA 3QXHA 2BV3A 2F8MA 4BUJA 5ITVA 1RWBA 2W98A 3S2EA 4BPBA 4NZYA 3AB7A 4M6WB 4M8LA 1GPUA 3RFUA 3EQ9A 1GEGA 1JU9A 2Q50A 4KN8A 1EHCA 4RFLA 4A8PA 1Q22A 1WPRA 1MVOA 5JNUA 4KE8A 3M3DA 4RH0A 2A9QA 2X5KO 2ZQ5A 3HKDA 2DWCA 4MLDA 4OHFA 2GEKA 3WYCA 1DELA 1S8OA 2QSUA 4GGPA 1OX4A 3ACDA 4HAUA 3G0HA 3ESRA 3VNBA 5L3SB 4CKZA 4QRDA 3TQHA 4UAJA 5DN6D 1CUAA 1Q1BA 3ZHZA 1ZCJA 1GGJA 1DQYA 3KV3O 3RJTA 2DQ4A 2EARA 1BXGA 2PH3A 1NUPA 4RPCA 3RVKA 3UUWA 3FMFA 1KDOA 2B25A 5EEGA 4NEQA 1R5JA 3HS3A 1SD1A 1OJ7A 2X2EA 3OZFA 5GJVC 1XV5A 2E18A 2E21A 1MJFA 3NHUA 2WWVD 1BA2A 4F1JA 5BQFA 4NULA 4TWIA 1O94D 3U44B 5I3CA 3PPVA 1E62A 2F4VB 1B3BA 1NXQA 3INGA 4REQA 3ZX5A 1YFJA 1PFGA 2VATA 1J21A 2FMUA 3HSSA 5FNZA 2WM8A 3QENA 3HMKA 4GX0A 4QSMA 5DM0A 4CKXA 3I52A 5JEEA 2V9PA 4I6GA 1QC5B 1SHJA 3LD9A 3FTQA 4GX2A 1HTBA 3K70D 4XWKA 1Z3CA 1G38A 3OE7D 3INTA 3KPJA 3GMSA 4RYLA 3EXHC 1CF9A 1AH2A 1EK0A 3FWZA 3R0IA 3QFHA 1PX0A 3NEYA 3QUAA 1FFXB 2BOVA 3FGZA 1QV9A 2Q41A 1F2TB 2VHJA 3ABSB 1XLWA 2XCOA 4QGBA 1WP9A 3AERB 3CT6A 4GPTA 3SKVA 4KBYA 1WTCA 2HBRA 5AI8A 2X1VA 3S5JA 2VQEB 3WVNA 4B43A 3PS9A 5FOXA 2GCOA 4ALIA 1DKRA 1DT3A 1KRWA 4LF6B 1QS0B 3PFGA 3BL8A 2R4UA 1P2VA 4HKTA 4J1TC 2X7XA 2FI1A 3ZEAA 1P4GA 2I71A 3KYBA 4U1RA 4IY1A 3V4RA 1Z3IX 3KIPA 4E5VA 3C0KA 3EARA 5A9RA 1DKQA 2FHSA 3KXKA 1F2UA 1CDEA 4E5NA 1L5HB 1NJ6A 3KSUA 1FSSA 4RX1A 3E3NA 4Z4HA 1I7SB 5HRAA 4ACBA 2P4SA 3SKYA 2XYHA 3V7YA 1TGVA 1AMNA 4YK7A 1UJNA 4KYIB 4XQ0A 2XYRA 3B6EA 2D54A 3V4VB 1DOHA 2C2XA 1PYOA 3FKQA 2KB0A 2Z9BA 1T5TA 3P9PA 1PNVA 5AJWA 5SV2A 4KGXA 1FPQA 4U3JA 3ESCA 4OQMA 3DMNA 5HUQA 3ADDA 4FJ2A 4JUCA 4C04A 4TT3D 2ALJA 2MYTA 4PGHA 1ZGGA 4F0HB 5EKSA 5H7XA 3H2HA 1GZVA 3K71B 2O59A 4HTFA 3URMA 3ZGYA 1EVJA 3ITKA 1M8KA 1YQQA 5D7BA 2PEZA 2W6ID 3QU7A 2WKSA 3CW8X 2IODA 5AI4A 1B7GO 2WQZA 5KZMB 5D3MB 1UFOA 1SELA 3KTAB 5JBIA 4GI3A 2V63I 2R68A 1Q0RA 3C1TA 1O8CA 2BGMA 2G7ZA 1NMSA 3AUXA 1B0AA 4MV1A 5HOEA 3PXCX 2OCYC 4ZK2A 1RZRA 4X8MA 3W7AA 5JTUA 2VP5A 3R5SA 2D7JA 4Q00A 4Q3AA 1JSRA 2VJPA 1DWOA 3D2BA 1GU1A 1P2FA 3PI6A 3VR5D 3M4NA 4PSCA 3HR8A 5LP1A 1GUDA 2X1MA 3BCRA 4NC9A 3TFWA 3T1HB 1WMAA 2A0FA 3CXRA 3B82A 3HUEA 3UMGA 2H6EA 2V7EA 3BTVA 3DLIA 3HWRA 1CJMA 1QYXA 2GDJA 2OK7A 5HKBA 2QAJA 3KQLA 1Q1EA 1C1HA 3ER6A 2M6RA 2J4DA 1L4UA 1TYAE 5J43A 4Q4JA 4RCVA 5JD5A 5M04A 1L5VA 3WDMA 5K5EA 3VNSA 4TROA 1ND6A 2PA3A 1FTYA 4K3VA 2R3SA 1EH5A 4IDBA 4WD3A 2G28A 1A0OA 4UQOA 2C5LA 3I9V6 4E4RA 1E3IA 2HA4A 1WKCA 1C1XB 4QYXA 4KUEA 4ER7A 1UKEA 3IULA 5I7VA 3CHYA 1GNQA 4FTWA 5D5HA 2J6BA 2Q1TA 3SMVA 4G8DA 3VDRA 5C5CA 3BRWD 4MVWA 4DR3B 1NVVR 1F2VA 4OU4A 5L45A 1QMGA 1DBPA 1SAYA 2JRCA 1AK2A 4NVRA 3RK0A 4AF8A 2YWFA 1T4CB 3KHKA 2YJ3A 4DAOA 3CN9A 5B1SA 3SSNA 1TEZA 4GLFA 3AV0B 1W52X 4TL7A 3CLTC 4Q02A 4CKWB 1U9IA 5BO5A 3X1YA 1UZHC 2WE7A 3P8ZA 5FBHA 2XOKD 1KFBB 4WVLA 1UBLS 1SVLA 3RVPA 5KNBA 1XCLA 3QPUA 2C20A 3PGXA 1FOEB 1T2UA 4M9SA 2O0JA 2CNNA 2L17A 3INRA 3GHHA 2VXYA 2CBZA 1R74A 1S2LA 4TQAA 4DMCA 4L15A 2IZ7A 3T5CA 1UBNA 1YFZA 4R81A 4I46A 5P21A 3AF3A 1G42A 3LYAA 3QEOA 4NDZA 3E82A 3N2GA 1MDBA 3TTSA 1C9EA 5EKDA 4IGKA 2X0RA 4PVDA 3TD2A 2I2WA 2HJ9A 1ISPA 3HXLA 4B6FA 2C99A 5LLDA 5BSEA 3JD4A 5DBGA 1WB5A 4PFSA 5D6OA 3UV7A 3FZGA 5JCJD 1A8HA 1XVLA 3LV8A 2VDQB 4DJFC 1IATA 2AG5A 1NJFA 5FADA 1G4AE 3ICVA 3W1VA 1UXIA 1N9GB 2JGRA 3HA5A 2I9KA 3I2KA 5EIBD 1F12A 4DRYA 4JI2B 4DM3A 4WXMA 3M2PA 4FBMA 1V26A 3HMQA 5H02A 3AG6A 1X7WA 2V6FA 2VRNA 4D8WA 2R8OA 3KVNA 4G0YA 5DX1A 4BUZA 2MHCA 4UUAA 4CF6A 3AVOA 3PJGA 4D4LA 3IOEA 4CR6A 2AQKA 3ZWCA 2X19A 4YJ2A 2J45A 4TL8A 5IVIA 1E1NA 2V45A 3D6TB 4GBMA 3CBQA 4BV8A 2FDCA 1RWWA 1JXAA 2CHVA 4IG4A 2A84A 1CJSA 4RM2A 3SC2A 4LQLA 4PBTA 5TGTA 3VYWA 1JT9A 2JK1A 2GK6A 4MQ5A 1V5FA 4YJ3A 3MXTA 1C9KA 3FHOA 4QLBA 3AR5A 3L18A 2WTUA 4D9BA 1NW9B 1EX7A 1Q0HA 1E79A 1L7MA 4OFWA 2CF6A 4MI1A 5EIOA 2GEJA 2P5UA 2X2PA 3AG5A 3CJTA 3EIUA 3BICA 4OHMA 1T0BA 4TVOA 4B7XA 1Q5PA 4BEBA 4WADA 1DRVA 1TLTA 1YIDA 4L9RA 3FTCA 3FSRA 1XSEA 4TKMA 4B1FA 4EHJA 3U7GA 2V6IA 1X94A 1OPRA 5JNWA 1L7RA 4NBWA 1ZC3A 4LXXA 5LN1A 4DILA 1LU9A 1EVZA 2IPNA 3NRJA 4F3YA 1R9GA 4DPMA 1G63A 2ZPUA 5FPYA 4NJMB 5KJFA 2DWOA 4RGYA 1FDWA 4L2IB 1QIDA 1VFPA 4GL4A 5CVCA 1OBFO 1TJ3A 4L22A 5E9QA 1G6OA 2H1WA 1GVHA 5DCWA 2FMFA 1FZQA 4QNNA 1Y9ZA 4ZOAA 3TD9A 3AVXA 3MTAA 4QPPA 3X1KA 1UZDC 2XGSA 4FLEA 4TS1A 5K0NA 5TT0A 5GIOE 2G71A 2ADFA 1RCOC 3NHKA 1C7ZA 4P80A 2IZ1A 4YA6A 5B3JA 5HKKA 2IELA 5GY7A 3D1JA 3VOBA 3W5UA 1P9LA 2QZ4A 1UFKA 3CR3C 4LXHA 3ZVLA 1BXRA 1VE6A 2BFMA 1GTRA 4B3GA 3CVWA 2Q9AA 1ZD1A 1YQWA 3OCWA 4IKOA 1Q3KA 4X54A 4BO5A 3DS8A 3OJLA 3IBGA 4YALA 3WXMA 1ZR2A 4O1HA 3M9WA 1SCNE 4XA8A 3VBCA 2AOVA 2J3KA 4LV8B 1VGVA 4P2BA 3OPYB 5KMGA 1PN3A 1G3UA 3JZAA 2R1VA 2XMSA 3F96A 4Y0VA 1EHYA 1ONBA 2OCBA 2X0KA 2X4LA 3EFBA 4HRYA 4KLZA 4RPIA 4WH0A 4BVJA 4CV3A 4F1WA 3R6LA 3O3CA 4CQLA 3M9XA 4CMGA 3HPRA 4RV5A 2GILA 2ZCJA 1M2OB 3E53A 2HDOA 1YBHA 5IVDA 4M98A 4FI3F 3K16A 2AWNA 2I6GA 3ILSA 2CJPA 4CIDA 1HWYA 5ISMA 1K2VN 1Z0AA 3PDJA 1I80A 1XZNA 4PSVA 2HU5A 2XA9A 4H3VA 1ICIA 3BDIA 1XF1A 1USUA 1DBWA 2GPWA 1E6MA 1IEXA 1Z5OA 1AN9A 1W5EA 2JGFA 3PXGA 5AKEA 4QJ4A 4RVDA 1RIIA 2DSNA 2OD7A 3EDRA 5DHFA 3NX4A 3AVVA 2GPSA 3VC3A 3KJGA 1MRZA 1L7XA 2B7CA 1YZHA 4ZEWA 4JHXA 5KPDA 2DJ5A 4G86A 4LJ8A 1X7YA 3T3OA 2J67A 3FCEA 5JDCA 4FFSA 2C0QA 3C8DA 1A8SA 1I0IA 2I9PA 3KOYA 5DGDA 5FYDA 5HCIA 3ZCTA 1WCXA 1VMIA 3OX4A 1CUSA 5JS7A 4EAQA 4AROA 4PONA 4D99A 3GG2A 4GI2A 4IX1A 5D87A 5LQRA 4HPWA 4TRNA 5I3ZA 4CFSA 1O6BA 3LCRA 3OZCA 3UAWA 1BH6A 3KXPA 1HQDA 3AESB 5F73A 3A9RA 4CR7A 1NQXA 1RBQA 1FXWF 4IIXA 1REQA 2OVBA 4A16A 2LE0A 4OUKX 1P0FA 1XL1A 5BXQC 1HUQA 4KNYA 1RPJA 3MYYA 1CRQA 5HTKA 3NIDB 1BOFA 2NTVA 3BA1A 4MLPA 3ZE2B 4EKNB 2QX9A 3RR2A 2B5VA 3FR7A 1VJ5A 4FZJA 1XRMA 4LDQA 3N9IA 4BVAA 3KPYA 4CMBA 4PCUA 3WWOA 3NV9A 3K0CA 4KQFA 1G17A 4X97A 3VSDA 3NGXA 3RRXA 1ZK4A 2GBIA 1PR3A 4KFSA 4KZPA 4MI6A 5BQXA 4PAGA 5KVSA 1E2GA 3EBOA 2FH5B 5A3JA 4P9NA 3THYA 5FOUA 1JNXX 3A9SA 2WJIA 5T7BA 1PEAA 4TTSA 4PSUA 3NH9A 4KOAA 3WZ2A 5LR6A 4JP3A 4CHGA 2TMGA 2F90A 4Q7LA 2O3RA 1MG0A 1VG8A 2EKDA 4C7MA 5JVDA 1P0CA 2QVYX 1G2IA 1E6WA 2WDPA 2ZJ8A 3A3NA 1RWOA 4IKEA 4PZ9A 1Y37A 4S35A 1D1PA 1DC8A 3ZCXA 4LFBB 3ZU5A 3BREA 3X1ZA 4AG5A 4B76A 2Y1DA 1RQ7A 1PTKA 3S28A 2R1TA 4XLZA 1WUIS 3VO1A 2Z2JA 4AF6A 4OHPA 4DM7A 3LMKA 4F4FA 5AQ1A 5AW4A 3IDFA 5BVGA 4KMRA 1UDCA 2ZTSA 2WJZB 1Q77A 1KI6A 2GN4A 3F78A 5A0VA 2FFAA 3BRSA 4C3ZA 1NX9A 3FAZA 1ZOIA 3ENVA 1XRPA 5B58T 1QIIA 2B92A 1W46A 3GH1A 2NVUA 2QM3A 1Y6ZA 2I2AA 5KBYA 5EZSA 3SEZA 5IHXA 1DKNA 2C95A 2B8JA 3FVRA 3TXAA 3TXYA 5GMOA 5FWAA 1OKKA 1G9XA 2P78A 3PD1A 3F2IA 4AMZA 4EW6A 4GYJA 4X6YA 3UMSA 5LU9A 2ID9A 3VPCA 5JSZA 3ZQUA 3I04M 2OOSA 4R3NA 4I66A 4F3NA 3A9UA 2C1EA 4L27A 4CF7A 1IZ9A 3A1SA 4KXNA 3G79A 1O95D 3SLRA 3EPHA 2RGRA 3UG7A 1OFUA 2P4QA 2IP4A 2F1IA 2WSIA 2C3MA 4M1ZA 5CDGA 3R9WA 2OENG 5SY6A 1KL7A 3ZH9B 4XSGA 3OFVA 4A6PA 2FXIA 2GD0A 1ZL0A 4Y2SA 3AUYA 4E4YA 3L8FA 4I1OA 3R3WA 1X3LA 1QBGA 1R4NA 1UFQA 3D0KA 1V9LA 4NX2A 2WYIA 4UVDA 2B6HA 3RTDA 2QEQA 2IVZA 2ECPA 3GUYA 4D41A 4I5IA 3LUCA 4KLRA 4WXEA 3TAXA 4ZODA 4ZVRA 4LHYA 2WSYB 2FSPA 3LGAA 4ZYWA 3KYCA 1AUXA 3NAGA 1AV6A 2DWUA 2Q0XA 1NSYA 4BFVA 3FLAA 1DTWB 4MHTA 3B6MA 2GQ0A 3CGWA 1PK7A 3H2JA 2OAQ1 4OSOA 1PIWA 2VDWA 1JP7A 1AKWA 1IJKA 3B70A 4HATA 4B9EA 3PR1A 4Y1FA 3B5JA 1RHJA 3HCDA 2DVMA 2G6BA 2ZUUA 3LCJA 4IVQA 3H4VA 2CLKB 4AUKA 2HT6A 4EGAA 3NBYC 5EWJA 4EPYA 5HKOA 2JLYA 3B52X 3LPNA 1SCJA 3AUSA 3IMGA 3ENNA 1IN5A 2JJ1D 4C6TA 1AK9A 2B8EA 1QCYA 3I9MA 4OXYA 3ZOKA 3UY4A 5JMTA 2MSLA 4ZCIA 1VYHA 2CD9A 1IRIA 2QL9A 1H0SA 1YR2A 1NKTA 4IGIA 2FZ5A 4IIYA 4TTPA 1KFKB 3ZNPA 1CJKC 4ALNA 4ZAZA 4KP7A 2PSSA 2FWJA 2HPVA 1JEQB 3FDZA 1EZZA 1W85A 2DP4E 4LDZA 4FOOA 3QWFA 4AUMA 3S2IA 4R6XA 3P9RA 5JZOA 3VTFA 2BMDA 1N1DA 3D6UA 1DIRA 4V24A 2E87A 2YZKA 1T0JB 4ZQCB 3WWYA 5L4NA 3PWKA 1TNDA 2A7XA 3VPHA 1YOVA 2VS1A 4ENUA 5LFAA 3I72A 3IE1A 3GU3A 1Y6GA 2B1IA 1QVRA 4N76A 5E4TA 2IU3A 2QVXX 5HF9A 1Z2AA 1EFTA 1U2GC 2GN0A 4E5UA 4URFA 1FP4B 4GPIB 5EXSA 4ZTBA 4B35A 3LKBA 1PW5A 2IZZA 2JIBA 2PGAA 2R86A 4IXTA 1I9CA 3PE4A 4IEIA 3OQMA 1E5QA 1XAGA 4C4AA 1M33A 3GRCA 4LG1A 3T35A 1XTPA 4G01B 3ANYB 2NO7A 3SE0A 1A1SA 3IIKA 4EO7A 3IQHX 3W7VA 5ES3A 4ZANA 1GNSA 2GAFA 3UNXA 4OAOA 5K3OA 1WBBA 1E6LA 3S2FA 4E31A 1PQPA 3G1UA 4U2DA 5BN3B 3B3AA 1OB2A 2OCKA 2Q5HA 3CPSA 4G23A 1TU0A 1D6NA 3UXHA 2QZ9A 3GFRA 3AUUA 4D3SA 2EWVA 1OX6A 3R3VA 4NTZA 3O4GA 4G85A 1CZNA 4QPDA 5CVDA 3AHHA 4ITUA 3V34A 1TJPB 2ZAOA 1FYFA 2OBXA 1SKUA 3B2QA 4RY9A 1LLUA 1GG9A 1R8QA 2IF2A 2OCDA 4HWKA 3WGKA 5HZHA 2PEYA 4BZQA 2GF0A 4PRYA 4TWAA 4S1WA 1YQUA 3VYTB 3QKWA 4HPJB 3WMEA 4EECA 2V0CA 4YP9A 3A1NA 1D7OA 3USZA 4Z49A 1IONA 3BTOA 4MTCA 1P0PA 3Q3HA 2OCLA 3QM1A 1MD9A 4RH3A 2HSJA 1V11B 4QUKA 1C8LA 4DV3B 4HG2A 3OO0A 2WPDD 2OY0A 3RSFA 5JQGB 2W43A 4XD2A 3DDHA 3OE1A 4YMGA 4JV5B 4OIFA 1JQAA 3N58A 1UOPA 2CFSA 1H66A 3CX8A 3GZJA 1WEKA 1YASA 5AJZA 3PA6A 2P41A 3B51X 2CXQA 3PSAA 5DLQC 1JSZA 1DQZA 3LAWA 1M1XB 3KZ1E 4UARA 4WFQA 3OQNA 4DCCA 2DEUA 2J5KA 3QEKA 2YHBA 5C46F 4NDNE 2ZG6A 1FX1A 2L82A 4WOCA 3AW8A 1YL7A 4R8VA 3A6LA 2V6JA 3BMQA 4KR2A 2AG8A 2GZ1A 2VJMB 3O4HA 5BN5B 1K4MA 1AHIA 1YMQA 5KYUA 1IZ8A 1MN6A 1NBAA 1BVRA 3DQZA 1WZ2A 1EWTA 2HGSA 4FUTA 2JATA 5A6VA 3ZDRA 5ITZA 1HE4A 3K0AB 3O03A 2PCJA 2AWOA 4MWGA 1T8UA 4BQSA 3TN7A 3BXZA 2CVQA 4L0DA 3V1TC 2PKWA 3NHFA 1EMDA 2EW1A 3LPDA 2WNIA 3BXGA 4KGVA 4MS4A 2I7XA 1L8QA 2JKVA 3P1JA 4P3YA 3SOZA 2XQIA 4I5EA 1VE7A 4H7DA 1DO2A 3DZDA 3IVAA 4Q82A 3CO0S 2Q7OE 1L4LA 2JW5A 2QDXA 3CBGA 4FHZA 4HFMA 4QTXA 1YQGA 8ATCA 3DCJA 5MFZA 3GT0A 1O0CA 5B7GA 1Y4UA 3HGQA 3QBEA 3R44A 3CG4A 4L3OA 3IXQA 1UADA 2BR5A 1E2LA 6Q21A 1A95A 2LP4Y 1PLJA 4QFMA 2FVXA 2YNMA 3G2JA 5DTIA 1WPQA 3RC1A 4MKVS 1HQKA 1JQKA 3PLRA 4KQMA 1O95C 3E8SA 2TYSB 4Q37A 4WLNA 3W3ZB 1E58A 1OTYA 2YFQA 2KYRA 2ZRQA 4BFUA 4BEWA 5K01A 4YP6A 3GN2A 6YASA 1ECJA 2RGNA 3QU9A 4BB5A 2PTHA 2QDKA 3HO8A 1WZUA 2PZEA 1YUMA 3E7DA 1NFFA 1PZGA 1ZD3A 2FN8A 1OC4A 1V5GA 2XH8A 3AEKA 1HORA 3C8MA 4H7HA 4NAVA 4TVBA 3KXLA 3TBHA 4CN9A 4JYAB 2J33A 1X38A 3AB3A 3JPYA 4MZDA 3TOZA 2VF7A 3P9ZA 3FPCA 4RVFA 3QW2A 3O8LA 3CKYA 5JS8A 3GBPA 5KYYB 3O83A 1AQYA 2CY0A 4R01A 1PVVA 3TKAA 3KKNA 1ESNA 4QDOA 1N2CE 5JCOA 5A5GA 4FX2A 5KKCA 3D31A 2VTEA 4OB7A 1S1MA 5EJ2A 2RHBA 2CK3D 3WNDA 2X86A 1GGVA 3FWHA 1RRKA 3I6MA 4FGLA 4ZALA 1G59A 1T8PA 2VHYA 3P4XA 4FQ8A 4G5GA 1U1FA 2VDKB 2I8CA 2WF6A 3NP7A 1R66A 5TNXA 3ZV4A 1XYYA 5JQGF 4FYVA 1G8YA 4CEHA 1XC7A 2XMPA 4M1QA 1L8XA 3NTUA 5AOAA 3I1YA 3K5HA 4KV7A 1GY8A 1SEPA 4C76A 2QS9A 3E22B 4TL6A 5C18A 4C2BA 2IQIA 3CPEA 2WICA 3F71A 1TB4A 1JDVA 3O31A 4KO1S 1TA9A 4TZTA 4QO7A 5EUCA 1F9AA 2UVPA 3NNNA 3CLSD 3OZBA 5LUAA 1Z4LA 3GYBA 4NYIQ 3HYTA 3COSA 2CMGA 3QVUA 4UUNA 5JD6A 2SICE 1AURA 1XZPA 3SZMA 3R7WB 2ZAMA 4JJAA 3ZDFA 3F73A 2CDRA 5LZ9A 3ZHYA 1Y63A 1ECGA 1QKIA 5KNDH 3N7UA 4NNJA 4ZVSA 2ZRJA 1NL3A 1Z4PX 3FUVA 5D1HA 2AGVA 2WINI 1WXFA 3QOFA 2XQVA 2ZP1A 3B20A 1BWQA 3I6ZA 3WIBA 5A0TA 3LBAA 2GFHA 1H4SA 1FW8A 2B4RO 3ILXA 3WFZA 3I6QA 4BGIA 1LS1A 2R6AA 3FZEA 1NQWA 1RJFA 5JPDA 3HR4A 2QXTA 2CCKA 2EWMA 4BZZA 2FB9A 2M6LA 2Z6QA 2QV7A 1KYTA 1P60A 3DV2A 3OLVA 5D00A 3SX0A 4D25A 4MV3A 2PRIA 4Q9KA 1BTOA 5KVAA 2JBWA 3BMOA 4LXTA 3LF1A 3OU2A 4G4JA 4P36A 4GRAA 4KDEA 4WZBB 3OM9A 2VHEA 2Q6IA 5ALYA 3QY9A 1DUIA 4PC2A 1C7RA 1MB9A 4RS3A 5AI0A 1F60A 5KQSA 1QQBA 3I2FA 1YACA 2PIAA 3BIWA 5K4GA 1BA3A 1Y0BA 1FBNA 3KDSE 3TEFA 2DJIA 1Z7WA 2GWRA 3UT5B 5C1OA 3EJWA 2Y93A 2ZDGA 3TNJA 1SVDM 2RAFA 4D4KA 1NW7A 3CNOA 1OTXA 3CSSA 2H1HA 4URZR 3WQHA 2BKAA 2FKNA 1HE8B 1V9CA 5EL0A 1B76A 1XQXA 3PEWA 2C9YA 4JAVC 3LBIA 1O3YA 3LRXA 1SQ5A 4PZPA 4MX8A 2CLCX 5K4AA 1J99A 1EFLA 5AI6A 3W5CA 3GAAA 3TLZA 4JB0A 3KFVA 1O6ZA 2W4QA 2RKBA 1FQWA 3H1BA 5CLFA 4YDHB 3DZFA 4JNCA 3TG2A 4FYKA 4F6RA 4RLSA 4BQEA 4YMLA 4RHXA 4M76B 3GH3A 4G5RA 4EHDA 4JX9A 2O7VA 1PJSA 2R11A 3CVYA 1XDBA 2E6UX 1G8SA 3T38A 3R7SA 2FEOA 3L7NA 1KMHA 3FZQA 3G23A 4KGZA 5E4FA 1PR0A 3A9WA 4ESHA 1KEEA 2C1XA 4MVYA 5C7LO 2ZAGA 3UWOA 2C5HA 4YIHA 2Z04A 5FYQA 5JAIA 1RIFA 3FVWA 1IIRA 1P0IA 1K3TA 1QTIA 1F17A 1Z4OA 1A2BA 2YV5A 2BD0A 3H42B 3HWWA 5DTJA 2H5EA 3EE6A 3K30A 4AX8A 1PJAA 1ISIA 2GVNA 2SECE 1DFHA 4TV8A 3E1GA 3HB0A 4V0NA 5T41A 4EYSA 1AGXA 1LPBB 1QHGA 3A6JA 4X5OA 3MJVA 3FBWA 2JDID 3CA8A 1N34B 1G8JA 2GCNA 4J2TA 1LRKA 3H86A 4XLLA 3SD7A 2IYXA 4FN4A 5AW8A 2DFTA 1ZVJA 3T7KA 2JAQA 4JJ4A 4YQFA 4YDRA 1RKUA 1JHXA 2RARA 1B8OA 2JGNA 4JI0B 3KUCA 1H65A 1PUJA 1IB0A 3D3JA 3HC7A 1OX5A 1TVMA 4WY5A 4MPJA 3JARB 3L79A 3IR5A 3BGWA 3MF4A 3RIYA 1HDGO 3RBAA 1R4ZA 2V7UA 1WVGA 4V1CI 1H3NA 1KJNA 3I53A 2GJAA 5TPZA 1YR3A 2D1YA 1JQEA 2QTGA 1PG0A 3QPAA 5L3RA 3WWDA 3TUZC 1M0WA 421PA 3D81A 5ECGC 1ENZA 2PYDA 3MD0A 1RBLI 3F5QA 2IV2X 2ASVA 2P9GA 1DDOA 2WZCA 4BMSA 5HS4A 4D0SA 1X9IA 1Y4DE 2A35A 1V8PA 4Z54A 5A03A 4TRMA 1WMFA 3W8NA 4R1MA 1WDDS 1GHTA 4LWOA 2QTTA 2ZIUB 2OGZA 1E7WA 4R6WA 1N3IA 2PD6A 4LE1A 1YR7A 3B9PA 2P62A 3OIGA 1JFFA 3TGWA 1QZXA 3ZBQA 1RM4A 4EUSA 1PR9A 1HOTA 1X39A 2FN3A 3RJZA 3FLEA 1ISMA 4HQOA 1SRQA 3U3DA 1ECPA 4PS0A 4BVFA 4LY0A 4EYQA 2H5IA 1E5LA 1CQIB 4GBGA 5I9SA 2CL7X 1VJGA 3O8BA 4DABA 1E3WA 2O54A 2MYPA 3Q7RA 1NKSA 3FWYA 4JN6B 3DXXA 3EQ6A 3HKCB 4JUIA 4NFYA 4V0SA 1OH6A 5KCZA 2BFAA 4QQFA 3Q1LA 5PGMA 4DNPA 4EI2A 5ALFA 1V39A 5FCDA 3TAHA 5TQ0A 4F5ZA 5L7TA 2BSXA 4ZVPA 4HF7A 4YDQA 4IGEA 2G0AA 2BZ1A 2I4OA 3QVSA 1MHPA 4ZAXA 5DOVA 2B8TA 2FQ1A 3PEUA 2V7BA 1DHRA 3IOMA 1TUBB 4JBLA 4LCEA 1H5QA 1TEVA 2CDBA 3KUXA 3QH4A 4K46A 3DONA 1FS5A 4LXUA 3RG2A 5ALDA 3D4OA 4Q9HA 4XYGA 4DUGD 4MYCA 1OFHA 1JIVA 1MVLA 3H1AA 3PQ8A 4OHUA 5A4MS 3QXJA 4ZCTA 4H08A 1D4AA 1GNPA 2QWXA 4JWKA 4D3DA 2DR2A 4Y7CA 1J8YF 3LE8A 4D96A 2FZEA 4S1OA 2GJ4A 4RUKA 4YREA 2Z30A 3CLSC 2Y71A 4F96A 4G1FA 5JD4A 3VH3A 1SXPA 1FP2A 4BX0A 4CEIB 4QELA 3RT1A 5ABPA 4LQ4A 3ENWA 2FZ4A 4YJFA 2C8VA 4BQNA 2PZLA 3O9ZA 2HDHA 4ND6A 1WNFA 1X6VA 3UFXB 3G82C 2FEKA 1GDTA 1WSBA 1NG1A 4R2MA 4C29A 1FTQA 2IA5A 3IDZA 2V0GA 4TLAA 4IS2A 5BR4A 3GJ5A 4BB6A 2GCGA 4QUJA 1RLOA 3EMVA 4KIJA 3GJ8A 3Q9NA 4MQMA 1JTFA 3JX9A 3V2UA 5I48A 3AT1A 3JQDA 4F2PA 4KFRA 4PAOA 1OA0A 3OPMA 1N3BA 1XMVA 2Q4BA 4X62B 2EW2A 1N6LA 2HTEA 2WG1A 1IJEA 3KPVA 3IKJA 4XFKA 4KHPB 1TIBA 1OH7A 1RAEA 2HRZA 3A6DA 1Z6GA 5IH3A 1L5YA 2Z5GA 3D0OA 2X0EA 5ALMA 3H0KA 3V1LA 4YJHB 3WMXA 1SD5A 3GQBB 4IIJB 1H22A 4Z99A 2VHWA 1DI0A 1M2EA 5AM2A 4H3HB 1T6YA 1U3GA 4HFJA 2JAHA 1PS8A 3PSHA 1MB2A 5EVJA 1PGPA 4HNTA 3JQ7B 3OT1B 3R7AA 4J1NA 1DV2A 3P9KA 3WJ1A 2HI0A 1MOSA 1FDUA 1Z4QA 3ZWKA 5MFPA 1U80A 2E9SA 3GJYA 4WLUA 1TK2A 2RGYA 3FW1A 4RLQA 5A7GA 3HVRA 2RHHA 5KNCD 5EE5B 4RK1A 3O1LA 3SSAA 3QE9Y 4L3WA 3UN1A 5A3RA 2BKUA 3LNCA 4MGIR 2F6RA 2J5XA 2ZJBA 4MXDA 3MTGA 5B2EA 3I5XA 4EPWA 3KG2A 4FNAA 4ML3A 2GAOA 4M9RA 3G5TA 4NJEA 3ZK7A 4E1VA 3DKPA 1EE2A 1WX1A 3VR6H 3DZ8A 4ZICA 2UUAB 1D1TA 2AC7A 2BFDA 3T5PA 4A8JA 2NXJA 1I5EA 1EFRD 3M1IA 5AI5A 2VJQA 2WFLB 5FA6A 1L5LA 3QITA 1QTNA 2FU5C 1W19A 2XE7A 3T9BA 4ZZ3A 2AZ4A 5EP2A 3HL0A 4EA8A 5CDFE 4ZZIA 4DLAA 4FDAA 2YCBA 2IHZA 3OF2A 3AL3A 1E7MA 3PNPA 1G5HA 1EJBA 2NQ2C 1P1CA 2PH7A 1LX7A 1GXSA 2R7KA 3DR3A 2C9CA 1EHIA 1U0SY 3K5PA 4YQYA 3RU7A 3UJ3X 2X4IA 1LJLA 2H07A 2Y1LA 1PAUA 2GAJA 4C4PA 3G5MA 1OH5A 3YASA 5EE3A 1C3EA 2BJHA 5BMOA 2YIMA 4K86A 1EQUA 1BRTA 1LBTA 4DIUA 1U7DA 3WI7A 4XUGB 4L7QA 4MB2A 3UMJA 5CFQA 2X6RA 4X1YB 3UF0A 5KWIA 4FYPA 4NCBA 2BH2A 3MTDA 5DEOA 1R7RA 1NM5C 2H2WA 2NLOA 3VNAA 4GSYA 1VIAA 1L4KA 4OGKA 5AHOA 6PFKA 1W9MA 2AYYA 4C14A 4JVSB 1GGKA 3HWSA 4ZT2A 3T5BA 1BWVS 1IWPB 2WMDA 3UW1A 4URVR 1AB6A 5DF1A 1VG9B 4QAJA 2LKCA 2L2QA 4OD0A 3ZZ1A 1CLUA 1G5FA 2B69A 4Q7QA 1JG4A 1PFQA 2PXCA 2PZBA 2DMRA 5EIWA 3Q6IA 5CIQA 3SSOA 2PE5A 1NUQA 3SE7A 3F9RA 1T1SA 4IIJF 1H2BA 1JWAB 5IHPA 1E9RA 2HH9A 3N86A 5DXFA 2REOA 2Z4SA 3DE1X 3E15A 4MSUA 5F76A 5DNYB 4HDSB 5JAQA 1T3HA 3AOGA 2V68I 3F4KA 1ADFA 3TBFA 4ED9A 1Q57A 4U8GA 2OCIA 4UNNA 5F51A 1RLTA 1L8AA 5CLQA 2FR1A 4GWLA 2D00A 1HM5A 5B4UA 1RWMA 1DT5A 1E63A 3GUHA 4ZO6A 4DJTA 2JLZA 3KB8A 5J5VA 1FCJA 1YE8A 1A9RA 4XVHA 4OGWA 5AW2A 1D2HA 3M4JA 4E33A 3HM9A 1TEXA 2QUHA 4EJSB 4QKQA 3UB4A 3H83A 2CLLB 3U81A 3PIRA 1X1AA 3HBFA 3A6KA 4O1IA 2FLKA 1PJZA 1ESZA 2M6KA 2G9NA 4KR9A 4GP6A 4LNHA 4MP6A 3PUYA 3DL4A 4BMOB 1IPHA 4NZ9A 2AZMA 5F3RA 5KNDD 1J5EB 5FWNA 1RJWA 1F0NA 1NGSA 4Q5IA 7MHTA 1NVEA 3B3GA 1SC3A 4DLBA 3LC2O 1GQFA 4JT8A 2RKOA 5AVSA 4LGMA 5HPYB 1WUYA 4Q4AA 4F91B 4IO0A 2A9JA 3R1IA 4QQKA 4OQFA 4C3UA 4N18A 3HRKA 1L9XA 2VKTA 1EVIA 3TOCA 2UZ1A 1EFDN 5I51A 2V1XA 1Y3FE 1LB1B 4JHLA 2J8ZA 1BW9A 5KAMA 4QXQA 3IUPA 1IM5A 2WVHA 2F1KA 3AY3A 4I55B 4N41A 1BDMA 3S2GA 2GK7A 4NESA 1E2EA 4AZWA 4F4IA 2GXQA 3EQ2A 4PANA 2FFHA 1VL6A 3LFUA 5HDQA 5LDGA 3I9NA 3MLBA 3RT9A 3NHSA 3P2YA 4JROA 4ARBA 4URXR 4X6LA 1YU9A 1IY9A 1X2EA 4EH1A 4EMBA 3MOSA 4U7FA 3L6BA 2CNWD 2Q99A 1CRPA 3NBZC 1EVQA 2AD5A 2BFEB 4LECA 1KOJA 2JEOA 1OGJA 3EOZA 3IX7A 3R0JA 4GOLD 3Q7QA 4MUKA 1QH1B 3ETNA 4IILA 1NY5A 2KX7A 2YXLA 2PMEA 3E1KA 1UEXC 2GPTA 4ZEVA 1L5RA 5ALZA 3RJ9A 5JC1A 1DIGA 4CLRA 1PTJC 2XNDD 3GJXC 4BBZA 2WI8A 4LNUB 2OA0A 4LZWA 1DAIA 3TQQA 4B2LA 5IXJA 1KAOA 4G0UA 5BRAA 5TJHA 1PT6A 2UUOA 5DN9A 1GAXA 2IE0A 1FNDA 4DMUB 3HHPA 3VPGA 5T6BA 1T3ZA 4UUMA 1J2YA 1U0HC 3G8CA 5JECA 2G04A 1DXYA 2GLXA 1GQQA 1S02A 3B36A 1HG0A 3ZU2A 4A82A 4OLAA 2ZRLA 3GRPA 4M22A 1FK8A 5EZQA 4M46A 1KI7A 4A6DA 1F6DA 1HDCA 1NX6A 1OT3A 1V3UA 2NSLA 5E8RA 2N47A 1E6CA 1NNUA 3DF7A 3MW8A 4K9QA 1USKA 5AK4A 1RXOC 5SZJA 4DCNA 4OK3A 1RW4A 1X92A 3T54A 4S24A 1QFXA 3NIWA 4YRTA 3ZLTA 5I7WA 5IZ4A 4OYHA 1H42A 3C3XA 4N54A 4CUKA 1SUFA 4UNRA 4TXLA 1Q7BA 4FWTA 4GKKB 4ETMA 3AO0B 1OWMA 2AD1A 3AC0A 3V7FA 4RIEA 3CFYA 1P7YA 5AKLA 3PDIB 1G8AA 1WCV1 3JQ6A 1UDWA 3GHYA 4LDAA 4PC7A 2NZJA 4ZPJA 4IDGA 3AVYA 2FSVA 3KS9A 2CFCA 1NBME 1QR2A 3JYQA 4J7AA 4OJQA 3VQTA 5JPCA 4IH1A 4E46A 1YZUA 1A9XB 4TMTA 4GLJA 5KOYA 3LP5A 3MQ4A 1T5BA 4MCJA 1T2DA 3M5WA 1QLWA 3H2YA 5DULA 3OIVA 4I55F 3HKDB 1U8CB 2OC9A 2Z43A 3UK7A 3U09A 1OX4B 5ECWA 4WK2B 4I4CA 4EY7A 3AR8A 3GPDG 1O8BA 2OE2A 2FLWA 4FGKA 2QTWB 2C9DA 3FYHA 3NBUA 5SYMA 2BFWA 1RYBA 3VI4B 1R6XA 2NACA 2NP6A 1RQGA 2K7ZA 1EEHA 2V6GA 4FHEA 5AD1A 4OA5A 1RLDS 1WSAA 3IC5A 3K8ZA 4I50A 4W1SA 2GZ3A 4J7CA 3ZPXA 4ZEMA 2P3OA 4GVXA 1UKVY 1EXMA 1U2SA 1Z4MA 4P8RA 1ST3A 3ZBTA 1J0CA 2GSDA 4OQZA 3X1JA 4BFZA 1PJCA 3I83A 3M4XA 1LLDA 3AVUA 5G1OA 1P5JA 4DUPA 1JSLA 3E1SA 2PN1A 4J43A 4O4HA 2IXAA 5HP4A 1ATIA 2TMDA 2BISA 2XGOA 1QRRA 2EZ4A 3BWEA 2ZUEA 4BX9A 1L1EA 5BVGB 3F5SA 6REQB 2P9EA 5AKYA 4K6KA 3X0DA 2O2JA 3TFOA 1DBQA 3GVIA 4M83A 4D57A 1P4JA 2AJTA 4KVZA 1WR8A 1XCJA 1C8KA 3LXXA 4FS3A 4GUDA 3S0JA 2XE6A 3IQEA 2ZR8A 2C7GA 2XEDA 4MUIA 4IWNA 1I4TD 3DMDA 3N59A 3U16A 1ORRA 1RBYA 2ERXA 1S8AA 2HLDA 2P9QA 4OP2A 4U5QA 4EG5A 4XCVA 1XTQA 1GPYA 3C41J 2GUWA 2GCOB 2G67A 4HVTA 4JXKA 4PR0A 4G0VA 2D13A 4MMZB 4O2RA 1IXKA 1VRCA 2VXCA 3ND8A 1UKBA 3SF8A 4BNJA 5FX2A 1JJAA 2PUDA 5ALSA 4MRAA 1GCGA 5L6LB 3QNMA 3FNRA 3MNFA 5CXXA 2GDZA 3V2IA 3GVXA 2P6OA 3G6WA 1G16A 3A37A 1RQXA 2YMQA 1QTQA 4P4UA 2Q3DA 3KB1A 2VYVD 4W63A 1E2FA 3NHYA 2PX0A 3VYVA 3VH1A 2W0SA 5BQ5A 1SCKA 3TZKA 3BULA 4MVJA 2CV0A 1ILWA 2B4TO 5EXXA 2AEMA 4U3JB 2M1XA 2QI9C 2XAAA 2XUAA 3AU9A 4HFRA 1RAIA 3SC4A 3EHDA 3KEGA 2C9ZA 2IUFA 1IUOA 3NEJA 1FLDA 2PS1A 3Q2KA 3TS1A 3VSBA 4WN3A 4DEVA 1JS1X 2JL1A 1YJXA 4FT2A 3P4UA 1T5LA 4HTFB 5DHUA 4ARSA 3TX6A 4GKJB 3W8EA 3EAGA 1WKVA 2E85A 2NQTA 1WW2A 1NBWB 4P3KA 2BZGA 2GX6A 2XMGA 4FJ1A 1U28C 3EGXB 4J3FA 3FZYA 3WB2A 1QGYA 2B94A 5TQ2A 1PNOA 3QF7A 2J9ZB 4ALKA 4J90A 4WJLA 1KO4A 2QLNA 4A0SA 1AUSS 2FGJA 4DEXA 3DF9A 5BR7A 3FYCA 2JD0A 4EY6A 4Q9AA 4H17A 2LV8A 3WKEA 4EUNA 2GRAA 5JATA 2ZYWX 2YTZA 4FYXA 4HQFA 2G82A 2AZDA 5FUQA 3FMIA 2YFHA 2YN2A 1TOAA 3A14A 3SHQA 2OLKA 3JWHA 1YL5A 2IEIA 4D8YA 1FTWA 3I2HA 3TTVA 2WJAA 1IH8A 1OXUA 1VHWA 3HP1A 5HKLA 3T7TA 3FZNA 4Q4JB 4FWIB 5FBKA 1UUFA 4K9MA 1YBMA 3PNLA 2QLBA 3PE3A 4PN7A 3ESXA 5LD2B 3L5KA 3VR6D 4ZV7A 5AHKA 3EZ6A 1RM0A 1QNLA 4BL5A 3MT0A 5AXBA 2C84A 3O21A 2NTYC 2WR8A 2V5UA 2LKDA 2AHRA 3EZGA 3H1PA 4NLLA 4RCYA 1E94E 3ROMA 3CX7A 5ILQA 1JFLA 3B48A 4DFDA 4TKZA 2BKXA 3RVBA 2HCRA 1QCZA 3QK7A 3OLQA 3KQKA 4FFNA 1LV8A 4PNEA 2H8KA 1TFUA 2I4IA 1L7BA 2V65A 3BKXA 3RUDA 4AN1A 3I9OA 1LDNA 3KZOA 2JC3A 5FOSA 1O9HA 3KT8A 2TRSB 3M0EA 1W36B 3U7RA 1GLNA 3FFTA 4IWXA 2EJBA 4YT4A 1WUHS 5EGSA 3NU1A 3MWDA 4UASA 1JFRA 2G72A 2G8NA 4O33A 1HY3A 1OT5A 5F2NA 1OTHA 1ZVQA 3JWEA 4LGCA 2I2BA 3GZTB 5BWBA 2HSEA 1N6OA 5K0CA 1CQWA 4P4LA 3UIEA 5JJIA 4OQPA 2CFIA 2PMDA 4JKOA 4NBNA 4RDIA 3RHFA 1U3WA 3LZDA 4HNQA 5JE8A 2QJWA 2HBZA 1CY0A 3A11A 2WV9A 4ENQA 3M5DA 5AKXA 1IXYA 4FD2A 1H5UA 2C2HA 3IESA 5TV2A 3IJEB 3LUHA 2GH1A 2PX8A 1T1EA 2ZVJA 5IJAA 3QKSA 1JEYA 3DDCA 3PC6A 4ZYVA 1NBMD 4WT7A 2HPHA 3WDKA 4OU5A 3C3PA 1XKTA 4DV6B 1AQUA 1MENA 2ADMA 5JAOA 4JXXA 1TT5A 4ZAWA 1MNAA 2OV8A 1PRYA 2GF9A 4GPBA 1KVUA 2HWUA 1QYVA 1YSCA 2Z5VA 3PYXA 2SBTA 2BMWA 2CFOA 4XWTA 1KWGA 3PKIA 4OBEA 2O6LA 1COWA 2HK9A 2CZGA 1C9DB 1NP7A 5LQUA 1DG1G 3OSUA 2C4TA 3EOBI 3HU2A 1Y8CA 1C0EA 3TEMA 2GJ8A 5ERXA 4B4OA 1TMGE 4EG4A 1GZHB 4N3AA 3E61A 4NCHA 3OLCX 4H0FA 4QU5A 5THXA 4BCCA 1U02A 4LRWA 1X74A 1TA0A 1OIVA 3DMGA 2C7RA 1NMEA 1BC5A 2GEBA 3BFKA 1WLSA 1QVZA 3PHCA 3AHGA 2KLBA 2VFAA 1YK1A 4GW3A 1L7PA 2L42A 3QLVC 1JJBA 2R4QA 3FPHA 2DH5A 4OLHA 3SC2B 4C1NA 4YCSA 5C7YA 2ZYHA 3IO3A 3TW8A 3VOTA 1SUSA 1E1CA 5A4KA 2ZVPX 3L02A 3QUSA 4JSYA 4CM4A 1L1RA 3E9DA 1RXEA 1RDFA 2ZSEA 4OQXA 4YUXA 3IGFA 5T67A 1ZJ4A 2A9FA 1IXZA 4RL6A 5IAOA 1TIPA 2FFRA 4OP1A 4D4HA 2GD2A 3RUBS 2P65A 5EPOA 4CQJA 1J70A 4O5OA 2YJ5A 4Z5XA 1I10A 2HJGA 3GRFA 3EG9A 4BFWA 1KO1A 1J1IA 3U13A 3QU4A 2H52A 2XWQA 2GBLC 4Y2QA 1G8MA 2QSYA 4OJNA 2FQXA 5FPKA 3CG0A 5L95A 1ZOLA 2Q4DA 2QVZX 2V6MA 5GWXA 1Q7GA 4RTOA 2DBYA 3E7XA 3MJDA 5ALKA 3ESDA 1EK2A 2FPWA 1KVSA 4PLTA 1ZJYA 4P7JA 1XQVA 4RBNA 4BNHA 2Q4OA 1V71A 3HKBA 4JFAA 5HFNA 4B3MB 1S9DA 2JZNA 3PRKE 1W25A 2G4CA 2WKRA 4QHSA 4UAUA 3RV3A 2P9JA 5F33A 3SHVA 3V2GA 5IF9A 3ABRB 2VCEA 2JJMA 3F1LA 3LUAA 4IJ6A 3U7HB 1JALA 1G64A 1ZM4A 4GH5A 2QD3A 2ZRIA 1E4VA 3AEZA 3GB9A 5K8JB 2OG1A 5HIJA 1PHRA 1J9ZA 3DAYA 2PKRA 4HLNA 4R4JA 3RYTC 4GOND 3W8DA 2BFFA 3D3WA 4BWYA 2GM9A 1EAMA 3L07A 4WXHA 1BXRB 3NWJA 4MV9A 4OUDB 4U9UA 4XM2A 3UQZA 4B6JA 5H3HA 3ITEA 4RTLA 4W9NC 2C54A 2P68A 1DKUA 1D07A 1HLPA 1X13A 2HCFA 3FSEA 4PNZA 2PX6A 1DX9A 2N42A 3UJBA 5KMGB 3OX3A 2R1VB 4RWEA 3SXJA 1LBHA 4XDGA 2V54A 3IAM1 1A9TA 1T2FA 1TLLA 4GPD1 1U0NA 3L4KA 2VDMB 4F7WA 1O2DA 1ZOSA 4FDTA 1OFUX 4HQ6A 2ZATA 4RQTA 4CQLB 2IBSA 3OTQA 1VGQA 1LV7A 2E5WA 5CYFA 1QM5A 1WABA 2ZSDA 3MHPA 4Z7QB 2PQ2A 4ETNA 1OZAA 4UXHA 1E2BA 1LDEA 4KJZA 3N70A 3CTPA 4U0KA 4JBXA 1Y33E 4MKIA 1A5BB 3I61A 1C0PA 1XIVA 2NXCA 3K7EA 4IRMA 1SC4A 4D4MA 1YDMA 4B3RB 1C7EA 1OYWA 4MQ4A 1VCHA 4AZVA 4J03A 1XPRA 1XTJA 3L5OA 2W90A 1SBZA 1MAUA 3EZ9A 4PGMA 5EEHA 4AL4A 4TXHA 3AI7A 3JYLA 3X2SA 1PZMA 3OJCA 1QAOA 1AKTA 4QD3A 2VBFA 4MIOA 3RLIA 2MOKA 4TKVA 2VNJA 3JALA 3WYBA 4UHHA 5C8VA 3C7DB 2IF0A 2PU7A 2X22A 4AX4A 4J0FA 3LCVB 3W5HA 5JYDA 4YS6A 5IAGA 1QSGA 2AA3A 3LPCA 1RAHA 3QELA 4G25A 3HXQA 1DC7A 1G8KA 4HX9A 4AFNA 3QG5A 1SVUA 2GEVA 1MR3F 2HA5A 4Q93A 3JQ9A 4NWIA 4WOBA 1ZU5A 3E3OA 3SS8A 3EX7C 1F4LA 4I9FA 2PNJA 4DN6A 1R88A 4DBVO 1C9YA 3ZH2A 3REGA 5A5VA 5BV8A 4QTZA 4QUHA 5EXTA 5BYAA 4A92A 4KLCA 3EWIA 3AVWA 1ESCA 1H8HD 3MJRA 1X7XA 4BZXA 3ESZA 1SCQA 2H57A 1U94A 3KR0A 4BC1A 1QGUA 1TCBA 5HFAA 1C1DA 1QWSA 3RF7A 3C5EA 2V3WA 5DCUA 1XP8A 2H29A 2PZFA 3QV1A 5DHSA 3IEXA 3H04A 2FZVA 3PGMA 3THYB 4Q47A 3IHLA 2ZE6A 2H1LA 3CCCA 2I4LA 3DHNA 3RO7A 5B6PA 3NALA 4ZT4A 1GT91 1KYQA 1SC9A 2E1RA 2P9CA 2RGGA 2YFYA 3H9CA 2R8YA 1P9RA 2FW9A 1IZ0A 2O8CA 2L69A 4MWEA 3UG6A 3O1HB 1O1YA 5HMLA 2O2YA 5H16A 4HUQA 5F12A 4BCBA 4LDJA 2C42A 4LZAA 1BHO1 4FFRA 1BCRB 1Z0IA 3AJDA 1HE3A 3K9QO 5CNKA 1O97C 2R1TB 3ZXUB 2X9NA 4C0LA 3MWLA 1E2MA 2O8NA 2XTNA 4I2NA 4G4SO 1BWRA 3L3BA 5KQMA 3WGZA 1KI6B 2HY7A 4EGFA 1TADA 1CR0A 1NNLA 1NWCA 3OIUA 3UYKA 1KIFA 1WUJS 3V32A 3CYFA 2YC4C 1BDHA 4B40A 3BSYA 3ADCA 4WZBE 2NVUB 1K6MA 1DWUA 3DVAB 3IUJA 2XXAB 5BSKA 2LXNA 1JR4A 1Z8DA 5U4QA 3ZHVA 4N6OA 2SCUA 2Z2ZA 4I1RA 5EP1A 5K6AA 1AQNA 3HTXA 1SU6A 3DWGA 1QX4A 1PJBA 4RAOA 3IHWA 2PT9A 4U02A 1PV2A 3WGTA 5AIAA 4FQ7A 1E1QA 4LCBA 3HNOA 3AEUA 4RABA 3IVRA 5JSZB 3PR2B 3OIWA 1E3LA 4HAZA 1AKRA 3NI2A 2ECQA 1IOWA 3L06A 2I3DA 3PUXA 1ZUD1 5HK8A 2V97A 5BRJA 3WAJA 1AGNA 1T36A 1EJ7S 4QM6A 4DBLE 4X1KA 1KXZA 3AP2A 3MPUA 3O26A 3C4JA 3IAAA 3UXEA 5AIBA 5KDOA 3HXKA 4OJKA 4XX1A 2C7BA 4JQOA 1K0UA 2Z09A 1R18A 2XUIA 2BZSA 2WC1A 2DFNA 4N3NA 5L4LA 2VP6A 3O82A 3G89A 5IT9A 1H1LA 2XITA 4NYIR 2AG1A 3F9CA 3SYLA 4AT1A 1BVHA 3TZEA 2ZYIA 2PZJA 3ESYA 3SP1A 1R4NB 2JFPA 3H5OA 4EVQA 3AMVA 3AY0A 3TIIA 3U7JA 1RBZA 2PWAA 4ARZA 3VPDA 2WTMA 1KJWA 1P61B 3BJMA 4UULA 2SKEA 4WNIA 4RZIA 1ECFA 1C50A 2GYYA 3Q87B 4D6PA 2RCYA 1BFUA 2X4DA 2V55B 5HHTA 1P4HA 2VHVA 1ISHA 2O2XA 2P6NA 1NLMA 2QTBA 4ZT6A 1RHKA 3F97A 3RRMA 2WAYA 3LVFO 1RI2A 1U7ZA 1X15A 3LQFA 4GX5A 5B1IA 5EINA 4F84A 2VDWB 1B2RA 1QIKA 1VPEA 3TOVA 3R5TA 1RJDA 1DB3A 4LE0A 2D2VA 3RYIA 1SBCA 1U9ZA 2HRRA 5EWJB 1CNFA 1L4GA 3DFIA 3O47A 3OQHA 1UMDA 2J1LA 1Y89A 2HUPA 1KQFA 2QTRA 1Z2OX 4GF5A 4EQ6B 1XTUA 4C6TB 5KTRA 2DHQA 3RWOA 1RJ9A 4BVKA 4CGZA 4HN9A 1DGQA 2I76A 3T94A 1ZP6A 2EBHX 1F38A 4K6GA 4AO7A 1ZYUA 2Z58A 4HADA 2IXDA 5DU2A 3RAPR 3PPIA 3GMTA 1V1RA 5E1BA 2VP4A 3OEED 5L7YA 1W4RA 2G0TA 3FDZB 1R0WA 2B9EA 1W85B 2F3UA 3D0QA 4BFSA 5JBNA 1FP1D 4HDNA 1XGKA 2JFFA 3R5HA 3FJ1A 2ZIXA 3JW8A 2VUSA 2B34A 1H2AS 1P6QA 3IP7A 4ES6A 5CH3A 3E81A 3GUCA 5KYTA 5KYVA 2GUGA 3WJAA 4D9MA 3QYJA 4FZ3A 4L5CA 3K4PA 3T7RA 3SIXA 4WBNA 3FNFA 4CT5A 1SCIA 4MULA 1RYYA 4AY4A 2ZRMA 2JFXA 4RTSA 2EBFX 1J2RA 3U7EB 3C85A 2XI4A 4ZAVA 1MO4A 2P1ZA 3BK1A 2OLEA 3NHZA 5EGNA 4ZTUB 2VG8A 2GB4A 2RK6A 3RK4A 1DBSA 2O3JA 1KI3A 1ND5A 3LBHA 3SQOA 4CKBB 3CCFA 4H0NA 4J0DA 1IHPA 2E4WA 3K2EA 3PUIA 3NORA 4WCFA 1AGPA 5REQA 1E3TA 4PF1A 3KCQA 2YKGA 2PLNA 2WVAA 3IPRA 4W8GA 1HOXA 3NRBA 3EXFA 5BOVA 1B6GA 1XMPA 2QL5A 1BS2A 4HSGA 4GFDA 1FYXA 1JLLA 4K81B 4QODA 3DLHA 2PV0A 3AIOA 2FEPA 4JBGA 4LJYA 2A9OA 4JLAA 1U2DC 1I32A 1NZFA 2FRXA 4MDHA 1A8QA 3ROEA 1N2HA 1XROA 4QATA 5UKDA 3ZUPA 2RH5A 1LGYA 4Q7KA 3OE5A 1P2TA 3IEIA 1ESEA 1LI5A 1RC8A 1KGDA 4DLUA 4YP0A 1QPBA 3B5IA 1RXCA 5CLLA 5AJUA 4PZDA 5FORA 1RHQA 5KTPA 4CR8A 5AR1A 1XB2A 2VJDA 2BDEA 5CRIA 3Q3IA 1NDHA 5J2UA 5CYOA 5KTYA 3ELYA 2Y2VA 2MSWA 2OBFA 3OEHD 1K1EA 2QV0A 5T4BA 2W2LA 3BSSA 1G6KA 1Z4KA 4O5AA 4QTUB 3L84A 2PKEA 1G4UR 2W8BA 5AH0A 4Y2JA 1FDRA 1JJFA 4MI3A 3DBOB 4ZTZB 3HLTA 2NU7A 2YOGA 1E2DA 2Q2NA 4R3UC 5AJVB 4JEUA 9LDTA 2Q6OA 2PUWA 3S81A 1EUDA 3HVHA 2XRZA 1ES9A 3BCSA 3GFTA 4P98A 3IR7A 5CA0A 2DBVO 4P84A 3C6QA 3KR1A 2RHOA 5GVRA 2FWNA 1Z0JA 4JEIA 3EVDA 4Z9XA 5IEBA 4RGBA 1N4AA 1XLTA 3WNZA 5C37A 3BMQB 4EGCB 4C7OA 1MJHA 1H6BA 2F3RA 3HVJA 3HCRA 5KYUB 3R7NA 2O0MA 1LPAB 3Q0IA 4J7XA 2WYOA 5LMNB 3GG9A 3IYLW 5SY4A 1ZLYA 3LYHA 1II9A 3MJTA 3K0BA 1I4WA 3MJSA 5ITZB 4QGAA 1HPLA 3L8DA 1Y98A 4BMYA 1XU4A 4D9FA 4ZDIA 5JZVA 1I3LA 2EFYA 2VPWA 2FSUA 2BTEA 2A0WA 1ZHOA 2Q29A 3PKJA 3PKZA 4M0MA 4YPFA 1ZEMA 5F1YA 1JYFA 1TPYA 2O2ZA 2W2KA 3D4NA 4H31A 4JDUA 3HB5X 4LW8A 3V4PB 2O7NA 4PXYA 2NSDA 1TC1A 3WZMA 3JZMA 3BD6A 2DT8A 3OEWA 4A0GA 3FPGA 2H0RA 2NO9A 4JT9A 4BKUA 1PDWA 4AKSA 2WF5A 1UBHS 4FLMA 3T1QA 4S05A 1XYGA 2M9MA 3DHWC 1T5HX 2FSSA 4KVFA 4LPKA 1VKRA 1EUCA 1SCUA 2FCRA 4QGHA 1S9HA 5C8XA 2DM6A 1G19A 3ZK9A 4CTKA 3NUQA 2OUIA 1TYBE 3BXHA 3NC1C 1V47A 2BBWA 3EVCA 1H5NA 2Z2XA 3VH2A 2J46A 3AEKB 2IPOA 2AVDA 2MCFA 2BGJA 4IOLA 2YJNA 4RDXA 1KSHA 1JX6A 2IFTA 3ZE1B 3R9XA 1TI7A 4J4BA 1HLFA 4OBWA 2A7QA 1M75A 3PCRB 1SNYA 5ADWA 3EZNA 1X87A 4LGYA 3TRIA 3CWCA 4MIYA 4BV3A 3B60A 3PD0A 5EUMA 3MTIA 5LQCA 1UW9C 1AK1A 3O2QB 4KPUA 4S1PA 4DYVA 3SHFA 1YS7A 4QICA 3C6KA 4L4UA 1F51E 1T1GA 4LMPA 1J49A 1QFMA 3H9BA 3CF2A 3A25A 3OQIA 4WZ6A 2IS4A 4CCWA 1N7GA 3FHLA 1E9BA 1NXPA 3QP9A 1S01A 4D8XA 3HRIA 3RYFA 1NYQA 4ITVA 2SHKA 3DDSA 1NVTA 4TN5A 2NUAA 5F21A 4TKLA 4DZZA 1BE0A 2WWTA 4C89A 1EZ4A 4XLTA 2C61A 4KN6A 1OI7A 2B30A 1TM3E 4YEDA 1S4QA 2H9YA 2VQFB 3E5MA 4N5DA 4Q4HA 1TQDA 1UT6A 1TQ2A 3B1YA 4FR0A 4KTTE 4W5JA 1HH4A 1CP3A 2H16A 2GXUA 2UVPB 2NYAA 2CGEA 4G37A 2B5OA 3IT1A 3OCUA 4MW2A 4HWRA 3WIEA 1KP2A 1DVRA 3KQVA 4PQRA 4UEOA 4JUFA 1JMVA 4BEVA 4PLHA 2EQ5A 3CW2A 1MO6A 1Q6ZA 1XAJA 4MGEA 4RIHA 5E2AA 3DCNA 4E51A 4EY3A 2HREA 2AFIE 4E1AA 3W05A 1KJ9A 3GEMA 1R9MA 1IXSB 3A2MA 3BE6A 2WD8A 4WACA 5KVCA 1R8YA 2X0DA 2G1PA 1CUHA 3L9WA 3LFTA 4QYWA 2ODPA 3CLRC 3HN6A 4JLWA 3DJYA 4LZZA 2AN1A 1RXYA 1BJTA 2KBEA 5ALRA 4GMDA 1JDBC 3ZWXA 1OOEA 1N8SA 2GHQA 3MG9A 5TEVA 5EE1A 2XKAA 4QASA 2Y3IA 3AILA 4F3TA 4FW8A 1CEEA 5KSPA 3RKUA 1YOBA 2BCGY 4B2IA 4JMLA 1UK6A 4H1VA 2Q0SA 3VU9B 4HMQA 4HXFB 2QLJA 2YYAA 1Q1AA 1SZDA 2PO7A 4Y30A 4BGVA 3L04A 2ZUCA 5JUWA 4H7PA 2IYLD 3IBSA 2Q3BA 3KVRA 3MMSA 2QP4A 4CG3A 5FBZA 2OT3B 4WECA 2HCTA 1ZXXA 3C87A 3RS9A 1ICEA 1HEUA 2YN0A 4BX2A 2CDNA 1NW8A 3QE2A 2R7NA 4EA9A 2FSFA 3GGPA 5JD3A 3R8XA 4ZI7A 5M2QA 2Q2QA 2J7PD 3R75A 1CY2A 5TGZA 3ZDZB 4HEA1 3UT6A 1Z7BA 2W2VA 2FSIA 4YUWA 4BATA 5BSWA 8AT1A 4LS3A 1J2JA 3R24A 4RHTA 2FF5A 5BUSA 4HGOA 2BMJA 2EF0A 2Z83A 2JPDA 2GCEA 4HVCA 1U2PA 5J3JA 3DEYX 2F64A 2O0KA 2Q0QA 2DUMA 2YMPA 3JU3A 4Q3LA 4J49A 2BY4A 2O8DA 3R0QA 3T9FA 2C8JA 2ODTX 2XDYA 3R4CA 1A7AA 2BDUA 3HXTA 5FV4A 3NBMA 4CKYA 4L76A 3QWAA 3BWXA 3FPLA 1F8YA 5C8ZA 1KHHA 2EJUA 4BP9A 2ZSHA 2ZKIA 4F6RB 2ATIA 2CHFA 4W4TA 1JAZA 1JDPA 1HFJA 3PFKA 1QH8B 4EL5A 4H4CA 4M0UA 1FYWA 4AZ0A 1KEEB 1KMHB 2HK6A 2R5WA 4N12A 2P35A 3KR2A 1NLYA 1SZCA 3WK4A 1I51A 2DTDA 5JEDA 3QBTA 4A9AA 3CZRA 1YGPA 2CC2A 2LBPA 2NPIA 1WSDA 5C0OE 4F9EA 4BXOA 4AP6A 5L8VA 3PHLA 2FPPB 1T1RA 3SFZA 2HKIA 1O5OA 3LXRA 4QE3A 4ZN6A 1G7CA 1ISFA 1O4VA 1TM4E 4MAAA 4BECA 3PYMA 2OC4A 1R64A 3BWVA 4A3SA 4NG4A 5AOBA 2FPIA 3WAKA 2WTNA 4N5NA 1UODA 1DAOA 3ZCRA 5E0KB 1KZ1A 2RB4A 1L3IA 1JUDA 2HF7A 3OMXA 4J75A 5IRCD 1PJTA 1GTSA 1YJBA 3K9HA 5CPFA 4LVNA 3WP1B 4PC3A 1RZVA 4YCJA 2WQ7A 1L5NA 5IAEA 4F8YA 2YJTD 1XDSA 2BHTA 1J56A 4MB6A 4R1NA 1KP9A 3PFWO 1D2GA 2B2CA 2YW2A 3ICQB 1KYXA 4K9RA 4LDPA 4RACA 3JQBA 4V0ME 3RFCA 1G8FA 3LQYA 3VAYA 1XOIA 5TMBA 5LP6A 4H6WA 4J1QA 2X4GA 3PQ5A 4FYYA 3M6AA 4PXAA 4E12A 5CT6A 4FFMA 3IJRA 3N2ZB 4B4VA 4ZOLA 3SEFA 3R09A 1K8RA 1PG2A 4ARCA 4PZ0A 3JR7A 3ZI4A 5JI2E 3ZCPA 4B09A 3EF3A 1YKSA 4U9IS 1YMVA 3JWIA 1YXMA 1P1JA 2CBXA 2YJZA 4J94A 4JEHA 1OLUB 4R1PA 3RSGA 4JYPA 4XWYA 5I7HA 1GARA 4WCVA 4RQBA 4H6PA 2VLBA 3RTBA 1HSZA 4JK3A 2Z8XA 2RAPA 3V3TA 3QX7A 2QJFA 2DLCX 3VKVA 2EG9A 1JFFB 4J91A 4TKUA 1FY2A 1OVGA 4PO9A 4V2IA 2R1ZA 4GM1A 2ONZA 4U6SA 4WKNA 2XMCA 4DBLC 4MW0A 2AI2A 3HN7A 2X8LA 5EMNA 2CMHA 5J63A 1ZQ1A 3ZR4B 3H1FA 2BRUA 3LC0A 2YCLA 1E3WB 3ZQ4A 5FTNA 1RXUA 3EDQA 4NABA 1LY1A 2I7DA 2XIJA 3IO5A 2DCMA 1YKGA 2FDRA 3A9VA 3HBLA 4FMCB 5CM2Z 3VHQA 5CLGA 5FI0B 5JMOA 5TQ0B 5JG7A 1V0JA 5L51A 1SN7A 2OHXA 2E1PA 4BYGA 5LIPA 3CNBA 1M2VB 3L6CA 5EIFA 1XVUA 3H16A 2H11A 1QG2A 5LYJA 1Z38A 5DH9A 3KP1A 3Q0TA 4D42A 4QU0A 1C1YA 3JQGA 4OI2A 5FPPA 1YIOA 1GYPA 4MCHA 5K3AA 4V02A 1NY6A 2JANA 1X8LA 2IDZA 3DO6A 1A1VA 1U0GA 2WJJA 4L02A 1N6NA 4MMXB 4P83A 2XWBF 3D8TA 4GYWA 2EZ9A 2PWBA 1UBOS 2OAP1 3B3FA 4K6MA 5DWVA 5AFSA 5KNBH 4MA0A 2A9PA 2X77A 3CZMA 3V7WA 3ZE9A 4B8YA 3LG2A 3Q6NA 1GFIA 1SHZA 1Z73A 4N5MA 2VJKA 3PC8C 3G0GA 1KO8A 3GAMA 4DFCB 4LDRA 2PH5A 2RH9B 5KIAA 4YJFB 5G4LA 3SY8A 2DECA 2XIQA 2FZKA 2OM6A 2CL5A 5GTDA 2R7LA 2ZS8A 2A30A 4CPDA 2BUCA 1BO6A 5F9FA 4YRIA 3JAKA 4J0KA 4Q3KA 2AV6A 2F17A 1ML4A 3MYRA 4ASUA 4EHKA 4I1YA 2DLDA 1BU8A 1KYWA 3OHPA 4L7VA 4M0LA 4R1UA 5IN4A 2AFRA 4COOA 1A7JA 2FG6C 1JYEA 1W8DA 4RTJA 4ZO8A 5IZCC 4DKXA 3IUQA 2JHAA 1I3KA 2WU1A 3SQMA 3EWAA 4EJMA 4ZVQA 2RHDA 1NDQA 2AB0A 1VG0B 1JI0A 4FQ5A 4ACAA 1K8XB 1RFGE 2C5SA 2IWRA 1HK7A 3KOZA 4B4UA 1ACMA 4MDFA 3ZD6A 1SULA 5BSHA 3U0VA 1N25A 3PGKA 2CB9A 2DBRA 2X5OA 2O5VA 4RK0A 1E7YA 4ZU6X 3VVMA 4GECA 2IZOA 5FJIA 2G6TA 2P90A 2PT5A 1CHDA 3L1IA 3OCVA 3O90A 5EQDA 4D0NA 4H7FA 4BFLA 3HBAA 3UMRA 4PZUA 1K5HA 1QIHA 3GJ6A 4X93A 4LTMA 2IYAA 2Y1KA 3C16C 1XZHA 4U4AA 2XYPA 1P3DA 3SR0A 4TPKA 2QP9X 3K4QA 5GOZA 3UMFA 1WP4A 4FMCF 1O58A 2O3UA 4OMDA 2OFOA 821PA 2EX4A 2Y66A 3VV3A 4WTOA 4DBZA 1CUZA 4RK4A 4MMYB 5EXDA 2GZDA 1EFHA 1RLJA 4NJEB 1KC3A 3B78A 3GFFA 2PZKA 2R6ZA 3LZCA 4KXMA 3RD5A 1EM6A 1K98A 1NZJA 1IQRA 2BFDB 1AV7A 3SDBA 3M3PA 3KSMA