4QGBA

Crystal structure of mutant ribosomal protein g219v tthl1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
KVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMVPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Protein-RNA affinity of ribosomal protein L1 mutants does not correlate with the number of intermolecular interactions.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 47
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4qgbA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qgbA02
1CJSA 4REOA 4DFCB 4QGBA 3UMYA 3U4MA 1U63A 1AD2A 5DM70 4LQ4A 3TG8A 3FPNA 3QOYA 1DWUA 3ZQJA 3U56A 1ZHOA 1MZPA 2HW8A 1I2AA 5DM60 4F9TA 4QVIA 4QG3A
chains in the Genus database with same CATH superfamily
2PG3A 4PCUA 2QSJA 4M0EA 4G5SA 3LX6A 4OLFA 2OGUA 2X8JA 2R1TB 3GUCA 4B6JA 2DFDA 4I55F 1JDNA 3U80A 5FUYA 5IDWA 4N18A 2C97A 3D2AA 4Y1RB 1C2TA 1BXNI 5KNDH 1KAHA 3X1XA 1SUWA 1E96A 2D74A 4LBZA 3DMGA 1MLDA 1P2BA 2HV8A 4BP3A 1JAHA 4JJ4A 1DEHA 1NMSA 4LKOA 4LZZA 3LY7A 5LOVF 2P7IA 2F1HA 2R7LA 4BV3A 2V6BA 3ETDA 3FBGA 2ID8A 3WBKA 1EA7A 1W581 1WVMA 3N7AA 5GV8A 4B32A 3SU8A 1A5AB 2E9SA 3JW8A 2GF0A 3H42B 4G0YA 4DM4A 1NT4A 3L7YA 3UWKA 3GBSA 2QN8A 1YUBA 4XXHA 3CG0A 3TLCA 1W2GA 2G1KA 4ZC1A 2ZJ8A 3KE8A 2ZT8A 1GN9A 3VGJA 3X1WA 1YD7A 4BP9A 2QZZA 3IUYA 1GTSA 1LNQA 1GTMA 4AWBA 1M6EX 4DNPA 2JEYA 2C9ZA 3CN7A 1IAQA 3SR4A 4LF9B 3VHXB 4QJIA 2Q9AA 1FVOA 1X3SA 2GHTA 3LLVA 4QD3A 5FYDA 1FQJA 3FBWA 4NBTA 5HA5A 3L0BA 1CVLA 5BSEA 4MV7A 5TQVA 1VMKA 5HSGA 3H16A 1PV4A 2ZE8A 4N76A 4EDHA 3JQBA 4ZEOA 4PIMA 1DPFA 1C9YA 1GTZA 1XRPA 5THKA 3KYIB 2JC3A 4YJ2B 1SVSA 5F2EA 1NN0A 4XRRA 2C1EA 3PQDA 4FGJA 3WK8A 4BJ3A 5EESA 1MEEA 1XRQA 3KEFA 2BI8A 1P1BA 3PNLA 1K98A 1Y3AA 1ISHA 3SZMA 5D84A 3AM4A 1R4MA 3LK6A 3N2GB 1DJMA 3ST7A 2FFJA 3D0QA 3EVGA 4CNQA 3V4RA 2ZUEA 3DWEX 1QK3A 3FNIA 5JV5A 3JZFA 2Z04A 4F0HB 1R15A 2IXEA 3NETA 4INZA 5AXAA 3IUPA 1WCIB 3BCRA 3DNFA 3OFKA 5CA0B 1ODCA 4UTNA 4L4ZA 4E4YA 2IF2A 2OQ2A 2D00A 3L6DA 3D8UA 1RQNA 2O8FB 2DLDA 3KJEA 4X3CA 5HQ3B 1PP4A 3P9QA 2XA9A 5CCDA 2PX2A 2BBTA 4EI9A 1OI4A 1GGKA 4B6OA 3T1TA 1XXHA 3CEJA 2F9MA 1K5HA 2ACVA 2I76A 5I4IA 4P7BA 1SA0B 2R1VB 1U0GA 2QAGB 2YWFA 3OH8A 5ENZA 4BTEA 4BGDA 3V8MA 2EX1A 4LPSA 4B7CA 3K7EA 1TOAA 3G7UA 1G2IA 3VNVA 1XQ1A 3EVDA 4A23A 3KB6A 3OZAA 4I55A 3GD5A 5CJPA 4DLUA 5K8IA 5LQJA 4BZWA 1PHPA 1AQJA 3KZ1E 4EEZA 1TFUA 2NUBA 5LDDC 3UMBA 1XJCA 4TLCA 3OCCA 1M33A 1ZK1A 2DUNA 2FUG1 2K4MA 2YQZA 4LNHA 3ZWMA 1YS9A 4PZEA 3ZCVA 4D3XA 1ULHA 3GRPA 3I76A 1U9CA 4Q3LA 4Z49A 1DKMA 3P96A 3Q41A 4N5IX 1POXA 2OHJA 1K66A 1U9JA 4N49A 1YR7A 1BH2A 1ZICA 3O8BA 3DZDA 1ODSA 3HUUA 3L0IB 1AKUA 4M7PA 3WHPA 3P4YA 5KTMA 2C7PA 1Q44A 2ZPAA 4O2BB 4MGHA 5DSTA 1O08A 4IFBA 4OHFA 5KJCA 2BDUA 1TA9A 3W4IA 2A5JA 3M1YA 1XJ0A 1V2GA 2FF7A 5DM1A 2WUFA 4YMIA 4K6OA 4YLGA 5A62A 3VOTA 1C3OB 4IGKA 3T41A 1K7FB 1TU4A 1PHRA 1XTQA 2A9QA 1QE3A 3DH0A 3NBXX 4P93A 3ZWVA 5C35A 2SCUB 1XB2A 1WR8A 5ADUS 1RAGA 4GKAA 4CM6A 5CR9A 3KKEA 1SY7A 3QW4B 2ZU0C 4LHYA 1PFUA 4BKQA 4KO3S 5HNKA 3RAGA 3ESAA 4IFIA 3Q8WA 1GRCA 4EOGA 4HC4A 1ULTA 4DQUA 3IAHA 1ZOLA 2PBLA 2YW2A 5JCXA 1KO8A 2QQEA 2CFCA 4LN1A 2GYWA 2X2OA 1KZHA 5IAAA 4Z2YA 1OWMA 3NKVA 2H0AA 1CUIA 1WY7A 5CM2Z 4F4IA 2JH3A 5A4FS 3AF0A 1PQPA 1P1CA 2ZCUA 4I36A 3ROZA 2NIPA 3VTFA 1YRBA 1II9A 4LSZA 5JVDF 4LY9A 3DKPA 4LF4B 2HU8A 2GCNA 3ME5A 2XKJE 4MOWA 2AWNA 1GZVA 1JLLB 1JSCA 5H9WA 1VPLA 1EE2A 1L7VC 4G23A 1R0ZA 3KETA 1D7AA 1RJWA 1SVUA 1L5SA 4JLOA 5CT9A 4A8HA 1L4FA 1AQNA 5BQOA 4WJZA 3SBDA 5LZ7A 1NM5C 4YRNA 3PDJA 1NVBA 4N3NA 1K7SN 1ZK4A 3R9KA 1I2ZA 3Q40A 1MB0A 1G8MA 3UAOA 2GZ1A 2VXCA 4Y2JA 1C0PA 4OUKX 3OG9A 2IUTA 1I4LD 3CLTC 4OXQA 4RH0A 5EEHA 8ADHA 2NSDA 1OH7A 1P4SA 4ZREA 4EPWA 1M83A 3WBFA 4LG1A 4RTOA 4K9DA 4YXWD 1Z2DA 3ZX5A 3QE4A 4DHWA 1BN7A 1NG9A 1WP9A 3ILVA 3KUCA 4K3UA 1MAUA 1OA0A 2P40A 1TYDE 2Q4EA 2PVSA 1B2LA 2OLEA 4IGAA 4KQGA 4UHFA 2Q50A 3AEZA 5AHRA 4DIOA 1TO2E 1GQOA 3GOHA 1LF5A 1VJTA 2CHQA 2CVHA 1M8FA 1O5TA 2HLHA 1NNEA 4RHTA 1GG9A 4L8VA 1ILEA 4RCYA 3HCFA 3QGMA 5B5SA 3DR3A 4L85A 3BXOA 4LE1A 4YPOA 3W5DA 2DECA 2HLPA 2PH5A 3BILA 5LQDA 4N41A 2IVZA 3TSOA 4CPDA 2GYVA 4W9RA 1SXJD 3X3HA 1M8KA 2AMLA 4J43A 1YB4A 3CE6A 5EMKA 5IAEA 5LNK6 4G4IA 1M5TA 4H1HA 1RLDS 2CL0X 1PZHA 1XR3A 1ZI8A 4GLJA 5LJIA 4BEBA 4I50B 2R66A 4JVNA 2MSWA 4RANA 1U8AA 3WK7A 2QVGA 5ICCA 3G9ZA 1DX4A 1Y5LA 2PX6A 2YWEA 3TEJA 4CEHA 4HDNA 2XZDA 1HDRA 3A06A 3ELBA 4WEQA 3PQEA 2X2FA 1M75A 3MAAC 1BGXT 5K8LA 2OYRA 1GYPA 3KPYA 1OGIA 2PD3A 2ZETA 3DMNA 3FDFA 3JASA 1K0UA 4D02A 4D9IA 4PPGA 3PE6A 5HBGA 5C8DA 1USKA 4TXJA 4BHTA 3EQ6A 3JRNA 2CHVA 4TLEA 2WQ6A 2FZWA 1GKLA 3LPCA 4TKVB 5CDUA 4ZI5A 3UGTA 3DO5A 3IIJA 3PE4A 1YZFA 3KYCA 2ZK7A 3TLGB 1GYQA 1A8PA 3F6EX 3GNSA 3HUDA 2BLLA 3ABIA 5ECDA 2QMZA 5JMPA 4C08A 5EJ5A 2FXVA 3F73A 1ZDMA 4DWWA 4BNZA 1MW9X 3ZHCA 3PGJA 1DKQA 5HM8A 4XM2A 3KFXA 2FPGB 3K4HA 5JVDA 4XYMA 3LLSA 5G1NA 4JV5B 2EYUA 2EJBA 5DNVA 1JHPA 1YAJA 4PC3A 3DCNA 1Q7BA 1FU8A 2Y1WA 5C34B 1SD1A 4G9BA 2OCGA 2PH3A 2X8LA 4I0WB 5EE5B 3TFQA 3VSDA 5I47A 1ZHHA 3NHBA 4KAAA 3UW1A 4ZQHA 3THOA 3MGGA 3IP3A 1FP1D 4IIBA 1YJCA 3PTZA 2WJJA 1OOEA 1JV2B 4MUBA 3MW8A 4I4LA 3NGMA 3BXEA 2PVPA 4PZZA 4RD1A 4Y3UA 1L5HA 3M5PA 2HMVA 3DPSA 4R40A 5DHSA 1KZGB 3ZHBA 2P62A 1YL7A 4E09A 4OL9A 5I3CA 1EAMA 5JDCC 3M3DA 3KCQA 3JQ8B 4IQGA 2K2QB 1Y1SA 1Z35A 1J8QA 2DR0A 4MUJA 2X42A 3B78A 3GGOA 3R6DA 3P0FA 2GCOA 5HFJA 4YAUA 3OECA 4XCXA 3L40A 2CD7A 5FTKA 5H7XA 3ZOKA 1ZUIA 1UJMA 3ICEA 1GUAA 1USIA 3OAAD 4RFVA 4AKSA 4YRKA 3HP4A 2P5YA 1MJGM 1QB7A 5K1ZA 1YZUA 3I37X 2RIPA 4JYPA 4B3JA 4MVJE 1N9GA 1J00A 1TW3A 2QMHA 1M6WA 4XPIA 3RFFA 1XMXA 1I10A 3F98A 4DIEA 4EHFA 3KJZA 4ZYYA 3Q9SA 1D5WA 3IVCA 2LKDA 2IOQA 3ZH2A 5CT8A 4B33A 2O5RA 1QGED 4TGLA 1KH3A 2CF6A 4RDIA 1QBGA 1R9GA 2NU9B 1JKJB 2GGSA 2HDOA 3Q12A 4YJFB 1GQFA 3MTIA 1M54A 1Q84A 4HQOA 4PWZA 3GAFA 5DXFA 5IANA 2B21A 3TAHA 4US1R 2AFHB 4HRYA 3WRYC 1QDEA 3DT9A 2XECA 3GARA 4XPZA 3S55A 3T0FA 3W6NA 1OJ7A 3PPYA 3DM9B 4NBRA 2J5KA 1O5OA 2NZJA 5CLLA 4KH1A 3L1VA 1YH3A 3O7MA 3ABQB 4YWHA 1BA3A 1YT5A 3AXTA 3C1OA 5ESRA 3RHZA 2VP2A 4K0RA 5G3ZA 2IXAA 2MWMA 1LDBA 4KQ1A 1J0XO 2V7QD 1NW6A 3P5BA 2B6NA 2AYZA 1EE9A 4KBYA 4PE5B 4B80A 2H59A 4XD7D 1G16A 4IIHA 2ZYDA 1J2JA 3SHVA 3ZDQA 2ZIGA 3ZXWB 2RAPA 4L5AA 4C1BA 3M89A 5BOVA 3LI2A 1JFVA 3T7SA 4ALIA 1LJ8A 2QZSA 3EFOA 4RA9B 2ODNA 3QBDA 1HK7A 2JJ8A 1G19A 4G37A 4DM3A 5ADWA 5HS4A 4H6VA 5ARDA 2VVTA 2WYWA 5KUTA 3MN1A 4CCYA 3QU2A 3DDCA 3EULA 4JAVC 4X1KA 1IHDA 2G0TA 2OILA 4IJ5A 4OHYA 5BT9A 4D41A 1YMVA 1URPA 3ICVA 3K5WA 2IE8A 4C04A 4YAOA 1CFZA 2RB4A 4JBGA 4Q19A 1HM5A 1VL0A 1UJBA 5IJ0A 4BN0A 4RULA 3EG9A 4PHGA 2O8CA 3QYJA 5A1TA 4NZ9A 1ULSA 4RM3A 4KVZA 4YRLA 4E6EA 2AN9A 4J2OA 3PFIA 2V7VA 2IXTA 2J45A 1QVAA 3LDAA 4IJKA 3D7NA 1J6UA 1YDGA 3EXEB 2WTEA 3AI1A 4QFDA 3HB1A 2J5QA 4N9WA 3VR1A 4FZ3A 1NBAA 4PNZA 3VC7A 1CZLA 4YMGA 2RAVA 1GV0A 1ZBDA 2IHJA 3E82A 4H77A 2H9YA 2C92A 1I7SB 5EP3A 1SC9A 1Z8NA 2PRSA 2C54A 3P9CA 3C3CA 3FMVA 4GGPA 3WJ1A 3LT1A 5DJ5A 2ANBA 2YBDA 2ZAYA 3IT0A 3KQLA 1G2QA 4D0LB 4D7AA 3VVLA 4CLRA 2QY9A 4L15A 1JDPA 4C7JA 5IWCA 2V7TA 1Y33E 3O4IA 2CJWB 4MX8A 3F7MA 3OHPA 1NDUA 3NJ4A 2RK6A 4FPXA 4IR7A 4Y9DA 3ZJUA 5F3WB 4BDTA 2XWJI 2R8BA 1KVTA 4KK3A 4OK3A 4QE3A 1DAGA 4RK0A 4X8LA 2JIPA 1T8TA 1ZD3A 3N07A 4AUMA 1UQRA 3UYLA 2CVZA 5GZ6A 5A9SB 2R47A 1UPFA 4EHJA 1X2EA 2QN9A 2I9KA 2QVCA 5JJLA 1H8HA 1JJVA 1UADA 2GFIA 3HC7A 4D4HA 1XCGB 2IXBA 1FFCA 3QPUA 3QOYA 1DXQA 1SVNA 5ALPA 3S7TA 2OD9A 1KZ9A 1VE9A 2C3YA 4F06A 4XA8A 4X8MA 4B0OA 4E5UA 1JT9A 2E5WA 4PLZA 3DWFA 1IK6A 2HSDA 1Y9AA 3P19A 4WX2B 5K45A 2Y8EA 4D26A 2QZPA 1GPUA 5BWBA 1L5LA 3A2LA 1B6SA 5I7WA 1MQ9A 1D1QA 4Q1AA 3O2QB 3BMCA 3LUKA 4Q12A 2VEDA 1AJEA 2RE8A 1YS4A 5LL6P 5LP6B 5D00A 2D5BA 4DWJA 5EJEA 2YW9A 3Q0IA 4G2TA 3QIVA 4BJHB 3ER8A 1U28C 3UT6A 5ALVA 1XRLA 1AKQA 1AHNA 2WLTA 3BRSA 2YUIA 3C8UA 1O54A 3EA0A 1OX4B 5I9MA 3ZE2B 4C2UA 4L9SA 3BD8A 1H0HA 2BHRA 1T4BA 3TCXB 4C22A 1JHAA 1IMJA 2VAWA 1Q74A 2A58A 3C3AA 5LPNA 4LYDA 1WF6A 1YB2A 2OZEA 1IBCA 2GXQA 2PMBA 3D02A 3R4VA 1RLOA 1B6RA 3HCBA 1NBMD 2I2BA 4JJEA 4JUFA 4Q3AA 1E9AA 2GS9A 4NEQA 4YJDA 5E9QA 3F8TA 4NCAA 2ZUDA 4A2CA 1T35A 3RU2A 2ID7A 3GWZA 1E7YA 1G8KA 2WAYA 4IDEA 1QHYA 5JNUA 1V71A 4OKSA 3ETEA 2JHGA 3B52X 1LPNA 4ZN6A 5EGNA 3R6WA 2X86A 3HWWA 1E79A 3E3LA 4LRSB 5CK4A 3PJRA 4OLHA 1PR4A 4F4JA 1D0VA 5A4AA 2KI5A 3KP1A 1LDEA 3R8FA 5F1KA 4DLYA 3PJEA 1KIMA 2V0NA 5I9NA 1CP3A 5FDFA 1OXUA 1X94A 1EVJA 3BFJA 2CNOA 3PI6A 4C0SA 5C1BA 1A2BA 1FX0A 1O8BA 2O8VA 1ML4A 4IUYA 1Y1RA 1OIVA 3BMOB 1FUEA 1KJYA 3IPYA 5CJ2A 1FZQA 5T4EA 1QP4A 1SK9A 3UCEA 1N78A 2NUTB 4X41A 2V8BA 4H60A 1MJFA 1YC2A 1B14A 3ODPA 4OXXA 4CNBA 5M3BA 4YJHB 4KACA 5IPFA 2NQ8A 3OSUA 1IOLA 3RJ9A 3TZCA 4IW3B 2X5KO 2XOKD 4MWZA 4ZZ0A 2WB2A 3UV3A 1XKLA 1YKSA 3LWNA 4WGFA 4BFTA 5ADVA 2QRVB 4FHFA 4NPCA 3IBYA 2JFBA 3VGPA 4B2PA 4IKOA 3ZWNA 1DJNA 5EWJB 2YUTA 1NXXA 2JIMA 1F8FA 1U1FA 3AEUA 3KKNA 2HQBA 3M6IA 2IKQA 2ZUVA 4L5BA 3GLGB 4CQLA 3OZXA 5BNTA 2TSYB 5JNVA 1T0BA 4RXMA 2EVWX 3DB2A 3V4SA 4BVAA 3K16A 2DBVO 4KOAA 2P1DA 4MCIA 4EP1A 1XA3A 4JI8B 2V5UA 3W6ZA 1UXKA 2V7EA 2NYAA 3B60A 4PYMA 3WMRA 5CFLA 1FTGA 2JI9A 3GJYA 2UV8A 4EZEA 1K89A 1V4NA 1J7KA 1Z0IA 4V0ME 4ZYVA 1ZCZA 3JQ7B 3RSGA 4YMVA 1MN6A 2JGRA 1UFKA 4I4TF 4NMMA 5MFZA 4QJ5A 3GP3A 2HL6A 3LC0A 1VB5A 4B48A 5JAOA 1U1IA 4CRWB 5T3UA 4FEAA 5A0VA 2XBLA 4NQRA 1YDFA 3HZHA 4BXOA 4H7KA 1B7GO 1E2FA 4LCBA 4OYYA 1PR6A 4B8YA 3FM9A 3MD9A 4S0XA 4Y1GA 4EGAA 1PT9A 3KB8A 1KI6B 1I4WA 6AT1A 1YJ8A 2WSBA 1TD1A 1GAXA 2PYIA 1USVA 2GVDC 4ZP1A 1RI2A 2VK4A 3H3XA 3N86A 4MNTA 5DOZA 3WGVA 3EGDB 1E1RA 4FLEA 1JJ7A 3PNKA 3VTKA 3BSYA 2BYTA 3F2VA 3AB3A 4Y6LA 4WFIA 3EA4A 3P97A 1V7CA 1I5OA 4MQMA 1XWFA 2VPPA 1J0AA 2ZRLA 1IAVA 2Z09A 3MJHA 3O4RA 1CV2A 1U7DA 5EJFA 2DPGA 2GO1A 3IQWA 1X87A 5INTA 2ZUWA 5LD2B 3NGLA 2R00A 1I24A 3N0WA 3N6XA 4LJKA 4Y6OA 3S2GA 2N75A 1UOQA 1WHTB 2I9PA 4PC1A 3RIYA 1DGQA 4KIUA 2IEAA 1FBTA 1GGJA 3Q0TA 4HB0A 5B1DA 3UVEA 1QH8B 2J08A 3OU2A 3PR2B 5EHZA 3WB2A 1UC9A 1LLDA 2VJPA 1C0IA 1A3CA 2WUGA 3NLLA 5IK2D 2MINB 1ZWKA 2A5FA 2X22A 2HSEA 3IKVA 3OQ1A 1HTTA 1VE1A 2C82A 2RI1A 4AL4A 1GKYA 4CXMA 2L42A 3KE9A 1H5UA 1QS0B 2FPKA 2XT6A 2JJ2D 3NPMA 4UEKA 5K3FA 1W48A 1RBQA 2DFLA 2DP4E 1S2NA 1VHWA 4RH1A 1GPJA 1G5HA 4J1QA 5GP1A 4IHJA 4DYDA 4Y9UA 4DR2B 5KJEA 4W5QA 4PX5A 3UXYA 3U39A 5JS8A 2M1XA 2BKVA 4C0XA 5BW8A 5K3OA 3DHWC 1YB6A 2BHLA 1W8IA 3GDGA 4AJHA 1QRSA 4M99A 2C8LA 4PX3A 2ENUA 2YFYA 1L4YA 3N3BC 4XWAA 5CIQA 5FI3A 5H8WA 3R7BA 4H7JA 4AF8A 4V1CA 2PEZA 1NNLA 1F4PA 1QLJA 2IOYA 2WG0A 4FR2A 4H08A 2O8DB 4X94A 4Q7LA 4PBSA 2HR1A 2A0UA 1VMDA 1CHDA 3A6LA 1PSWA 4KMRA 4CQMD 3SE7A 2P2ZA 1I3NA 1TADA 4GRAA 2J85A 3VI3B 1JS1X 1OWNA 4TXNA 4BE7B 1VLVA 2NO0A 4EIWA 3MGCA 1BSVA 4BQPA 3KKQA 4XQ9A 3DOCA 1TGYA 4I4TA 3EMVA 2UYQA 3B8EA 2DUMA 3AT1A 3H7IA 4DAEA 1NV9A 3BF7A 1YXMA 3GJRA 4ZU3A 4PN3A 2Q4OA 2ZE5A 3FPSA 4B7AA 4OHBA 4CQJA 1AB6A 4HDMB 2QJOA 1I36A 3DFIA 1USGA 2R8RA 3G88A 4JIMA 4YCBA 4N03A 2FW6A 3TOXA 1J22A 5B6PA 2EU8A 1E6EA 1XCBA 4TROA 3K30A 1MPXA 4RA6B 4GWKA 3RS5A 3UUGA 3ULKA 3MUNA 3ZLVA 2A3NA 3TOVA 4ERNA 1UBLS 1NSFA 4RY9A 2IC5A 2ZYTX 4L1KA 3DGFC 3LD9A 1B6GA 5JPCA 3VNRA 5JE8A 1ZS9A 2O07A 2D5CA 5FO1A 3HCCA 1UK8A 5ALIA 4DRXA 1V11B 1L1FA 4OP1A 1SBTA 5DGXA 2J3HA 4AY2A 3QWAA 3GHHA 4QTUB 4YUZA 1O7JA 1V1RA 2ZVDA 3FLEA 3E22B 3KPJA 1XKTA 1YKFA 2VTDA 1SC4A 3NCTA 1JGTA 4TTTS 4RJKA 3Q7EA 3V9AA 5L3QB 3I9FA 1Y3IA 5C81A 5C46F 2H00A 2KBFA 3N8IA 1JWLA 2ZT6A 4EVQA 4E7OA 4KYTA 1X7WB 3PNSA 4O8ZA 4FK8A 5CH8A 3SF8B 5K3EA 3GR6A 2RHWA 1BMQA 3CPEA 1T3TA 2G5PA 4URVR 2JIZD 4EF6A 3B6ZA 4A0SA 1QNLA 3A4YA 2BTQB 4WY5A 1YFZA 2JNWA 1U2DA 2WIAA 3CHYA 3HRHA 5AM0A 1WPGA 5E1MA 5C8YF 2QTHA 4C3ZA 3OU7A 3VSBA 2CLFB 3D7RA 2A5YB 4ZVPA 5BSMA 3ASUA 2WNSA 2BI7A 3B2NA 3BWVA 3JRWA 1P4GA 2ECOA 2FFHA 3BBPA 5REQA 4E6PA 3RG2A 1XF9A 2MR5A 1ORVA 2XBUA 2FVXA 5EHXA 3D4BA 4RLHA 2EHDA 4Q1EA 2ETVA 3VM6A 2CVQA 5DH9A 3SSMA 3OEEA 4R9VA 5LXTF 4AZVA 3LC7O 3D7MA 3FFWA 2FSVC 1QYWA 1WUYA 2KMLA 1J07A 4Y2XA 2ZRJA 2WTUA 2EKPA 4P3NA 2PBFA 1Z0KA 3I5UA 4IF6A 1J42A 2AHOA 3FR7A 1FP2A 1S01A 2CZCA 3EC7A 2OC9A 1F9AA 3AIIA 3FGZA 3JZMA 3CUTA 3EVNA 2I2XB 4R54A 1OE0A 1QGYA 5EPOA 4NK4A 3IUMA 3RSHA 2VHEA 3FB1A 4LF7B 5AJXA 2Q9UA 4NE2A 2V6AI 1P7WA 2DY0A 2GEJA 3Q2OA 3T15A 3DQZA 3TR0A 1VG8A 3DLIA 5AI4A 3M8KA 1RFGE 1LF0A 4J6EA 5FRDA 4CLEA 4F86A 1SQ6A 2FR8A 3EDCA 3R6LA 1EGVB 3SX4A 3GDOA 3X2FA 4J76A 1UJ4A 2VJNA 3QF4B 4JZYA 4KQIA 3O7WA 3HLKA 4N0EA 4R3WA 4MV3A 3HZOA 3MLEA 4EL5A 4GT1A 1VPVA 4OB6A 2P9BA 1Y7LA 1Z16A 4BZZA 5H81A 2A9VA 4LVNA 2RHHA 1GFIA 1LNZA 2ZSDA 3QVJA 5CG1A 3MINB 5M29A 3SSNA 3KTOA 4PIPA 1TF5A 4IS2A 1VL5A 3T3HA 1EH5A 2WPDD 2ADOA 1EXVA 4OHXA 2QW0X 2ZRFA 2L19A 2C3OA 5BSHA 1BXGA 1Q77A 3FZQA 1W5AA 1YR2A 2C5BA 4I4IA 1YI0A 1TMYA 2BJWA 3LS2A 1YBMA 2X1HA 5TQ2B 2A6PA 2B61A 4RV9A 4LFCB 1AGPA 3QVSA 3V4VB 3WJAA 4F84A 1CVRA 3IDAA 3WLHA 1ND6A 3QUQA 1YS1X 3M82A 4NESA 3RK1A 2CE7A 2CLSA 3UYKA 1Y34E 5LR6A 3J81k 5AW6A 3F5DA 4J0GA 3L0SA 1IXZA 4MYHA 1DC6A 2Z4SA 1E2PA 121PA 3DUFB 2YVKA 3BF8A 5JSYA 4E2ZA 3F0TA 3H9GA 3GJ0A 4MVJF 3D6UA 1QF7A 3JARB 2I54A 2V67I 2G4VA 2X58A 3G0BA 2JFZA 3AJAA 1RTKA 2MDTA 3MS2A 4FGWA 5EP2A 4A91A 5KCZA 1M2VB 3STVA 3GLHB 4OXKA 4OXYA 1CQJB 4GICA 3REQB 4E4RA 2ZZNA 1P8JA 3V7UA 2VH1A 4F9TA 3ABOB 4J1TC 3P71T 5DT9A 5C8YA 2EZ9A 1LZKA 1FP4A 3QQ5A 4O4HB 3WVNA 5CEEA 3JQPA 3K31A 4RF5A 5AK0A 3HU2A 2QXYA 3QE0A 3OY7A 1E2IA 1P6QA 2OHHA 3GPBA 4QBFA 4Z86A 2ZIEA 5DYNA 3FZEA 4JC8A 4MGEA 4ESVA 3HKBA 3B9PA 3HA7A 3WWZA 3TG8A 1EK6A 3IRUA 2EJTA 3MOGA 4NDNE 2NV2B 1WXHA 3ZY2A 3Q15C 2XTAA 2LCQA 4OI1A 3EIFA 4UCWA 2O05A 4K9NA 4KPUB 4E2XA 3DV0A 3SIPA 4MROA 4HZUB 2AMJA 3MWFA 2GPJA 2BOVA 2A1TS 1QE5A 4XWTA 5HZMA 4FMBB 3C0KA 2KHZA 2UVDA 2W8BB 3PFKA 2PJRA 2BGKA 2MU1A 3G9QA 2QTWB 3LUGA 4QYWA 4UAVA 1L7AA 1Q0PA 1A8IA 1D7OA 1GPYA 3DVSX 2EX0A 1P9OA 3VV2A 3W9BA 1OH5A 2A33A 3LQ4A 3OIUA 3ZDFA 4ARZA 3HA2A 3C8DA 3HO1A 2H7XA 3GJ5A 3DCJA 3MOSA 4HTFB 3GN2A 1U31A 2JJQA 3CS3A 4DLTA 3BICA 1WKCA 4POAA 4PTLA 2J9ZB 4FFVA 3SX2A 1R1DA 2EL7A 4DOMA 5EIAA 4RBNA 4CG0A 3GP5A 2P9TA 2PU5A 2R85A 3ZQ4A 1RWVA 1R66A 1TMGE 2Z9CA 3STUA 3GEEA 2IH5A 4ENPA 4PPQA 5B55A 1QBKC 1IN5A 1OSNA 1PWYE 1NZDA 1XPUA 3GZTB 5AKHA 3EXIA 1V4BA 3ZDAA 3WB9A 3S81A 4EGSA 1TPYA 4J0CA 4X1YB 3SYLA 1DL5A 3OJCA 1JR4A 1SCKA 5CP8A 1D2MA 1ZMRA 5LB4A 2BKAA 3PUHA 3WGZA 1V7ZA 4HGOA 4NZOA 4YP9A 5HEKA 1M6YA 4L2IB 1R4AA 3EPKA 1SXJE 1WDKA 5FBWB 1W2HA 4MVJA 1VL1A 2IIVA 4KN6A 6REQB 3FETA 3L8FA 4BO6A 2IXGA 3N8HA 5JFTA 2VUUA 1Y6ZA 5HJEA 5LNK1 1HTBA 4BX3A 2J9RA 3A25A 3BJRA 3NYQA 3URMA 1XP5A 2ICAA 2VRCD 3OBIA 3RW9A 5TQ0A 2YV2A 4EFLA 2JAHA 1JEOA 1KJ9A 1EM8B 2B4TO 2JI7A 3PV0A 1U4OA 2FE1A 3VPSA 4DJEC 1P9WA 5J58A 2H2IA 1YI1A 1TK3A 2ON6A 3OQIA 1N77A 3GGDA 3GEBA 1XMVA 3IPAA 2NVUB 1QANA 1HLPA 5ITZA 3EZGA 4D5EA 1CJTC 4OGGA 1BDBA 5BUZA 4EI2A 3INTA 3FVVA 4QJ4A 4QRDA 1GGMA 1CG6A 4KN9S 2AIRA 1VJ5A 5AI6A 5EC8A 5K8JB 4HGZA 3HBJA 2Q0XA 3F3SA 4FBMA 2ZJBA 3ZKWB 3IB3A 1FMFA 1Y3BE 3FZGA 4JI3B 2WLSA 3EB9A 3SKVA 2G76A 3IOBA 1QOPB 3OE4A 4C3VA 2EW1A 4FIDA 3RUFA 1UBHS 2VUHB 3QHAA 3U6BA 1CC1S 2OC4A 5BNFA 4AYTA 1EG2A 5CJJA 4ZKEA 3SS9X 1U7TA 2OP0A 2OE2A 4O3MA 2I6TA 3F7TA 3HABA 4Z3DA 2ZIFA 1KMMA 2PWAA 2VNIA 3NUGA 3LC2O 4QAJA 1O87A 2NXEA 1UWAC 4MW7A 2OCDA 3THWA 1O8CA 2KLHA 5FNZA 1E1NA 3SZRA 4BTLA 3I1JA 1DWQA 2ZEJA 1JEAA 1MQ8B 1TJYA 2XQJA 1N3LA 2CHEA 3P5SA 1HNXB 4EO9A 2WIBA 3UO8B 5CCXA 4PYQA 3K9WA 2BM8A 1MTZA 5ALJA 2LW7A 1E59A 1ODLA 1XEWX 1NJ8A 1RQLA 4RJLA 1K3UB 2HDHA 4EUSA 1FRNA 3D0KA 2RDMA 4RVOA 8LDHA 2Y0EA 4IZHA 4HVLA 4A6EA 2BCJQ 2PN1A 4JYCA 5B1YA 2XRMA 1QTQA 2EX4A 4TSKA 4IP0A 1KQFA 5KB3A 4G41A 3EC2A 1FMLA 2PKCA 4JROA 4IXDA 4BO1A 5BV7A 1QGUA 5E1OA 4HHHS 3AJ9A 2R6R1 3Q7QA 3OSZA 3DWIA 2Q21A 1B3BA 3U1TA 4F9GA 3SHOA 2W6ID 3GT0A 3K35A 4LXUA 3STTA 2WG1A 2O0LA 2GUWA 1YK1A 3CT6A 3NONA 2I78A 5JNLA 4K8OA 1UJNA 1FU7A 3BIXA 3FYCA 1IWAB 1OLSB 4LW8A 1P45A 1MDBA 1S89A 2OESA 4CDRA 3ICQB 3VO9A 1ZW6A 2RARA 3I9KA 3K4PA 3TCNA 4BAUA 1NNSA 2CCKA 4D2IA 2ZTVA 1SKBA 1Y3DE 1S8AA 1PFVA 2DFKB 2OCLA 4NRDA 3JU3A 4RK5A 4WOCA 4Z0PA 3R7SA 1SXHA 1X19A 2BGRA 3RF6A 3ZGVA 1GNLA 1U7ZA 4BB0A 5KU7A 1MW8X 2GDJA 2Z56A 3DTNA 3NNSA 4MRNA 3LUPA 5AKXA 5TEWA 3WHIA 2C94A 1THGA 5KOHA 1P0IA 1U65A 4OQLA 1PV1A 3DONA 2ZUFA 3Q8KA 3QFFA 1E3MA 1VKZA 4M9UA 4Q1BA 1C3JA 3TR5A 2P2LA 3UOAB 5C4MA 2LNDA 5I7RA 1XJQA 3WX0A 2DYKA 4XW2A 3NDRA 3EH2A 3OT1A 4GFDA 2R5NA 2VHUA 3NWEA 4R1OA 4BNGA 5BOSA 2GWRA 2AC4A 1PJBA 3TQFA 4NNJA 5IKMA 3QXGA 3K1YA 1WBDA 2OAEA 5JH7F 1JHUA 1KP2A 2ZRCA 3A6PC 4LDZA 4ETIA 4FGKA 3SFZA 4K3VA 4AZ3B 4CHTA 1KF0A 1DIGA 4EY7A 1NPYA 2V65A 3ILSA 1KJZA 3AP1A 4E07A 2IP1A 2VDQB 4ND3A 3SSAA 2Q8PA 2C77A 1X38A 4XWOA 5K0TA 1X1BA 5B37A 4N0MA 4HEJA 1UWKA 4PFJA 2G4LA 2LDBA 3QSYA 1A82A 1E7RA 3MRSA 1Z5VA 3AI2A 1SH7A 1FP6A 5GM1A 2LWIA 3ZNQA 3ACBA 3RC2A 4OJKA 4CU2A 4ZDJA 1QU2A 4O63O 4B84A 2O19A 2GAFA 2PMDA 3DEYX 4I9FA 4PC6A 4TKUB 3NIDB 2W70A 1LSUA 4H0FA 5GVSA 4I2NA 2XCUA 5CT4A 4NZZA 4MW1A 1T9GS 2XWPA 4FQ7A 1JYSA 4TV9F 3QEAZ 1CY8A 2WAXA 2H57A 2A9FA 1NNUA 1CQPA 5B4UA 2J8ZA 4L4RA 2HJSA 2FXIA 2JAOA 4YAJA 4FXPA 5FFFA 4YWJA 3BK7A 4UMEA 1R0XA 3OICA 5KNCH 3ZHOA 2OPBA 2W2KB 5FTJA 1P29A 3ROEA 1PDVA 4RD6A 3H1AA 5KNBA 2AVNA 1Y6GA 3DEFA 4WBXC 1D2GA 1PWEA 4U39A 2AE1A 1E5QA 2E82A 2R6DA 1E9CA 4ASUD 1YJXA 2IL1A 2W6OA 3H2HA 4KFSA 1EB8A 2GZRA 1ZRHA 3SYKA 3DJFA 4FGSA 2PNJA 4RIGA 5KYUA 2NU8B 3RO7A 5CXUA 3TLJA 3HYNA 4QU8A 1YQDA 5F1PA 4MB0A 1XPOA 3EYAA 2G80A 1HTWA 2WZQA 3ADBA 4AS1A 4QUDA 5B36A 1XEXA 2ZCVA 4PFSA 2FU5C 3W2HA 1HNNA 1O9BA 4NMWA 3L79A 3BZBA 5DTIA 1XLTC 2Q6KA 1R0KA 4AS3A 2RHOA 3RRZA 2XUIA 5B58T 3BKWA 1O97D 1XZFA 3C7DB 4NI5A 5HCUA 5BW6B 4ZI3A 2GI4A 3L0CA 1VYHA 3LPNA 3G79A 3ICCA 5FOVA 5LBIA 3TTXA 1YS7A 1TXGA 4W6ZA 5JDIC 5KBYA 1B0UA 3FDJA 3BMXA 1GQQA 1PRYA 3F3YA 3OOSA 3P9YA 2XGSA 4D25A 1PBNA 1WO8A 1VJRA 4NHEA 4BNDA 5BSKA 5K03A 1DBSA 1XKXA 3GA0A 1N75A 2BGJA 3BJMA 2RGAA 3D6JA 3EY4A 4CU5A 3C3PA 5JH7A 1Y98A 4DBZA 4TLMB 1H1TA 3FYUA 4R3NA 1SQSA 3NBZC 4JNCA 4PCAA 1GPWB 4E31A 1A4XA 1PTJA 3BHMA 1CYEA 3T7DA 4CF3A 4EPXA 3K3PA 1T0UA 2J9YB 3QUAA 3VPFA 3ZBUA 4F3CA 4LZPA 2WHYA 2J5XA 1LH0A 1JNXX 2UZAA 3D6NB 2EJWA 3FHJA 1QYDA 4GSYA 5C7LO 3N8NA 2DPXA 4G5QA 2CWWA 3OLXA 2QN1A 1XVUA 5I7FA 3V9PA 1NOIA 5EJ8A 1ISRA 1MB9A 2VTBB 3CX6A 4K9OA 1EDOA 1UW9C 1M8JA 4WMLA 4V0MA 4YT5A 5DWQA 1C1DA 4XH9B 5A7FA 4TV9A 4PF1A 5FLYA 3ZJTA 1QH1B 3G89A 5IJZA 3HDVA 2PM8A 4J7CA 1V9CA 4NAUA 3WDMA 4B4KA 3U09A 3TXYA 5IXYA 1L3CA 2IJGX 1RIFA 2Q28A 3JQDA 4IOJA 3PA6A 4Y2GA 4DCMA 1JZQA 2QPTA 4ZV4A 4PINA 3S1LA 4LXGA 4QEZA 1K92A 5B7QA 1XPJA 1SCUB 1BMFA 4U9IS 2DCUA 3FTPA 4EFKA 5A03A 4HSEA 4PM4A 1UDCA 3BC1A 4IH9A 2AKYA 4UVIA 2HI0A 3TIFA 4EPRA 3GFOA 3HBAA 2Y93A 4PONA 4IV8A 1HGXA 3NB0A 5FAKA 3WLNA 3KC2A 4ITRC 1OXSC 1M5RA 1F0YA 2A9RA 3OIVA 3A7DA 4JA2A 1TPZA 2QOEA 1UXGA 2OWEA 5DRTA 3JYQA 5HS6A 3TUIC 4EVRA 4XGNA 5HKKD 2EQBA 2PUFA 1NW4A 5F9MA 1W47A 1MO2A 2GPAA 2KBEA 1N9ZA 3U4QA 3N2NA 3F47A 5CA1B 1VKOA 2IKSA 4LSWA 2IP4A 3FJ1A 4OPMA 4BV9A 1Y63A 1KETA 4YCLA 1U80A 5BWOA 2QJTA 1QQ6A 4JX9A 2VXYA 2CBGA 1W4LA 2HTFA 3WRYA 5F77A 4EPYA 2CK3D 2OOSA 4TLAA 4IDHA 1BRMA 1AQIA 5EJ2A 2PGXA 4L08A 4NXNB 2VEOA 2RONA 2WVHA 1T2CA 2D4HA 3GD7A 3GFRA 4ZAVA 3ZE9A 2RKOA 4YRSA 2HF8A 3EA5A 2ADFA 4CMCA 1KFCB 2CBXA 2XEDA 3F96A 4PXYA 3ZR4B 3SJAA 6CHYA 4LEIA 2DQ4A 3E9EA 3SXUA 4ZOBA 4D4KA 5ETJA 3WIEA 3KWLA 3OPYB 4JJIA 4XVUA 3AVYA 4UVHA 2BLNA 3UC9A 1QIEA 3DBHA 1V41E 1VIAA 2FY8A 3K5IA 2FWAA 3U7EB 1QXSA 4INPA 4B3FX 4OUDB 2BUCA 4L0CA 5K99A 1XXLA 4P36A 1E32A 4BV2A 3A36A 2ZRGA 1JHDA 1PJAA 2OGTA 2QZ4A 2ZSUA 1TKCA 2IPXA 1HLFA 1OZ0A 4V3CA 2YJZA 3V80A 1HOTA 4U0JA 4BRUA 1O9GA 3INRA 4OQQA 5H80A 5F5LA 4Q03A 3D54D 4IDDA 5KQPA 3MQFA 4LJYA 4IOLA 3TTYA 3VPGA 3FMPB 4LYYA 3VKHA 1RKVA 3RSFA 5AT1A 1NKTA 1OFGA 4HO1X 5F5XA 4CT4B 4R0MA 4YUXA 5JY6A 3OEWA 2P77A 2Y1DA 4DR1B 1QX4A 3RTDA 4DWOA 2DZDA 1E0DA 3JQAA 3OMLA 4KXWA 1SOVA 3RSLA 3FUTA 1ZJZA 1J5PA 2HXYA 3PPVA 2P4EA 3ICWA 3QU9A 3JVDA 2J4DA 1KDTA 2WMDA 3H0CA 4M98A 3JAKB 3CVUA 5ALSA 3LQQA 2PCJA 4MUIA 4TWZA 1U98A 3R9XA 4JR1A 3P2YA 4CTKA 4BN5A 2WTMA 3CF0A 3NBMA 3KTAB 3QXJA 4U8GA 1MOSA 5B12A 2ZVPX 4H3SA 2BGTA 4GI2A 1OZGA 2GJ4A 3KV1A 2PRZA 3LUAA 3CIOA 3GYBA 4ENSA 1LK0A 4AIIA 4CKWA 3MBKA 4KIWA 4X7RA 3A04A 5BUSA 2AMFA 2UZ1A 1JU4A 3FUWA 4X7PA 1ENPA 3ZHQA 1TKAA 4PC2A 1DQYA 5JWOA 4GZLA 5DX8A 2E2WA 3RYHA 2VK8A 2O1XA 1DARA 3FMOB 1KH2A 5K3BA 2AQHA 5IJAA 4FFDA 2YMQA 4DYHA 5AUNB 4DV1B 3KL4A 2OP1A 5HPYB 1SHUX 4F97A 3QKUA 1J1ZA 1MNAA 4MKIA 1FF9A 4CCSA 2GHQA 3G8CA 5KHAA 1GU1A 3H11B 3C41J 2HLDD 2RBGA 2C20A 2NACA 1OFUX 2LTAA 5AVWA 1Q7TA 2I6UA 1JEYA 3C97A 2Y1XA 3AIMA 3CKYA 2B20A 4G97A 4OXRA 4Y2QA 3WFJA 2AJ8A 4L73A 5JXIA 3IBFA 2PNFA 4RKEA 4DN6A 3TE7A 1T8YA 2E18A 4ZMSA 4AG6A 3F6RA 3VDNB 4TUYF 1G3QA 1LI7A 5DIZA 4ZOEA 7ADHA 1V3UA 3NAMA 4I8IA 1D4ZA 4REQB 4B3HA 1I0ZA 2CL6X 3ZYZA 2B8JA 1W5SA 2G08A 2AZDA 3WYFA 1OLOA 5H68A 4X61A 2D5IA 2M6KA 1RBMA 2ET6A 2ECPA 3FGNA 1KA9H 3FWPA 5EZ6B 1NBWB 2HIGA 4AFNA 5C53B 4QUAA 4RVGA 3E2PA 3NYIA 3OOHA 2XDAA 2P4SA 3UT5A 3THYB 3U5ZB 3HSSA 3AQ4A 1SCAA 5K8TA 1ZC4A 2HJHA 1S1MA 1ZNYA 3N6RA 2CF5A 2WTXA 2FN4A 4X92A 5HIKA 1N6LA 3WLIA 1U28A 4KCGA 3WWCA 3CZAA 2BHTA 2QX7A 5BMVF 1ZKDA 2VF2A 1CCWA 1CZKA 4KV7A 5DHQA 4KQWA 1BA2A 1T3GA 4G25A 2RGCA 2PH7A 4MKVS 3CUKA 4Q9HA 3LWBA 3OX3A 5L3SA 4BO2A 1N2HA 3GF4A 5AICA 3QHQA 1UBRS 3FG9A 1CUAA 4M1QA 2GBGA 1CDEA 3WGJA 5HJ7A 1PFGA 3D3EA 4RFSB 3B7GA 3OKPA 4R1NA 4F3KA 3II6X 5IDXA 3TUZC 1CUJA 3H84A 4MPPA 1K75A 3QLTA 1T9DA 2OMKA 3FAZA 4FE3A 4DDTA 2OXFA 1ZGJA 2VK1A 3EZ6A 1F2UA 3K70D 3TH5A 2BFBA 3MWDB 1S3FA 1DQSA 2XCLA 4Q3OA 4YJ3B 3KKMA 3NH6A 1QAMA 1S8OA 1W76A 4HQFA 4P3YA 5T5QA 2WU1A 3QHPA 3KCNA 4KVAA 3E84A 1DKRA 4XIYA 4FFBA 2B99A 1E1DA 4HAOA 1HORA 4B47A 3ZLUA 3SOZA 4C0WA 4RL4A 4D42A 4J03A 1P1KA 1NPTO 2YS7A 4R0NA 1HQKA 3Q3GE 2KS6A 4MGKR 5CLHA 3TTUA 2J6HA 2H65A 1TUBA 3DDZX 1H9BA 2BFEB 4L5YA 2W2MA 3H2SA 3VQTA 2AF4C 1N2CE 4RK7A 1GPMA 2C4NA 2QWXA 3TIIA 3Q1LA 5DRYA 2V7BA 5JNRA 2JFPA 4GPEA 1DG3A 1AN9A 3QVWA 1ZEMA 3E9NA 3ESZA 3V8EA 2XTMA 1NVMB 1R3DA 1UEIA 1NUSA 1BMDA 1E2DA 4UFOA 5AI8A 2XE7A 4IDOA 3SVLA 2AN5A 4QWMA 1NY6A 4UE3S 4PX2A 3N8GA 1U8UA 2WJ4A 3K9NA 5J63A 2WVAA 3O8QB 1RI4A 5FR1A 1UM9A 2WJGA 3EPRA 3SMQA 1XTTA 4CUJA 5EERA 4QJ3A 3GOQA 1NJSA 2XYGA 1KSJA 2JG3A 1PWXA 2OBLA 5FV7A 1TM5E 4BMDA 4FJ2A 1YOVB 4TUYA 5C37A 3UBTA 3OQ6A 1T2EA 3UXHA 1JPVA 4DDVA 2YOGA 3O1IC 3WL6A 1LLFA 2QUIA 4O6VA 1Z8FA 5IU6A 4UNSA 2AXNA 3WWOA 4BU1A 4C5AA 4DMRA 4PYRA 4E51A 1Z7BA 1V8OA 2H4WA 4NAHA 2QI9C 3WKAA 3TW8A 3ZTTA 4AZ0A 3NDPA 2H9AA 4QUJA 3IXQA 4NQZA 3LPDA 2PZBA 1WD7A 4FYVA 5D6OA 3GCXA 1RWNA 1I6WA 2F6RA 4WIAA 3NUZA 4ERXA 2ZRQA 2JHCA 2WIFA 4LDJA 1WCWA 2KSQA 4ZODA 2J9FB 4JLMA 4M9ZA 2OK7A 2E49A 4NF2A 1ZINA 4DJTA 4OI4A 2GBLC 4N7MA 1RPZA 1B1AA 4MGIR 3HK2A 1IBKB 1G17A 3PL1A 4BYGA 4JP2A 2CDAA 3OCVA 3HBLA 4R83A 1ZJ4A 3FWHA 1SUBA 5AUQA 4EG6A 4GL2A 1WMBA 3OCYA 4JJFA 2O8EA 3QLVA 5JROA 4X6XA 1ISMA 2IDZA 3PUZA 4C76A 2DXIA 4BQIA 1KEPA 5ALZA 4L4SA 1KE2A 1CQIB 1DXOA 2AK2A 2PO7A 2RJOA 1EFKA 2BEUA 4TX1A 5LKRA 2XD4A 2R4TA 4HH1A 4ZGGA 3L3BA 3R3XA 1EFUA 2CZGA 1GNVA 4RZHA 3HRKA 1SUDA 4KPFC 2VF4X 1F7UA 4URWR 4B6GA 4WCDA 2FQXA 3BH0A 2A4MA 3WWYA 2BFCA 3OPYI 2FSIA 3A1WA 4U63A 5BQXA 1H6CA 4AN0A 5MFPA 2I4RA 4Z1MD 2DPYA 4AZWA 2BEWB 3H97A 4RPCA 1VMIA 5GAJA 1UIMA 1UINA 5DNWA 1GLGA 2JGMA 2NNLD 4LBVA 1JEQB 2UXDB 2ZT5A 1SD5A 4R2KA 2OV2A 3IRVA 2YHAA 1OREA 1E0KA 4YRGA 1OPXA 3AL0C 3H4IA 2FX2A 3AL3A 2Z8XA 4I14A 4WNYA 1SXJA 5T8KA 4FFRA 3A9VA 2NZVG 1L6RA 3GUZA 3OQBA 4G5FA 4UHCA 5F4ZA 2BMVA 3UJ8A 3W1EA 4BVLA 5A4DA 2ZR7A 3MWEB 5KINB 3F4BA 2J3JA 1W49A 2PX3A 2CLLB 1KEEB 4HK4A 4N3BA 1V6AA 1B1CA 2ZVQX 1AE1A 5FPSA 1S3SA 3ON5A 4E11A 1N7JA 2OGZA 4BWGA 3TG2A 2FN8A 3G2QA 2A57A 3HI6A 4LF6B 1QYRA 3V8VA 4PZ0A 3U4CA 2I4TA 4WZZA 5YASA 1CRPA 1S4MA 2VPZA 2Y68A 8OHMA 1JQDA 5FWDA 2O48X 3LXUX 2MSNA 4MP8A 1GR1A 3JPYA 1V43A 3U7FB 1LV7A 4FNMA 2D1SA 3J7TA 4IIDA 4OH1A 2HMTA 1DJOA 1DTWB 3VSAA 3U7QA 2JLYA 2OMEA 2WWGA 4AWXA 2C1ZA 4FX5A 3G5MA 5G4KA 1GUDA 4QQ8A 3DT8A 4A5SA 3I0MA 1GCIA 3AOEC 4G63A 4UZEA 3B9RA 3B3FA 3C6BA 4OU4A 3W79A 4RGBA 1W88A 4MGZR 3QPDA 4LQ4A 4TV8F 1QF9A 5IVKA 3KBOA 1ZK3A 4YXFA 1DWPA 1J56A 1UZMA 3PCRB 2ASVA 1KTIA 3ELYA 4DMUB 1UDBA 4A03A 4OB8A 4UDNA 3NCHA 4JIGA 1N6HA 4OOFA 5BMOA 2EKLA 1FLAA 1PU2A 2XNSA 5EYPA 3N1UA 2F1RA 2FZ5A 2H52A 3NP7A 4Q47A 4Y2YA 3FSEA 2ZREA 5D3QA 4UAUA 1BXKA 1CRWG 1JVBA 1YBHA 2HHAA 4OM7A 3UWSA 1NYTA 2XVZA 3D6VA 3ZWCA 3MOIA 1M5UA 2VDNB 1EDBA 2R8YA 4UTZA 2NYUA 4Q9JA 2VNAA 3ROTA 3LBIA 3V34A 2A8YA 2EJVA 1L5ZA 1Z62A 1HNZB 3D8TA 4P58A 3I4FA 1E63A 4FZVA 2BELA 2OQRA 4CM4A 1A8HA 1JR3D 4HYTA 4PLGA 1UBTS 1BAPA 1OXBB 1XCMA 2JGDA 3OAAA 5H4HA 1T4CB 3A28A 3CSSA 2AI2A 4RUBS 3HV2A 5AP9A 4ZAZA 4TLLB 3NI2A 1H3FA 3GMDA 4HAWA 4U3JA 4X44A 4HWGA 2ZB4A 1C14A 2HRRA 2RHRA 4UBKA 2Q5OA 3LMKA 3TZKA 1YVRA 5AJHA 3L18A 2O3JA 1F7VA 1Z5GA 1LLCA 3WGTA 1BHJA 3OJFA 4OAQA 3FN4A 3G2HA 1R4MB 2IHBA 4Y0VA 3JQEA 1DOHA 1ENOA 4EITA 5JXGA 2GJ8A 2G28A 3KFVA 4M21A 4RCVA 5IF3A 2X23A 4GOMD 3W3AA 1XZ8A 4W99A 1UZAA 1VBKA 1GXSB 4NCHA 4X1IB 3AOGA 1D07A 4AULA 1EAYA 2GK6A 4M0KA 3UMSA 4LJ8A 4OD0A 3RBAA 3LBHA 3LYUA 1I5RA 3D5TA 1GU0A 3T35A 1J20A 1PGOA 1XZJA 4JBWA 4G01B 4MINA 5ED0A 5JPIA 5IKOA 4F85A 2FSVA 2H1FA 2YKGA 2FPLA 3JXEA 3Q3EA 4G07A 3KLMX 2BTEA 2V7QA 3NATA 3RS9A 3NM6B 4XOUA 1P9NA 3WKDA 1A88A 3VDMA 1IZZA 5A9TA 4XYLA 4XD7A 3L07A 4F4UA 1W5FA 3FOAA 2ZR8A 3KSAC 3BREA 3AL2A 1YE5A 2WD7B 1ZD1A 1YQUA 1KI1A 2EP7A 2GVZC 2GZAA 2VUIB 4MQ4A 4B81A 4EJSA 4KPEC 4TTSA 2ZTHA 2H4YA 3ZWXA 4LHSA 4BAZA 4TV8A 3OJXA 4UNIA 3LQYA 5E2BA 1F0PA 1ADYA 5C52B 1XPRA 1W0JA 1PJQA 1WD5A 1R4NA 2Q6LA 5HJ2A 3ND6A 3NDIA 4J16C 1OFIA 2IEBA 2AW5A 3JVUA 3RABA 2JZOA 1HA3A 2R8PA 1YVPA 3C39A 2IS4A 1CY1A 4MUEA 4M1WA 2O5CA 2I29A 1SVMA 2ZJ6A 2XA1A 3WLPA 5FV4A 2X6RA 1AN0A 2BM9A 3H1TA 4HGNA 3ONWA 3G02A 2NW6A 3T7AA 4D44A 5DM70 4DLKA 1M9NA 1D3AA 4PSKA 2ZW9A 4YN3A 3CSDA 4KDRA 3RREA 4DDWA 2HPHA 4GYYA 2DX7A 3W9UA 5BW4A 3CZQA 1MQSA 4D6PA 1MO3A 1Y8ZA 1RWWA 4O1IA 4Y7DA 2PX0A 4BC1A 1QF6A 3EOAI 3I2FA 1F20A 1K63A 2OG1A 1JI3A 1FX1A 1VB3A 2A7QA 1L6IA 2ZULA 3HDJA 3ND5A 3OJLA 4IF4A 4LX0A 2O6HA 4M37A 4BB6A 1UFVA 4D82A 5HGXA 1N5KA 4PZUA 4R51A 2GDZA 1YQ9A 2JD2A 1Z0ZA 3P2EA 2LE0A 3IEUA 3U2QA 3BXZA 2ADMA 1RD4A 2P27A 5EIBD 1ABEA 4U7GA 3RVSA 4C4XA 2AOUA 3EZ9A 4DVGA 1WJGA 4MDYA 2VG8A 3V55A 1X77A 1U0SY 3A2NA 4GQIA 1SBQA 2RHJA 4RHUA 2O2SA 5KS2A 1I3KA 2NO4A 3DLPX 4Q4LA 1YVEI 1TM7E 3ECAA 4J1TA 4NFLA 5G3YA 3B6EA 2X15A 3IKJA 3VR3D 5FUBA 1E3EA 3OUUA 4NPAA 2FWMX 2YWHA 3SHWA 4E7PA 3P7MA 1DE0A 3KPVA 1TVEA 1ARZA 1T2AA 3BD7A 1G21E 4XVHA 5I9SA 3V4FA 1P8AA 2FG7C 3GBPA 2BFWA 2Q1XA 2XUOA 1M1NA 4PTYA 1KPGA 3OWHA 4KMMA 3IP7A 3T34A 1CEXA 4CI0B 1W94A 5DTJA 3AESB 4MWEA 4TRRA 4MW4A 2J30A 4L22A 1NXQA 5JXWA 3E2IA 4TXLA 4LOKA 2VJMB 1JG1A 3OCUA 2RHMA 3KUKA 2FG6C 4Z9FA 3WGLA 4ZANA 5ITWA 4ZTBA 2FFRA 2J0UA 1N6NA 2GPTA 3M4YA 2FA9A 1JB1A 2RHBA 4ZAFA 4DPKA 4P4LA 4ER5A 4RO0A 4UU7A 2YRXA 4MVCA 5HKAA 2GTPA 2IHKA 3IUBA 4R7GA 2R3SA 3EXAA 3JR3A 1KOLA 4FMDF 3E05A 4RGYA 4O2AB 5EN4A 4JYZA 4QVIA 1XLWA 2BY4A 1ECJA 3FLBA 3CZRA 4HFNA 3GRUA 4GDFA 2FOIA 1W36D 2J07A 4LGMA 4TRNA 1E2GA 1ZK0A 3GJTA 1QV6A 2LGJA 2FR1A 2VPIA 1VBNA 4IINA 1EI9A 2IF0A 3VC1A 1YFKA 3GRFA 4X1OA 1KOFA 4E1AA 3O8RA 1JDJA 3AWDA 1I4EB 1BXZA 1FVHA 4KKXB 2QSZA 3GZJA 3LCRA 1G4AE 4KXQA 2IYZA 3K4QA 4HWRA 5I9IA 1LXCA 4BVBA 2EDAA 2EBWA 2WV7A 4JX8A 3OHSX 3NIGB 1ZNZA 3F5QA 4F04A 5E4TA 5IT0A 4GC5A 5C7IO 4C2TA 3SR0A 4CEHB 3K09C 3EXG1 3H5AA 4HDNB 1QHIA 2PGAA 4LZNA 5F64A 1Q20A 2V7PA 1MNQA 4MARA 2ZWOA 3AETA 2R8ZA 3GROA 4XIGS 5JJIA 2Q2WA 2QMEA 3T1OA 3JASB 3QX9A 3UJAA 1XZEA 2ZOSA 1L5YA 3CH5A 4IWNA 1R0WA 4DJFC 2C9OA 1OAAA 5HUJA 1W4AA 3TDNA 5KVAA 2KW5A 2JAQA 2EWVA 3A1NA 3L9WA 3PWZA 3AVVA 4WN9A 5EXSA 4UUMA 2UUAB 2YHUA 1JI0A 4L8LA 2PD6A 4M1TA 4PCLA 3TFWA 3PQ7A 3CRZA 4ZI7F 5JSZA 3O4GA 4EY6A 4H6PA 1WIWA 2XOKA 3R3ZA 3ASVA 3T5MA 1UKZA 2XMQA 4V24A 1R9MA 3H8JA 5F78A 1V9SA 2P30A 3PEEA 2ZBPA 4XEUA 3SNKA 3VAAA 4B5KA 5DXAA 2CV0A 1F3LA 4IWYA 3DYVA 1KI8A 2YWXA 3IBGA 1XU7A 3VX3A 5CFMA 1QC5A 2GZDA 4CM8B 2ID4A 4ZIRA 2FPPA 1PFYA 3D7LA 5CEFA 4X85A 3BEOA 1YO6A 4CDNA 1TT7A 3KAKA 2OL4A 3QVXA 1W8DA 3GCZA 1L5HB 5EP1A 4BLWA 1M1YE 3KK0A 4CKBA 4DY4A 1AXRA 5BN4A 3RKSA 1XN1A 3QEBZ 4KW7A 1Y1TA 2A1UA 4N01A 4NFYA 4NR0A 4ZK2A 2IW1A 3STYA 4R98A 5DNCA 4B75A 4BRSA 2WUEA 3IELA 2XNKA 1UMBB 2JFNA 1TO6A 1NAIA 3NVMB 1RI3A 2EW8A 3WIUA 1AU9A 1HPLA 3GGPA 3M6VA 1J0BA 4L9RA 4RMIA 5CTAA 1S7GA 5JCZA 1QVWA 5J43A 3ELUA 1MD9A 3MMSA 3EF1A 1G20B 3L06A 5AMXA 4DM7A 2IZ0A 3FF4A 1J0CA 1FYWA 3TTTA 4IMJB 4DUZB 3ZD9A 5AKLA 5AXDA 1CIVA 1UZNA 4EW2A 3RT9A 2YYAA 3EXHA 3WADA 3H2ZA 2VJKA 3O94A 5JSFA 2O4UX 3HS3A 4NBKA 1E6LA 2AV6A 3VSCA 2X0RA 4L74A 3ENNA 5AVSA 5EIOA 2G1AA 3KLPX 3B5JA 3ZE0B 4BFYA 5TJ9A 1C5KA 4M76B 3DL0A 3P9ZA 1YHZA 3DBOB 4PO8A 2XOXA 4A0HA 3U44A 2X0DA 3WYCA 2J6IA 1E3JA 3O47A 3TSWA 1E1QA 4G1UC 2ZRHA 1FIUA 1PSDA 4II2A 1C3VA 1T1GA 4E2FA 1H4SA 4BWYA 1BDHA 3FWZA 2EIHA 3KOXA 3A4IA 1A5ZA 2GJKA 3L8HA 1GPNA 4JMLA 4Y9RA 5HP4A 5EINA 2FWPA 4KLZA 3KEQA 3OO1A 4WOBA 1C7QA 1R6TA 1RM0A 1T1EA 3RIHA 4DR7B 2ZSHA 4TXHA 3IKLA 3S1AA 1HDXA 3MJSA 2UYGA 3L77A 5BRJA 3IT2A 4US0R 2RD2A 2OZPA 2VOJA 1VG0B 3BGOS 3IQHX 4N82A 1U0NA 1CQXA 3HB0A 2WDZA 2V69I 4J9UE 2ENWA 5JJ5A 1XRJA 4X3OA 3PXDA 3EFOB 2OBBA 4BLVA 2JJ2A 1IPFA 2HJVA 4BNHA 4ZI7A 3DOOA 4TMKA 4YBZA 3A26A 5J2UB 1M0SA 4RNDB 1CERA 3BWBA 4C43A 2B78A 3C6KA 1OBOA 2ZUCA 2XZPA 2BFPA 4X1KB 1LLUA 3ILYA 1O95C 2DC1A 3UGJA 1AA1C 1A5TA 1M67A 3CFYA 4JFRA 4II3A 2X0NA 2D2XA 2AMVA 1TAHA 5KNCD 1VBMA 5BSUA 4RHFA 4FSDA 3THXB 1O0BA 4NCNA 3HDYA 1OIXA 1A69A 4OMFG 3ZIAA 5IJ0B 3OD5A 5I7UA 2O8CB 1Q1NA 3BCSA 3TRFA 4RVSA 1JWAB 2YY7A 3LOPA 5LQUA 3N0VA 5H70A 2HWUA 4MUMA 4F3RA 4LJRA 3F3MA 1HKHA 1UEXC 2L69A 2Z5GA 4AJ4A 1Q0ZA 3UOWA 3K2BA 1FJ2A 2H2FA 2DBYA 2OHIA 5D7NA 1WV1A 5FWYB 4OV6B 4TXMA 1TI7A 3SJ7A 3PB3A 5DYGA 1TRKA 4X6LA 3TOCA 3K9LA 1X70A 3A6EA 4RETA 3UAGA 4CW7A 1GYRA 2YWJA 1TA0A 1MHTA 2DKOA 3U6KA 1WW3A 4NOKA 2CXTA 3EF3A 3AHFA 1OI3A 4Q9LA 4A8TA 3HFJA 2VT3A 1E2BA 1U2ZA 1W96A 3ORFA 2DUWA 4IYRA 3ZDBA 3IMGA 5FBVB 3CEAA 4Q3CA 2Y1GA 5FI5A 4NC9A 1JMYA 1BN6A 1RU3A 1L4UA 4CLRB 4ENRA 3TRKA 3O4HA 5ANRB 1KHTA 1RDFA 3MAGA 1QP0A 3FDZB 4FBLA 4UBJA 3HXPA 4AO8A 2BN4A 1OPRA 4UNPA 2ILTA 3N0TA 3WGNA 3IT3A 2O54A 2Q9CA 4DBLE 1LNSA 1ZI6A 1WXXA 3MC1A 1Z6AA 3PK0A 4RADA 4AN4A 1UOPA 2Q2NA 2XT0A 2VTEA 2QQFA 1N0HA 3BFPA 3DNPA 5BYBA 2PRYA 1ZD2P 5TXGA 3BRWD 1QOZA 3LOUA 2G7MC 5ISMA 1N7HA 1Y5IA 3HGTA 4HUQB 4Y6RA 1XIVA 2OCKA 3TM5A 5K4HA 2FJPA 4W8OA 2GA9A 3MD0A 2QX4A 1ZOOA 3PNQA 4IUCS 6ABPA 2FEAA 3FPJA 3AUXA 1XLTA 1NW5A 4ZQBA 1SBYA 3T9CA 2VPXA 1ZD4A 3ZWPA 2WIKA 2CHUA 4EHBA 1ABFA 1W52X 2FSSA 2SNIE 2IU3A 2GPBA 2FPSA 1N2CA 2Y1OA 5DTEA 4J4BA 2Q1YA 3IAM6 2JAUA 1G8AA 2NNWB 3ODGA 4ER3A 1G64A 1JIVA 1OT5A 4MW6A 3NJRA 4TPKA 5GJVC 3BMCB 2JIZA 4KGDA 1JAYA 1KVSA 2H0RA 2NO5A 1BEUB 2HNKA 2Y0PA 1E9SA 4HRVA 4JBLA 5DN6D 3O95A 2EFDB 2XLCA 4L4XA 4LYHA 3H6GA 2FKNA 4KPGA 3NBAA 3OX4A 5ALDA 1WB5A 2FZKA 3CF4G 2BKUA 3B38A 3S8EA 3C3MA 4JGIA 2IDMA 4C0LA 2P90A 3VR6A 4XTRA 1HUQA 4FMCF 2FJUA 4F8JA 1K8QA 1KI4A 1RFLA 1QONA 1YK0A 4TT8A 3H1BA 1W46A 4CMKA 2JGNA 1KZ7B 3L05A 2NPFA 3RU9A 3WL5A 2J59A 2YICA 4KDCA 4U7TB 1JDVA 2B35A 4RJ2A 2L18A 2QU8A 1F9EA 1J25A 1K6IA 2ES4A 3AUFA 3KDAA 3KZOA 3M83A 5JD5A 4DFCB 3B6IA 2WYOA 1FUKA 1JHXA 1IN4A 2OSBA 2P3QA 3KIPA 4FWBA 2MSKA 4WKPA 2FZCA 1ZY2A 2NPOA 5EMNA 4JLAA 1XQXA 3ONEA 4Q1FA 5E6UB 5E9AA 5L3ZA 4MIOA 4E70A 1Y80A 2ERCA 3DLAA 5BVHA 1DIAA 5C0OE 3G0DA 3GNQA 4MW2A 1QO0D 1UPTA 5FORA 3PXGA 1RS0A 1PD1A 4EHLA 3LE8A 4FSHA 3GQVA 1KEZA 2GXSA 2ZJ0A 3F7NA 5AXBA 4HRAA 1S7CA 1XROA 1QYXA 3LK7A 2F3RA 1MIOB 2O4CA 3FPKA 4EATA 3UUWA 4ZVNA 3ETLA 5LQKA 1TECE 3KDSE 1FX0B 3MNFA 3OTQA 4J4TA 2XW6A 4MS4A 3UJNA 1QZUA 4REOA 4NONA 3KOZA 4BPRA 1T3SA 3BL6A 3PRHA 1FLDA 5LMUB 3A1UA 2CXSA 2OV1A 2VJOA 2WPDA 4RV4A 4ND4A 1TZJA 3QEOA 2FP4A 2MMGA 3A3KA 1NYQA 3JZIA 3PEVA 3ZD6A 4X8OA 4RMHA 4Q3KA 1IM8A 1XVIA 3QK7A 1QG2A 2PKYX 3NX4A 1ZH2A 4Z4HA 5KSWB 1BCRB 5A7GA 3ADDA 1UJ6A 2QD2A 3IQIX 2TRSB 1FNCA 3EZFA 3H7AA 3NWPA 5C51B 2Q3HA 1XG5A 2O2EA 3E70C 4NENB 4K9SA 5C1DA 4IL5A 3CH7A 4Q9KA 3ZDZB 4XFKA 5CLQA 1YE8A 2CFSA 4G0ZA 1R6DA 4RIEA 2ZG6A 3VC2A 2PJUA 3Q6MA 4LV6A 4OHUA 4CQLB 2YZGA 1PJ8A 2FN7A 1K8ZB 3DUWA 4OLJA 1V7PC 1WKVA 2VQ6A 4YAWA 2OQVA 2H17A 2QRMA 3C16C 4CLOA 3U4MA 3RVKA 1M6VA 3ZLBA 2GX6A 2IYLD 5IC4A 1NW9B 1GSOA 5HMMA 5HOEA 1WQ4A 1T3LA 3FVQA 3I09A 4J90A 4OHPA 5F2OA 4ENQA 2BEJA 4C07A 1JHMA 3P0IA 1U0HC 3LY9A 3SSOA 5KVSA 5K0FA 1EDZA 1BW9B 1KAEA 3FHLA 4FS8A 4UARA 2WHRA 4ZYTA 4C7OA 3MTDA 1VJ0A 3A11A 4EARA 4JA0A 4XD2A 4BZXA 4YO8A 1NRIA 4PLWA 2PMWB 2X5JO 1F1BA 3IALA 1XTZA 1Z7WA 3RS0A 4JHLA 4EUEA 5L9AA 1U7XA 2ZWMA 1OBHA 1QFJA 4XSHA 5E7MA 4V03A 5KPDA 5CK5A 1L7MA 1L3BA 5HKLA 1EUCA 1K86A 3NHYA 4BQQA 2ZDQA 3I1YA 5AVYA 4DJ5X 1FQKA 1H0SA 1XP8A 4JSTA 2P9JA 2BMWA 2KJQA 1C9NA 2W6PA 3WLAA 3GBVA 1H2XA 4E5YA 3F6CA 4ESOA 5FWNA 4PAMA 1Z4KA 2V63I 3V2HA 4P5PA 5D3MA 4AUEA 5CB4F 5FEMA 2NUPA 2HA6A 4R9RA 4KAJA 4IEFB 1ZIPA 4QNRA 5JBQA 3ZI4A 3V48A 1A9PA 2EZ4A 1Q1AA 1Q12A 1IHYA 3F1KA 4HADA 4IXMA 4AVYA 3EFBA 4ZMBA 2IUYA 2WZCA 2R0QC 2R65A 1XNGA 5D2CA 4UMVA 3OLWA 1AQYA 3NBKA 4KITB 1FDVA 4F9FA 1E3SA 3NO4A 2QM3A 2QTZA 3B6JA 4D8XA 1JHQA 5K3SA 4DSAA 1PF7E 1ITZA 3O92A 5KHLB 4MQUA 5JS7A 1LU9A 2VAPA 2D6FA 1QKJA 2HUPA 3AEQA 1C9EA 1NUTA 1QORA 1X92A 1YL5A 3A6JA 2HEGA 1G7TA 1M72A 2ZAIA 4ND1A 4I2VA 5KTPA 3PX7A 3TPFA 1RM5A 3UM9A 2DWCA 1KO7A 1P5JA 2VZ9A 4IHJB 5BWNA 4EW1A 2A1IA 4WZBE 3DM5A 4MLDA 1IJEA 1H85A 1ISGA 4XQ0A 1OHHA 4CTNA 2D2IA 2OV3A 4IQ4A 1R16A 1WHSB 1V5EA 3SR3A 2Q7DA 4ALNA 4DV3B 2ONCA 4V1CB 1V25A 1VL8A 2CMDA 4BFSA 2CLCX 4P4TA 3BPSA 3VKUA 1CR2A 4XYEA 2GVNA 2Y77A 4FKBA 4C14A 4WE3A 4JN6B 3K71B 4PFKA 1T1SA 1NN3A 3VC3A 1V96A 2V5VA 2VDVE 2PDAA 3W2TA 1GTVA 3NHWA 1WSBA 2XH8A 3ZZ0A 4RMGA 4A8JC 5BN5B 2HX1A 1XL0A 4WXMA 1K6EA 3AERA 2QLNA 3PC7A 4PHTA 1JUDA 3N2IA 5ALLA 1MU0A 1HR0B 2WINI 1E4YA 1EUYA 2VDHI 1XDGA 2E6KA 1SCQA 3F4KA 4RABA 4X64B 4A2QA 3NP9A 1UPPI 1NXOA 3B1YA 4XKJA 3R5FA 4O5OA 3VI4B 5CVJA 5BYJA 2XR1A 4WACA 4YX9A 2FEKA 3AONB 5KVCA 4CMIB 2G36A 3FNRA 3C1AA 3V6LA 3KQMA 5JXHA 4EGJA 3A8TA 4RY8A 2PR2A 1FPMA 4G0QA 2ZS9A 3KQHA 1PWHA 4PRYA 3O90A 4X8HA 4E46A 1VMAA 1E0AA 3ZXYA 3FWNA 4N0DA 3LRPA 3C98A 3K1AA 3L5KA 2A67A 1TF2A 3AYXB 2QI9F 4S1NA 3U3RA 1DRJA 4BLRA 5JQGF 3HA3A 4KNVA 2Q4BA 2ZT7A 1H65A 2X4LA 1L5FA 2F7SA 2KQUA 5FAXA 2HTEA 1EJBA 1RM3A 2EFJA 2FUKA 3EIUA 3F78A 4B3TB 1JYFA 2C4TA 4CTJA 2Z3WA 1J09A 4KRGA 4DCPA 4DRXB 2UKDA 4AP5A 4TRJA 2H1WA 4BX9A 3N0XA 4U9HS 1JFLA 1UM8A 3KJQA 5CB4A 4MP6A 3KEMA 4AJIA 2AJDA 1JQLB 5E3JA 4CEJA 5C32A 3ABZA 4NDZA 3FVRA 4QECA 2R6FA 3EWNA 3F9IA 1EP1B 4MPTA 1UF9A 3ETJA 1M10A 1O94C 3RGWS 2QM8A 5EKTA 3ZNOA 3D4OA 3PLRA 1FDUA 3GEMA 4GZ5A 3THSA 4AF7A 4OMCA 2IZ7A 1DBRA 2SKCA 4RGQA 3VO2A 1W7AA 4OQFA 2AQ8A 4E13A 2ACKA 4R0VA 1QO9A 1JR3E 3DOFA 3BD6A 2RAFA 3MYRA 1JBKA 2H9IA 4ABYA 3CKLA 2VZ8A 1JZTA 1U1DA 4NBUA 4ICIA 5REQB 2HD4A 2WWHA 3SLGA 1TZCA 3SOPA 1A9XA 3LP6A 4DLSA 4G8BA 4TZ6A 4FU0A 2YXLA 2W6IA 4OATA 1NFFA 2D7JA 4LHXA 1OU4A 3LT2A 3V5NA 5EXTA 2WF9A 2AD1A 2HA2A 2C3UA 1Z4QA 2NSYA 5CLGA 3MXOA 1RHMA 3S4YA 1ORTA 3A4TA 4C7BA 1DJPA 3ORRA 3IODA 4IHKA 4QLBA 1JPJA 2ZWPA 3A58B 2ZIWB 1A4UA 5CT6A 3NEJA 4TQGA 1L5NA 1PL0A 4O5AA 5DNAA 1IVSA 1U9ZA 2PX8A 3PT5A 2RMKA 4FGUA 3M4XA 2Q2OA 2UZ4A 3VVBA 2QSYA 4NJEB 4U6QA 5EJ7A 2HA4A 3FNFA 5LMZA 3HCPA 3QH4A 3BJIC 4BMXA 4BNVA 1BOFA 1E7QA 1SIWA 2AEEA 5EE0A 1MV8A 1L7NA 3CLUD 3F9CA 3BTSA 3O3CA 3D8SA 3VHLB 4HI0E 5JS2A 2I34A 2BP7A 2UUPA 2H7YA 3WAJA 3QPCA 1T3HA 1G21A 1SVLA 1K0FA 2LCIA 3HFGA 3K32A 3HO6A 1EFPA 3COSA 4MXDA 2P6UA 3IVMA 4XX1A 2QMUA 2G1UA 4FJ0A 2FLKA 5JQGA 5LQMA 4EKDA 4GPIB 4WFQA 3CNHA 1R8QA 4RPKA 2VDPB 1T4MA 3BX1A 2B7CA 4KHPB 1BD4A 1DKNA 2EL9A 2QS9A 3IJRA 3QXSA 4GSLA 1PWZA 5FWXB 1D2AA 1P6UA 4HWKA 1MVOA 2BTOA 4GNRA 4D81A 2PUDA 3E23A 3LOQA 3OQVA 5DNUA 5JBIA 1A8SA 4B8ZA 3L6EA 4F45A 3OQPA 4HNVA 1OLUA 2C88A 1QQ7A 4ML3A 3CUVA 1V6SA 2D13A 4JC0A 3OM0A 4QDXA 3TYXA 2VBIA 4L27A 2JZCA 1ZJ6A 2PAAA 1Y6FA 2ZIUB 3H9EO 4K1XA 5HRAA 3PIRA 3AYZB 5FOSA 4K8RB 1XTRA 3KR0A 4EB3A 3F6BX 2VZEA 1U7WA 4M89A 3O5AA 1IDOA 1SIOA 3VV3A 5E9WA 4P35A 3CQ9A 3EDOA 4EVIA 2CW5A 4L8FA 4R2JA 2MSLA 3LQ1A 1QIMA 1WXIA 2HV9A 2WT9A 4YTEA 5L7YA 3C3YA 3C24A 3CLSD 3TSZA 4OJYA 4R8SA 3PT9A 5HIIA 3UIEA 4JOSA 3N5KA 1ILWA 1YV9A 4IIGA 4M0FA 3NAZA 1KERA 2ZVJA 1JF8A 1W0CA 1FP4B 5D7BA 721PA 1VG1A 2C2OA 2WYHA 1JQAA 3DKRA 4M0UA 4BU0A 5LU8A 2IYPA 1MH9A 1RMTA 1QCCA 2IHUA 4LOAA 1GGVA 1IMOA 2DUUA 2YVAA 3IMFA 4PZDA 1OIWA 4D9JA 3OWXA 4WESB 2BV3A 3OZSA 4N0PA 5JUWA 1YZHA 3H6HA 1QIHA 2MOKA 2DBZA 1D4AA 1JP7A 4WI1A 2NZYA 3EZ2A 3FE2A 3HXTA 2BCEA 5JD6A 5JMTA 2IYVA 1NP6A 1RXIA 3CF6R 1NJ2A 4IVPA 1NLZA 3R7AA 3TF5A 2PZEA 1G8FA 4Q9NA 3VZSA 3D8HA 2HPVA 3DV0B 1KBZA 1LZLA 1J7JA 2ORVA 3KLNA 2OFOA 4LCEA 2XNDA 2BGIA 3OCZA 1VI5A 1SXPA 5JI3E 2Q3CA 2QYHA 3PX2A 4RLQA 1DLJA 2XYHA 2C9MA 1YONA 1ZN2A 3C6YA 3D5QA 4Q1CA 4TYMA 5ILGA 3ZNPA 2NP7A 2VP4A 3GLIE 2PQ0A 3OCXA 3GC6A 4RUKA 3WMXA 1CY7A 1RLMA 1ECPA 4EO7A 2ERXA 3FF1A 1RYFA 1OFTA 1EUDA 1X1CA 1O89A 1PO7A 1HBJA 1PZNA 1R12A 2X1LA 1SHZA 3C5VA 1CUDA 3HN2A 2PL9A 3JQ6A 1GLNA 4E14A 4E33A 4QXRA 3QBVA 1XX6A 3ZWOA 5I51A 4EBFA 1VHDA 4I46A 1Z6PA 1SELA 2M32A 2R44A 3AUYA 3AVTA 4R1TA 3IMEA 2YX1A 1AUXA 1XMJA 3NQ41 1P39A 5CX1B 3I64A 5LKAA 3H04A 3WGOA 2YV3A 1F06A 1N32B 1ANKA 4IO0A 1U4SA 4DC0A 1GDHA 1UBSB 2JFGA 2WTBA 3QYFA 1ZKMA 3WISA 1M1YA 5BYKA 2H3HA 4KL8S 4OHWA 4MYDA 1JHYA 1QRRA 5ARBA 1TVCA 4RDHA 3EDRA 4AQDA 3IS3A 1BVYF 3RS2A 3L7BA 4CIVA 4JT2A 5KTKA 1Z0SA 1UBJS 1EFVA 4Y9SA 3CZPA 1TEZA 3QVKA 4V1CI 1Y0BA 4YV7A 3UF0A 1UQUA 4NABA 4KR0A 3WGGA 3ZWYA 1ZP6A 1GEEA 5KAMA 3Q72A 2QN6A 5G02A 3R7WB 3ZHTA 3EUFA 1WNFA 1XYYA 2BEKA 1XWWA 4I3FA 4F5EA 1U1GA 1XZLA 3HB9A 3M4NA 2DCMA 1VLLA 4PHCA 4AECA 2NX2A 1E1CA 2F1KA 2Z6VA 5J2TF 2ZBQA 3P9SA 1VZ3A 1U7OA 3ZDYB 1Z0AA 4MAAA 2ZSBA 1GP2A 1QIFA 1WCYA 1Z2OX 3FKJA 1Z37A 2Q1WA 4FI3C 4MYRA 2N0SA 2B94A 1PKEA 3LNTA 4MCJA 2YBVB 4R1MA 4ZOLB 4AROA 1ZU5A 3BWDD 4ENWA 1TAUA 3N3AC 4KWCA 5HVNA 1KYIA 2X2EA 4IDFA 4JODA 4MCAA 1ZH0A 2P79A 3TS1A 5IM5A 1T36A 1O6ZA 2GOYA 1E7WA 1P0CA 3DG9A 1UUFA 3GGCA 1NJ1A 3AV3A 1RKUA 2F9FA 2EXXA 3EOBI 2BKXA 3NAQA 1IEVA 2I6QA 1AA6A 1OXMA 2HREA 4BCBA 1YHNA 5IAGA 2YVLA 4BLQA 1AG9A 1E77A 1E2EA 1MOQA 3A0UA 4EH1A 2AI1A 1RIIA 2JLBA 4MRPA 1KJ8A 2IQIA 5HDBB 2FJ0A 1CHNA 4EYSA 3G8DA 4IOMA 4YT4A 2BR4A 2CK3A 1JAZA 3DZKA 4BNFA 4C5BA 2OD2A 4D9FA 5KTYA 2EFGA 3BQMB 4RJTA 4QO7A 1K3TA 1PK7A 3QOWA 5LZ2A 2H51A 2EWWA 2PKXA 3JATB 3FCYA 4ZXFA 1C3LA 2I4NA 2NU6B 4AP9A 4YRAA 1XZQA 2IK8A 3QI7A 3THWB 3BIJA 2PUJA 3WWEA 4ALKA 1GZSA 2JLCA 1S3GA 3EEQA 1RLJA 4TWAA 3N2KA 4QYMA 2N1MA 3OKCA 2R7NA 2WFLA 4KUGA 5EGSA 4WNIA 5BSWA 3OE7D 5L45A 5LQCA 2G5GX 3HV0A 1QH0A 1XA0A 1R27A 2IS6A 1RXEA 1PUXA 3G5UA 2BMFA 3CR8A 3DE2X 4XTCS 4B83A 5AVJA 2PYZA 3MVEA 3KD2A 3AILA 3W6OA 3NW9A 3NH9A 2XGGA 4DIKA 1KU6A 2QLTA 3FWYA 4M0PA 1GGEA 1SAYA 1EZ1A 1YVUA 3O9ZA 4KXLA 1R5NA 5BQPA 3UA3A 2PIAA 1XD8A 3ADKA 3LHFA 4RAQA 5LA6F 1R8XA 3IJEB 3H99A 3IX7A 5IZCC 1OZFA 4HCJA 2BGGA 1Y7HA 1QGUB 3QUTA 3IEKA 3MUFA 4IIVA 1FXUA 4LY6A 1K7XB 4PXSA 3EX7C 1XYVA 4J16A 4W5WA 2OHGA 1KAOA 1XTUA 3QKTA 1QM5A 3VVCA 1YRHA 2J1LA 3SIRA 3VZBA 1K6MA 3G0CA 3NTUA 3OHMA 3OZCA 3RUIA 1L8AA 4OQNA 4L5IA 3QJ5A 1YZLA 2QDKA 3WLJA 1F8UA 3COPA 1SXIA 4DKJA 1OB5A 1YRWA 4M6WA 3TVTA 1EVQA 3QX8A 1U3VA 3EXFA 5TMBA 4P38A 4V2IA 3C43A 5I8WA 3I3SR 2OOKA 1KIAA 2IRWA 3I34X 5D5QA 1IM5A 2HT6A 2VDWA 2YIDA 1DU4A 4LOLA 3RSCA 3VJKA 4C4SA 5F2NA 1ESMA 2PGLA 1C7IA 4NFSA 5KOHB 1YQXA 3R41A 4UZFA 4XM1A 5J2TA 4C0JA 2L0XA 4QOHA 2VL7A 2XWSA 1FL9A 1CJBA 4TYPA 3W8NA 5F73A 3VH3A 1MO5A 1A4RA 5JLAA 1RRMA 2Q0HA 3SDBA 3ZBTA 3K6RA 2D1QA 1TYEB 2Q3DA 3ZXSA 3LA8A 3OT1B 5MN6A 4QDJA 1D8TA 1GCAA 1ZJYA 3OIFA 2D8AA 3S28A 2NV0A 4D0NA 2AD5A 4WK6A 2WMOB 4QQRA 4CKEB 3HQ4O 3IUNA 4ZCLA 3OY2A 3QTLA 5TVKA 4FN4A 3IC5A 3MBOA 4JUIA 4PN7A 5SZHB 4AY6A 3BT7A 2QHXA 4IOKA 2ZDHA 4K9QA 3M6WA 1TMKA 1X1EA 1J8YF 1I6KA 1OC2A 2R4QA 3WL8A 5CYGA 1G38A 4D9GA 2VYCA 3ZEAA 1KVRA 2YINC 4LQCA 4OK6A 4J7AA 4J1NA 1P1RA 1VDZA 4HDQB 1VYUA 1HQDA 3W34A 4U7DA 2HLNA 3OFVA 4E94A 1T43A 3D3WB 2HLDA 3L1HA 5BUQA 1EIWA 4MKXA 5J4LA 1WUTA 4DCGA 2HUNA 1P2GA 3ZZMA 3UB4A 2IZOA 2X9LA 2R6CA 3I0ZA 3HA5A 1L5MA 1T5DX 4PLHA 4DMFA 3L1UA 4OXNA 5EP4A 1S1CA 4LDQA 4EWLA 3RVNA 1BQ4A 3C7KA 2NQTA 3I9V6 4BFUA 2JCVA 4X20A 4KR2A 3FHTA 4CCWA 1G66A 2ZYWX 1NURA 2IIPA 3AZQA 1N8SA 3BH6A 5ESDA 4G0OA 3AVWA 2P6RA 3NMUF 1TL7C 1U90A 3GFQA 3TBFA 1NKSA 2O2DA 1C1XB 1DRKA 2WJIA 2XE8A 1TTTA 1GA4A 2IZ1A 1NXTA 5IBQA 1WUKS 1O0SA 5IC5A 5SYMA 1BFUA 2HMAA 5IEJA 2IS2A 1Q22A 3MB5A 3HVJA 4C78A 2IODA 4GWGA 3BH7A 5T6BA 5I7HA 2JGKA 1MAVA 3IAAA 3NEYA 2RH5A 4DMLA 2Q45A 5LA6A 1P9LA 4LXHA 4BFLA 5JANA 3DD1A 4P4UA 4RD2A 5BSGA 1MAAA 2O5EA 3SQMA 3F3KA 3M6FA 2G0NA 5F76A 1XVLA 1QRTA 3QVOA 2HPAA 4C01A 1Z18A 4JEHA 4D79A 4DA9A 1YA4A 3R5HA 3UGQA 5BQFA 1FFAA 2YASA 4KSYA 4S04A