2HW8A

Structure of ribosomal protein l1-mrna complex at 2.1 resolution.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKMGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 36-MER
publication title Structure of the ribosomal protein L1-mRNA complex at 2.1 A resolution: common features of crystal packing of L1-RNA complexes.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein/rna
total genus 62
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 2hw8A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hw8A02
3QOYA 1DWUA 4QG3A 4QVIA 1ZHOA 1U63A 2HW8A 4LQ4A 5DM60 1I2AA 4QGBA 3TG8A 5DM70 3UMYA 3FPNA 3U4MA 4DFCB 1MZPA 1AD2A 1CJSA 4REOA 3ZQJA 3U56A 4F9TA
chains in the Genus database with same CATH superfamily
1O03A 1SQSA 3THWA 3EVBA 5C31A 3KLOA 1UH5A 1V8PA 3WQHA 2FPPB 4BE9A 4DF3A 1PZMA 1OAKA 1JEDA 2FFBA 4UBMA 4H3SA 2FR0A 4N3CA 3RVQA 1OCEA 4DLVA 2OD9A 1K5DA 4PBTA 2QE7A 3UJHA 2P9QA 2VP4A 4Q7JB 2HRQA 4TRMA 3EVTA 1BQ4A 4UHKA 4ITRC 1DLJA 1QB8A 4JP8A 1ZO8A 5CFPA 2W93A 4ROSA 4WEQA 3UW1A 1THGA 4BE7B 3BCSA 3V7FA 1WU7A 2EARA 4MI1A 4F5ZA 2BFAA 1EHIA 2RMKA 4CLOA 3C3KA 4JLKA 5C46F 2G25A 2EJWA 3ICEA 4M0KA 2PX5A 5HZKA 1QRUA 2PSEA 3DCNA 2RJOA 4JI1B 1FVHA 1SIOA 2OOSA 3I04M 4AX4A 4C6TA 5A5DA 1GTRA 4BVLA 3NCHA 5EJMA 4BP3A 4QATA 1RWVA 3FFTA 4GYYA 2BSXA 3KQPA 1D5CA 3HH8A 4M6WA 2QA5A 1Q3TA 4M1KA 4P4NA 5KYXA 3KWFA 4LI3X 3ZKWA 4JJAA 2HJHA 4IJKA 4TVBA 3GLIA 2ZM6B 3BWVA 2AOUB 2ZUSA 4OFWA 4FDMA 4L8FA 3IUEA 4Q39A 3QEMA 3QFTA 5WRFA 2G1AA 2YWFA 3GCZA 4QVKA 4COOA 4YI5A 1ZW1A 3RJTA 3QNWA 3G13A 4MS4B 2HAEA 3TRDA 4CMCA 3QW4B 1FTQA 1TCUA 3NUZA 5G1PA 1GGMA 4ON9A 5SY4A 1KERA 4DY6A 3OIYA 4R54A 5E1BA 2W4MA 1P2GA 4IVNA 1TCVA 3BREA 3KJHA 2I4NA 3STVA 2GPJA 3ZGNA 4BJ6A 3S1SA 3FOFC 4OVKA 3P9XA 3SQWA 4FKMA 1KDYA 1K89A 1G18A 5EQJB 3SEZA 1D6MA 4ZT3A 3ZHSA 5AVSA 1KVSA 2VK1A 5LB2A 3ISJA 4ZOEA 5IAGA 5FI1B 4DCUA 5EIBC 3RWMB 4G85A 3DUFB 1XXHA 5H68A 1VPDA 2C3UA 4HS4A 3A4MA 4GR4A 3ZIUA 2Y1FA 1NATA 3HCFA 1KSHA 1JSCA 1YCGA 4D9CA 1F8GA 3I62A 4YDSA 3ZLBA 4X54A 3V8MA 4YXWD 4YROA 4ZCIA 2YXNA 5I8WA 1OFTA 2XDAA 4E6EA 2QUKA 1C29B 1NW9B 2HO4A 1SVMA 3EQ6A 4MTCA 4LJ4A 4M9CA 4X9XA 2QMZA 2OZPA 1CJUC 5EHGA 3DL7A 3IVGA 3DWEX 1N2EA 3H8VA 3L7AA 1JDSA 1RHUA 2FPGB 2WHQA 2V6BA 3HLKA 3OJFA 4EBBA 5CFNA 1RC8A 3A3OA 1LH0A 2VZ8A 3VR3D 3WO0A 2ZJ4A 3KQMA 3D4BA 2I80A 1WB6A 2OESA 3AILA 4MW5A 4MYRA 3RYFB 3TVYA 3AU9A 4V0NA 4UU1A 4DREA 4TWAA 1BN7A 4JR1A 2HUPA 3WIDA 1KNXA 3PL5A 4OSPA 1J23A 4MUIA 5DHPA 3DDCA 5K3BA 1LPNA 4P9NA 3KOOA 2AXPA 4BVFA 1I3LA 1Z13A 3GAFA 3HACA 2GF9A 2YHBA 2QRUA 5GONA 4C0AC 3VNBA 3EA0A 1PEYA 4NBWA 1FNSA 5DSXA 1H69A 3S3TA 3UK7A 1C50A 3K9LA 3NX4A 2GN8A 1J22A 1Q1ZA 4R0NA 2J46A 4OSEA 2ISSD 1GGHA 1BEEA 2IZ7A 3EEBA 3H11B 5AI6A 5EIWA 3ZXIA 2IVFA 4G5XA 4F8EA 2Y71A 3QX8A 4UE3S 5KDDA 5JISA 3C6MA 5KYNA 1U04A 4O2AB 5JSFA 1KC3A 2QV0A 1QM5A 3V2GA 4G1UC 1I7LA 2C8KA 4B5LA 3VOBA 2BUAA 2VPYA 3Q3CA 3RTDA 2HWWA 2I2WA 4ZC1A 1TGYA 2G70A 2JAWA 3O1JC 4MR7A 5I7SA 1YRWA 3DBLB 1TD1A 3EIQA 3SM9A 1SVSA 2HDOA 2H7YA 3QU4A 1QDEA 2VDWB 2XMGA 4EVQA 1GZUA 2VG8A 2ZUDA 3ZJ4A 3HYRA 1E3SA 1ISPA 2GSWA 4FCVA 3TRIA 4CMHA 2Y77A 4N0QA 4OEHA 3KDSE 4Z9YA 4F6RA 1SK9A 1TO1E 4EH1A 3TG2A 3FSGD 4IKOA 4QREA 5B1SA 1NZFA 1C9JA 1ZK1A 1SUCA 1U0GA 3AKEA 4EB3A 2HFKA 2WKRA 3U16A 4CQJA 4WKBA 1W59A 4KIGA 1N5IA 1P9RA 1AKYA 2VSFA 2UKDA 2WD9A 3DZFA 1CUEA 2GNPA 1WY7A 3G68A 2OCLA 3IKJA 4U2EA 5I9SA 5K51A 5DFAA 1YZKA 1KQNA 1ZCFA 2I3BA 2ACKA 2OCIA 2VK8A 2I3DA 1G20B 4MLPA 2BDUA 4XLLA 5E95A 1M0TA 4MUBA 4K8OA 4INOA 1TIKA 4X7MA 1GNSA 4HDMA 2VBFA 1I5EA 2I54A 3AUFA 3HGTA 2CBZA 5HGXA 4C43A 2Y6UA 4EWLA 3VVCA 3EXHC 3EK2A 2QN6A 3OCZA 2H08A 2UVDA 3ECCA 1TMYA 4JENA 4RELA 4TVOA 5FA8A 1UJ6A 2WF7A 3B60A 4FC7A 4NJMB 4QQ8A 1YZHA 1ZD2P 1DCMA 3ZY2A 3KYDA 1U90A 1KGSA 3H6KA 3QBVA 4QEZA 5F5NA 1F4LA 2WHEA 4IOKA 4WZAE 4BNLA 5B3JA 4KRXA 4EI8A 3LQRA 1LTQA 3KE8A 4OK3A 1Y4AE 4O2AF 1ZIPA 3IO3A 4E4TA 3N6RA 2CJPA 1GCGA 2VAWA 3HGQA 4O4LA 1KU6A 2FRVA 1RWOA 5H83A 1TMGE 2JGDA 4QXPA 3NIBA 1WETA 2Z4TA 4HWKA 3EYAA 1N78A 1BS2A 4BNXA 4DIUA 3RFUA 2EHDA 3TFWA 1G5TA 3U39A 3L41A 4B3JA 3NEJA 2C4UA 3A9RA 1UOEA 4LZWA 1C8KA 2CBGA 3PUIA 4TQ9A 4V38A 4RTSA 3IUBA 2CL6X 5HTOA 5AI0A 2WBLC 3TQRA 1T43A 4UDOA 4WCFB 2Z83A 3FDZA 5FA6A 4GWLA 5EGNA 1F14A 2ZI3A 4OJKA 3CCFA 1IB6A 3FWKA 1J8DA 4K88A 2ZTLA 1GYRA 1V3UA 5A71A 3OQPA 1P60A 1JIUA 1P2SA 2ZPUA 3JD1A 4I1RA 1R15A 1ZCBA 4JH0A 4K87A 1YI8A 1P2UA 3IUQA 3A27A 1L5VA 4JLOA 4N6NA 4BCBA 2QRQA 3EH2A 3B3AA 4AZ0A 5AICA 2N1BA 4V3CA 3W9UA 4B3MB 3NDRA 1ORTA 2H0AA 4C9BA 1PEKE 4WY5A 3TZ6A 1O54A 3TTYA 5F33A 3M2TA 8ADHA 1GRNA 2DFDA 4MXDA 5B57C 4YUVA 4X65B 2BFEB 1AE1A 2ZETA 4MV3A 3SG0A 1MA3A 1RBQA 1GHTA 1QHYA 1E6UA 3WJ1A 1DO8A 3UF0A 3EMKA 3KOYA 3UTDA 3ILXA 5HQ3B 5HILA 3AY7A 4X7BA 5TT1A 1G4AE 3WFJA 2FMIA 2PGDA 3Q3GE 2PBLA 3AXTA 3HCWA 4IRXA 2YBEA 1N3YA 1ZOOA 5CFLA 4DVGA 4Z49A 4R2MA 3K9FC 1MO6A 1N5RA 2H5LA 4MRAA 4NAUA 2GR9A 3VNSA 3U09A 2A2ZA 5ERGB 2PL9A 1HO3A 3PDJA 2R1TA 5LZ2A 1XRLA 4EIWA 4B3RB 4F1JA 2C2MA 3IT3A 4IOLA 3RHZA 2NTYC 3KCNA 1EVQA 2RHTA 5D5PA 3ROZA 3ZCRA 1KQFA 2HT1A 1JNYA 1ODFA 1E2FA 2BEVA 1ZM2A 4PNPA 2P9EA 4QYWA 2R44A 1RJ9A 4NWIA 3LQ2A 2OKGA 4CM8B 3CVUA 1GQSA 1QX3A 3B1JA 3SNHA 3T7IA 2QP3A 3K0AA 3T7KA 3CEMA 3IPRA 3ZU2A 1QC5B 4ZVTA 5IASA 1CUSA 3QPAA 5THXA 5J3JA 2YY6A 2QZPA 1SCIA 3GMDA 3D5QA 2CEAA 4EG7A 3HCEA 3H05A 3CH7A 3A9CA 3OPYB 5L7TA 1E5TA 1VJGA 2BE7A 2ATIA 4OTZA 4EG1A 1NVBA 2CHGA 3KAJA 4B9AA 3CR3C 4DDUA 4ZMRA 7GPBA 2ZDHA 1E92A 4CN9A 3TR6A 1Q0UA 4B3TB 1EH5A 2B1QA 2Q4BA 4YQEA 5KSPA 1I6MA 4OHYA 3IUPA 2QE6A 4DFDA 3RRXA 3DOIA 3P0IA 2ONZA 1KI9A 1YRHA 3CTMA 1QJCA 3FFWA 5FWNA 3B2NA 2VHXA 5D1HA 3TS1A 3VR4A 4BC0A 1PI3A 1VPTA 3GJ0A 5H4HA 4ETIA 1ZUNA 1QF7A 1GN9A 4G09A 2OLKA 1WBJB 1MA0A 3P0HA 1Z2DA 4RGYA 5E7MA 2OOKA 3T3PB 2BHSA 2BM1A 5BNFA 3TOZA 1N9KA 3FY4A 3ZQ6A 1NJ5A 1U98A 2QENA 4AJ9A 1GEEA 3AFNA 3F6CA 3UJBA 4C4XA 1G8MA 2OGZA 2ZXEA 1JF8A 3AH8A 4DMUB 1CNMA 2R00C 2XUPA 3H5NA 1XAHA 2R4QA 1TQ8A 3LPDA 1T4MA 2AG1A 4YRTA 5A4DA 4IO1A 3L7YA 4WKOA 4BLPA 1M1XB 2BL4A 3B12A 4IXMA 4BMSA 4E22A 4DFCB 3IHKA 3NKFA 3WZMA 3M1YA 3G0HA 4PGMA 1CUZA 2FQYA 1RFGE 2GYVA 4MPJA 3RSHA 1EBUA 1M54A 4IGEA 1UFRA 1N4AA 1AMUA 1Z2CA 1UJBA 3CNHA 5DM4A 3RTGA 4QOJA 1X94A 3Q8LA 4IF4A 5TMEA 5EKDA 4MV7A 3D8RA 1Z2OX 5BXYA 2WINI 4CTMA 1SWWA 4L5JA 5JD5A 5HNKA 1AVTA 1OB2A 5F9FA 1OASA 2EW1A 4US1R 4WXEA 1CDDA 4W1RA 4DM3A 5ALPA 1P4GA 1ZJYA 3CH6A 4NFHA 5DW0A 5F7JA 5JYEA 2NU6B 1MAUA 1QG2A 3CBGA 3GXBA 4YRLA 4MW7A 2BI4A 2BKAA 2OBXA 4P58A 5TR9A 4DZZA 2CFRA 5E9WA 1FQOA 5HKKD 4IJQA 1L7BA 2XVAA 4IWYA 2IEZA 4D4JA 3AKCA 3NCTA 5LYJB 4D98A 2P4HX 1AKUA 4NJEB 2OLEA 3EAGA 2Z6AA 4FNGA 3O47A 5B64A 1S2LA 2QNIA 4MVJD 2FMHA 4JLJA 2CT8A 1HDRA 1YASA 1BD4A 3SR3A 4AFNA 2XE7A 1V4VA 1T91A 4UM7A 1GQFA 1UFKA 2I33A 2REQB 4TTQA 2JIRA 3Q0IA 4YJFB 5ALXA 2BTQA 3OURA 3OQHA 4YR9A 3WSWA 2WTEA 3SBOA 1HH4A 4RSRA 1G8HA 1WAMA 3P5SA 1PS0A 2PD4A 2R9VA 1N2CB 4MGIR 2NYRA 1DRJA 3JR3A 1UJ5A 8AT1A 3NP9A 1P74A 4C4PA 5KB3A 3OTIA 3H5VA 3EF3A 2PRKA 1G98A 3ZLTA 2AKEA 1EFPB 1WTCA 3HXPA 4R8RA 5EIAA 3S40A 4ACAA 2CYAA 1ZNYA 1OI2A 4I0WB 3WIUA 3D59A 1G2PA 2QE7D 5GJCA 4NCAA 4ZVPA 3BK7A 1R6UA 4YAWA 4ALJA 1KO4A 1I6WA 1GYQA 4FBLA 1RLUA 2I34A 1EJ0A 4Q47A 2VP9A 1BXZA 1G6KA 4B8YA 3QXSA 4JP2A 1G8AA 2AFHB 2W6ZA 3OP4A 3N87A 1DINA 3TX2A 3EXHA 5ITVA 2V7XA 1O4VA 3L1HA 1VJCA 2QHXA 2FPSA 2AE1A 2W4QA 4IDNA 2YN4A 1TVCA 2QX7A 4EA8A 2E5LB 2JHAA 3WHPA 3L6RA 1O1YA 4W6QA 1BSVA 3G5AA 3LW8A 4UW9A 4JVNA 4UM5A 2A5YB 2H1SA 3BWMA 2YJZA 4DBVO 3HA3A 2EGHA 3KB2A 1W47A 2QV7A 4M0MA 3ZW7A 4MDEA 4CKBB 3KALA 1Y1LA 5CDUA 1KQGA 3FHTA 1FRQA 5C4MA 3Q3JB 2KE5A 4S12A 4JI4B 5JY1A 1QIJA 4U2GA 5DXJA 5IVIA 1IUNA 4AAYA 4LF6B 4O8CA 1ZN2A 2FFRA 4RZ3A 4BO7A 3IE0A 3NHSA 2WG1A 1U02A 1ODKA 3NETA 3PUYA 4JOBA 2G80A 5DOVA 5HFAA 3WE7A 3WJAA 5B2EA 1XD2A 1Y81A 3KJQA 2BM8A 2JCYA 3NONA 4NG5A 4QNRA 1ZD8A 3QH4A 3DOOA 1V5WA 2ZT6A 4BZQA 2J0QA 4OQEA 3T4UA 4LDRA 2O0KA 5E1DA 4WJKB 3SLKA 1GPUA 4WLEA 5EESA 1DFHA 2NZYA 3LWNA 2PUBA 1H2RS 4P7FA 5DU2A 2WABA 4P0TA 3ZEIA 4J0HA 4TL7A 5TLSA 3W4KA 4KZPA 1RRFA 2GCEA 1X1QA 3HCDA 2H11A 1MO2A 3DMHA 1QQAA 1U2RA 4H59A 1UPBA 2O2YA 1ZEJA 3GJZA 4JUFA 5AKGA 5HPYB 2C5LA 2QN9A 2W6PA 4XR9A 1XQ1A 1V5GA 1YDGA 3ROPA 1QOPB 3A1FA 3JVIA 5DBOA 4REQA 2IZZA 5H0IA 1JGTA 1AS3A 5D51S 2ESRA 1KFKB 4C89A 1S3GA 1SH7A 1ORVA 5AK0A 1FIUA 2QLLA 3GJTA 4YV7A 1R16A 4B7UA 4IDPA 4JA0A 3EYWA 2AMJA 4DABA 1WMAA 4IGAA 4IH1A 2ZWAA 4UAVA 5HF8A 2JK1A 3H75A 2HU7A 1LVGA 2RGEA 4U2BA 1JU9A 2W8ZA 2Q1WA 5H4GA 2E6UX 3N8NA 4RS4A 5K3FB 3QMVA 2N1MA 3HJRA 3RAEC 1Z4JA 3SBDA 4Z4QA 4GUDA 1IHPA 2P27A 2P6UA 2D5LA 3RBVA 2W8BB 1E9EA 1QV7A 3MW8A 3RVSA 5AIBA 1QBGA 1JKMA 1T6NA 4RPCA 4RK5A 4QLBA 3SFZA 3B7GA 3FAZA 3NBKA 1ZUIA 3S2EA 3WNQA 3QXCA 3QEBZ 4L4UA 2XUJA 4B5KA 1K2WA 4QASA 1LC0A 3FCCA 5LQKA 1A4XA 1T5HX 1F20A 2V03A 5C5CA 3LFHA 2N42A 4J1SA 3ICWA 4R1QA 2EAUA 4TX1A 4Q24A 1VJ1A 1K5PA 3G49A 1Z0DA 4GLLA 4ZT4A 2P9BA 1I7PA 5C4IA 2FZKA 2CB9A 2FSHA 1CWUA 4AJJA 4N82A 5K6AC 3BXPA 3DZGA 4LJ7A 4N5IX 2O2SA 2IE8A 2XE6A 3QKSB 3RG8A 1UWLA 4BNTA 1BCRA 5I8ZA 3X2EA 1ZVKA 2YN0A 1DIAA 2GARA 2OQRA 3IBGA 4ND5A 5CB0A 2JLYA 1H0KA 3C70A 1THTA 2VDOB 5EN4A 2C29D 2IP1A 1E89A 2FZ4A 1OT3A 4E2YA 4AMBA 1IPEA 2VYQA 5LA6A 4OH7A 1VIMA 2YOFA 1LJLA 4UOEA 5HIAA 1PYOA 4MUGA 4H16A 1KGDA 1X74A 4A0SA 3U4HA 1OFHA 2X9GA 2XQFA 1OYWA 1EBBA 2CUTA 4TN1A 3IV6A 2OORC 4NCBA 3T5PA 1Z6YA 1XU4A 3AIKA 4MLZA 1Q1NA 2R00A 3VPAA 2VXCA 5L8VA 3VKGA 4QBFA 4BNNA 4ABTA 2GEKA 3DE5X 4AL4A 3PHHA 4B73A 5HRUA 4JYAB 3E4DA 1OX5A 2ZAYA 1BMDA 2QSJA 3SI7A 1UINA 1G21E 4R9UC 3D1LA 3S1LA 3ZNNA 4A8JB 4FP9A 3OZEA 1SCDA 2VLIA 1E8DA 1FP6A 4JUCA 5CX4A 3TTTA 2GPBA 3GU3A 3OTWA 5G4KB 1ZWLA 4I4LA 5H82A 4MKFA 2VWGA 5ICEA 2XAUA 3AKDA 1DTWB 4W1SA 3KUKA 3DUWA 3N3AC 5EKUA 3CRZA 4J3JA 5FHQA 4TRNA 3LUFA 3IP1A 4L95C 1CV2A 5LKRA 4Y1RA 4BMOB 3CUEF 1AMOA 1I1NA 2RHWA 3G89A 4TXMA 3ZWWA 1OIVA 1TJNA 4DZRA 3L8ZA 3E84A 1XZEA 3KJFA 3I2FA 5FPPA 5DWQA 2ZB7A 1E62A 4KQWA 4TPKA 4U7GA 4GRIA 1FTSA 1PW5A 2C77A 2H48A 3U0BA 1AQ6A 4KN6A 3MS4A 1M1ZA 8ABPA 4G8DA 1UDWA 4RE5A 1MVNA 1UBRS 2GHQA 3TNLA 4KMSA 3UMJA 1PT9A 4A6EA 2XRMA 4NESA 4UCQA 3LCUA 5JVDF 4XDZA 2Y4OA 2XZLA 2VZLA 4IDBA 1RWMA 1EXDA 2CLIB 1BWQA 3WA7A 2OXEA 3BSSA 1JQLB 3FZYA 7AT1A 3J81k 3M4XA 2QR2A 4EOGA 2PVPA 4ZREA 3M6VA 1OD6A 5IH3A 4WZBA 1S3SA 1G7CA 3IBSA 1BHJA 4XARA 4LK2A 4NYJQ 2J59A 5ALGA 1A69A 1UEJA 3U4CA 3KS9A 5B6PA 2HHJA 1NM5C 5FOQA 3RAJA 2NSDA 2Z0MA 1DWQA 2Y1OA 4G0VA 4K3UA 2BFMA 3TPZA 5CBPB 3DAFA 3K9CA 4GR9A 4MI9A 4QQFA 4TV9B 3KUUA 4LSMA 1KYWA 5FI0B 3TVTA 3AB8A 1D4AA 1VCOA 2VTVA 2FPRA 5DIFA 3CW9A 3CSSA 4YJ2A 1Y8CA 1S8NA 4DSUA 4KP7A 3WGOA 3EZ7A 4XSGA 2Q5IA 2EVWX 3A2LA 1O96B 4LMAA 5AHRA 4ZJPA 1Y3DE 3HWX1 4F2GA 1CJVC 5I4BA 2HXYA 4D44A 5L45A 1VI6A 4ZI7A 4DC0A 3DL2A 1MIOB 3DP9A 3F3SA 2Y1WA 3N0XA 1R6DA 5HE9A 1CY0A 3R20A 3ZIAA 4HVLA 1KTVA 5IAOA 5JZVA 5K01A 2BP7B 4TKVA 1ZR2A 2XHZA 3FTQA 3WV5A 1D3AA 1QV9A 3C48A 4N9QA 2CXQA 5KQLA 4H3KB 5CK4A 1A0OA 2H2HA 5DHQA 1I7SB 2PGLA 1KE1A 3EFEA 4M9RA 2ZJ0A 4LJ5A 1HEUA 4RVSA 3K1AA 4CG3A 2HR1A 3JVUA 2A0FA 4DV1B 3P4UA 2J5RA 1FNMA 4RY9A 1CUYA 4GYWA 1IE3A 1SC3A 2AG0A 3FFBA 1S1MA 4LXHA 3HXKA 1KQOA 2CLMB 1KWGA 3DO5A 3GAAA 1TB4A 4U9UA 3RC2A 2O8EA 4PPGA 4URXR 1AA9A 1M7GA 1MMFB 3D4PA 1I3MA 2FI1A 4JLVA 4QOGA 4HDKA 3EDRA 4WDQA 4YRSA 4YCMA 1ZD3A 1C1DB 1QO0A 1Z06A 1Z4PX 6REQB 2VHYA 2NT3A 3HWRA 4WOKA 1VPLA 4OM8A 3NFRA 2WJYA 4Z4IA 2EKDA 3UT0A 3UKJA 1XHFA 4X45A 2O7VA 3FE2A 4ZARA 2X4LA 3FCXA 3HM9A 1RTKA 3PXUA 4L28A 2H4YA 1JDNA 3NVMB 2P3LA 1W6UA 4MGYR 1HORA 5U4QA 5JASA 4JXXA 2UZ0A 3FPKA 3RAFC 1BCSB 4CLRB 1JA0A 4G1MB 4LZZA 4QUHA 3RAPR 2UVPB 4OK6A 1C7QA 4TV9F 1BQEA 2RCYA 1JPVA 3BL6A 1IVNA 5EIBD 2O20A 2H7XA 2W6IA 1NXXA 1E98A 2B61A 1DOHA 4QXQA 3R0JA 5JO0A 3A26A 3PC3A 3I4FA 2CLOB 1II9A 3TK1A 1DJLA 3F71A 5IJ9B 1BWVS 1QH9A 4MA5A 2X8JB 5CYPA 4F4DA 1ID8A 4EVRA 1NMQA 6LDHA 5FTNA 2H07A 2PGNA 3VR4D 3QVGB 3HE3A 3TIIA 1E9BA 2J48A 5LDHA 4G6ZA 4LZJA 4WWHA 1LEHA 3LC1O 4YP0A 1J07A 3L5KA 1YDEA 3DKRA 3OMLA 3GFFA 3EUWA 4B2YA 4BB9A 3GT0A 3H9JA 1JIVA 4FFDA 4YUXA 4EFNA 4HLCA 3FDFA 3TR0A 1J6UA 3CN9A 4OJYA 5CIQA 4RA9A 1ADGA 3B9RA 1E4EB 1RS0A 1CZLA 3CCCA 2P65A 1WRBA 5HDQA 5CM9C 2G1JA 3AIOA 3KEMA 3Q7EA 5AKKA 2A9KA 3IX7A 1NVDA 2GK6A 1H9BA 4X6LA 3X1KA 4D8VA 1RCUA 1FP2A 4MQ6A 3BCUA 1F8YA 4MQUA 1J9ZA 1XL0A 4O8ZA 2EATA 3ZDZB 1LBEA 1VHQA 2BF4A 4AK9A 1JR2A 1LPMA 4RMHA 2HMSA 2WTBA 4KNWA 2RI6A 2V74B 5AW2A 1E7YA 2OPBA 2JAOA 2OYCA 2DERA 1VLHA 1WP9A 1Q6ZA 5IJXA 5K6AA 3GARA 2YVAA 2I1VB 3VC3A 1G38A 2BUCA 4LVOA 3VHQA 3QF7A 3OQBA 3LCRA 4HP8A 3R09A 4R2HA 2V8BA 3H16A 4HDNB 4D1YA 3S70A 3ZW8A 1O9HA 3MT9A 1K3TA 1T34A 1QZUA 3V1UA 1QRDA 1SKUA 4ZEOA 3RARA 4Y6OA 1Y8QB 4EY3A 1WCIB 4D8YA 2GTPA 3WBKA 4ACBA 4LAFA 4UPEA 5ESDA 1YVEI 5AHKA 1ZQ9A 5BWNA 3NT2A 7REQB 1C8BA 2HEIA 3CLSC 5AK4A 1MD9A 1QIEA 1EUYA 4BZZA 1V96A 2NPIA 1IJKA 1XDGA 2G82A 1NVKA 4V0LA 5C1DA 4PG6A 3BL8A 5JARA 2HGSA 2BFWA 2OGSA 3EBLA 1Q0ZA 3K2EA 4OA8A 5H59A 2AHOA 2GEJA 2WP0A 2Y2UA 4NMLA 1SA0A 3RRZA 3TW4A 4O1HA 1I2ZA 4MCAA 2IGTA 2EJBA 4OX9B 1SXJB 2K87A 3IB6A 4PYKA 1YS6A 1MVLA 2XMPA 2FKNA 3FCSB 1IPHA 3AI1A 1COWA 2I7CA 4UVGA 2A9FA 2OCDA 4BFWA 4ND1A 4EHKA 5TMDA 4NZ9A 2HHLA 3WYGA 1QS0A 5BW8A 5FBZA 3RKUA 1ZX1A 3BK1A 1XF1A 1RXYA 2YDXA 2QROA 3EB9A 3LSYA 4YK7A 1YRBA 1R4MB 3U3KA 4EHDA 3RTBA 1EWTA 2V4UA 5AW0A 1LLQA 2M1ZA 2UYHA 1ZBQA 2QW1A 2UZ3A 4WFJA 3BE5A 5BUZA 1IN7A 4Y6RA 1RZRA 3DZCA 2CXPA 2WWIA 3L18A 5FPHA 1FOEB 4PNZA 4CMGA 3K3PA 4Q3LA 3VTKA 3TOCA 2C2YA 4TYNA 4CL2A 1ZA1A 4AY5A 2DSTA 4NU0A 1P8AA 4UUBA 4NBTA 1RLMA 5H1YA 1GG8A 3R41A 2JLQA 2XWJI 2OV8A 4NXNB 2PSDA 3IT2A 1TZ2A 1EWVA 4DQVA 2O7QA 2DTXA 3B78A 3K9BA 2RHHA 1T35A 5FWYA 3OJWA 1NUUA 2AKYA 1J1UA 1W1IA 3SX4A 2B2NA 4QPZA 1Y1KE 1NMXA 4NBRA 4G24A 1L4BA 4INAA 5EKSA 4ZI5A 3X44A 2ZYDA 5CG2A 1TTQB 3IEKA 4H6PA 3Q9SA 5AUQA 1Q83A 5AM4A 4X0EA 1R0BA 3ZCTA 1CUXA 4MQEB 4DQXA 3L6EA 4G4IA 4OBEA 4PPNA 4RETA 1T9CA 4UXIA 1LK7A 3HZZA 1KI2A 2FE1A 1PR4A 2LDXA 3E9YA 3GZNB 3RUPA 3DKKA 4RHYA 3VJRA 1J2RA 1AZSC 1IVYA 2O2GA 5CUQA 1WULS 3FTPA 4H31A 4IM7A 4QVGA 1WD7A 4URWR 4CV2A 3OKAA 4UAGA 1XTKA 3NAGA 1R12A 4H35A 4PC2A 4PONA 2VT7A 4JNKA 1QKIA 1T1IA 1FDWA 5EUQB 3VISA 3KPJA 2PGXA 3G9QA 3HDGA 4DCNA 4P0QB 1P5JA 1RE1A 4MO9A 1WXQA 1CPYA 4RS3A 3OTOB 3L40A 3T94A 3RRFA 3ILYA 3VJMA 2Z08A 5EPUA 1BEUB 1T36A 3MMXA 2ZI5A 4D5GA 1XD8A 1UM9B 2J85A 4F12A 5K45A 3CRW1 4XDGA 5EYPA 1CLEA 2ONKA 5KMGA 4L27A 1R9JA 4PAOA 3RFTA 1JHYA 1M7HA 4F6LA 1X19A 1ZN7A 4E70A 1WMBA 1UBCA 2PPLA 3IBYA 5AI5A 4U8HA 1H2BA 2Z6VA 1RKUA 4RMIA 3PIRA 1JQAA 1SUPA 2CNWA 3EPRA 3JQAB 4ZZ2A 1RWQA 2IU3A 4AZVA 3IQEA 5M3BA 2DB3A 2ZFUA 1II8B 3GLHA 2J5BA 1KE2A 2HU5A 2GAAA 4DV6B 5TMBA 1HL7A 2IHNA 4XVRA 4EPRA 4TQAA 5AKJA 4KDRA 5IC5A 3FPSA 3PKIA 2ZBVA 3BXZA 3MEQA 5TS3A 3KZNA 4X20B 1K6EA 2GHIA 5DVZA 1MJ5A 4J9VA 2F3RA 2IPLA 5DTEA 5JALA 1EVEA 3ZWOA 4QUDA 4P1ZA 5BORA 2QL6A 5BSKA 4L73A 1N2JA 2ZREA 3DVAA 4JLSA 4UMVA 3NG1A 1NXSA 5F21A 1KSGA 4ICIA 5L3VA 3K8OE 4B17A 1PG2A 3OEWA 1QV6A 1BYUA 3OMWA 4IDOA 4CMKA 5K4HA 3R3VA 5KU1A 2NPOA 3EGCA 1VI2A 4YP1A 1ZJ4A 1JIKA 3FZQA 2P2NA 1O6GA 4P38A 1L7MA 1I24A 3JD4A 2Z1DA 4U9HS 3IQIX 3P4XA 1KAGA 4MKGA 2BLNA 1YR3A 4UVHA 3CUVA 1KYVA 4RA6B 5EZYA 4MVJH 4GOKA 4G89A 4CGZA 5BWBA 4HB4A 2HZBA 2QSZA 4WOPA 1ZOPA 3ZWNA 3JRWA 4B6QA 3N2LA 4ZZ3A 3TFQA 4UU0A 2HLPA 1XTQA 4EQZA 1HEIA 2QR5A 3F4BA 4QDKA 4HG2A 2FFAA 3IIJA 3WA6A 1BXGB 1MB3A 3OFNA 3TSOA 1NI4B 2UZ1B 3PSHA 5CA1F 5E4YA 3EXIA 1C3LA 2JKVA 4WXHA 5F1OA 5JS7A 1YL6A 1CS0B 4TMYA 1QYXA 3IKLA 1Q6YA 1EM8B 3LOQA 3SDBA 4DUYB 2BGJA 2VP6A 2WSMA 3EXFB 4O2BB 1NI5A 4BQPA 3B6JA 1UP7A 3KVNA 3BXHA 3K32A 5JYDA 2X14A 3VBEA 2Q0QA 3CRVA 4XUDA 2QZJA 3TLJA 3VGJA 1JHMA 1DSSG 1YZYA 4J90A 3FSEA 3WMGA 1G64A 3ZU6A 4C08A 4ZIRA 1Q2XA 3GR6A 5I9NA 2FMTA 4B81A 4N49A 4R7TA 4LPKA 3QKWA 4M7OA 10MHA 1XEWX 2FMXA 4MUEA 2NYUA 2ZK7A 3UUEA 1F4PA 4EB8A 4IY1A 5IJWA 5J43A 4Z0TA 4I19A 5K99A 5AKXA 4A15A 5JLAA 4EECA 2FUKA 4DT1A 1V1RB 1MORA 4IKEA 1UPXA 3G8AA 3HFSA 3PP8A 4IGFA 1WXDA 1XMQB 3ZZTA 1WPQA 1YB7A 1TW2A 1FMLA 1TTHA 2ID4A 4H3HB 5DHTA 4KSCA 4HUTA 4QGSA 4HGNA 5BOSA 5FAKA 2O8CB 2CDBA 1WF3A 2I1LA 2IYUA 4RHEA 1SAYA 3NHLA 4WXRA 5JSKA 5JAHA 1X7XA 3ZHRA 4M53A 1HT3A 5HFJA 1H0SA 4GG1A 4MVXA 4B7XA 3F97A 4BB5A 2Q0XA 1DPGA 1XCJA 3BWXA 4FN4A 2AD1A 1Q14A 3K53A 4MV0A 2PV7A 4AN4A 3ESDA 3U7QA 3V00A 2VZEA 4B8WA 1KK2A 1E79A 3KTFA 1VKZA 4NFYA 4CE6A 3EISA 1AX9A 3DHVA 2BHNA 3JZDA 4QL3A 1PWZA 3U4DA 4BO1A 1Y1PA 4HFMA 4MB2A 3RSSA 5DTJA 4UBOA 4U7DA 1UKVY 2XUAA 3LYUA 3KKMA 5FPKA 1DWPA 3HKEA 4GMGA 2EP5A 2VJQA 5CM8B 4Q4DA 1EEHA 1DIRA 4ZYXA 3QJ5A 4G0MA 4WH0A 3DT6A 2ZTHA 1NBHA 1Y37A 4D4GA 1TQ6A 1DQPA 1GLVA 2EJUA 2KYRA 3OHSX 3DLAA 1X1DA 4PS1A 2Q5QA 4B6FA 4CI0B 5IZCA 4UASA 5KPDA 4U02A 5JZ9A 4O2BF 1CY8A 3ZNQA 9MHTA 3CZMA 1V11A 3LHIA 4TQGA 5B1EA 2J9GA 2JCXA 2AVDA 2J0SA 4EEZA 4KBFA 4TZTA 4MS3B 3DBIA 5DPMA 3TQIA 2MR5A 1Z5PA 2VR1A 1HT1E 1N2GA 4Z6KA 4M7WA 1T8TA 2JLUA 5HF9A 4H6XA 1Y7IA 2YXPX 3ISVA 3SEAA 2I6GA 1YHYA 1KYXA 2RONA 3HL4A 1Q1AA 2X5NA 3M4ZA 3Q3EA 1LVUA 3OQ6A 1N2BA 3HDHA 3I39X 4N5HX 3T3GA 4YBZA 4ZOQI 2CDAA 1N33B 2OC4A 1UPMC 3SXPA 4JWKA 4RJIA 1Q74A 3GBSA 1DOZA 3OJ0A 3HDJA 1WTAA 1KEVA 1PL7A 3C1AA 1YV9A 3UWMA 1HM5A 1JG4A 3ZIAD 4D99A 3W5CA 1RQLA 5I4IA 3QTTA 4B71A 1DTSA 2XB2A 2YZGA 2N46A 1NVGA 1YT5A 3A8TA 3JQ8B 4IAOA 4ESOA 5KIAA 4X6YA 2VS1A 2XXAB 1M2OB 4DR4B 5EJAA 1SOMA 5GTDA 1YZ3A 4TVKA 3THYB 1ONSA 2C7RA 3CO0S 4L07A 1BU8A 1ZH4A 1J0AA 1N6RA 1P6UA 4PANA 1Z9BA 4F7WA 1S7GA 5JHHB 1UJCA 4DLXA 4KYTA 4AIIA 4R0MA 1I3CA 4GSKA 4WZBE 3RUHA 2ZJ7A 2QD2A 4JEMA 2VNAA 4PHFA 5DNDA 5HHTA 2GCGA 4ZICA 1XRJA 5CYFA 1SXQA 3AXMS 5AVYA 1AA6A 4RK1A 1FRZA 1UBFA 2B34A 4C7XA 4EARA 1QO0D 2OV1A 5JJBA 5J63A 2AS0A 4ZCTA 3MMNA 4UTNA 2YHIB 1MJGM 2OSBA 5TY0A 5IRCD 2QMQA 1JFRA 4CMIA 2XCRB 1KYIA 2CNBA 2WSBA 5CTAA 4EY6A 4W7HA 3TSWA 3U37A 1TOAA 3UAXA 5AW4A 2OZEA 3JAKA 3SIXA 1LS1A 4CCYA 1NXVA 1O5OA 3ZU5A 4KHPB 4YB8A 3O03A 1EX7A 1YIDA 2O8BA 1QQTA 3RAGA 4QJBA 2GBLA 4LV5B 5DBHX 5HR5A 4LXGA 4JVLA 1ADJA 2G5PA 3S7TA 1I94B 3SU8A 4A4DA 4NK5A 1GPWB 1Z6QA 3K8YA 1R5OA 2QIPA 4AULA 3O26A 1Q7RA 4JP1A 3DEZA 1GSIA 4ARSA 1NF3A 3RFVA 4E11A 2W6ID 1DJQA 3BGSA 3AW9A 5CGQB 3OQJA 4A2QA 3FPLA 4MLDA 1RXSA 4LMBA 2I99A 4WLOA 4B44A 4C0HA 1XRRA 1KR2A 4EKDA 1G5HA 4QFDA 2CVPA 2XTJA 4I1UA 1OOEA 2JAUA 3G2JA 3N76A 4JIGA 5ETJA 1Y8AA 3V34A 4A6PA 4BY9E 1RNLA 1Y1TA 1JT9A 1NN3A 5AM3A 4S24A 4DQUA 3U4GA 1UWCA 3UZUA 5KVCA 1Q3KA 1ZH2A 2O3TA 1N6KA 2B4QA 2G1KA 2IXFA 3OQIB 5FUBA 2NUTB 1SUDA 4KTVE 3PPYA 1P1IA 3HA5A 1NQUA 4I14A 3M1LA 4E31A 5IU6A 1NYLA 1ZH8A 3OH8A 1F17A 3QM1A 3GLQA 3HZOA 4ND4A 4Q3AA 1VSVA 4Q3OA 1UFVA 3AHCA 4COKA 1DC4A 4C0QC 1ZOIA 2Q2NA 3GLVA 1CIVA 4L78A 1XTTA 3G7UA 5IX8A 3GCXA 1WXWA 4M9QA 3A4NA 2H1CA 3K9NA 3IHTA 4R7GA 3LDUA 4ETNA 4PAMA 3KETA 3WJ7A 1EA5A 3I9V6 4BAUA 1J2YA 1X9HA 1IEXA 1KZ9A 1ZA2A 4GI5A 3UUWA 2FK7A 4BZXA 4XWOA 2IS1A 3PWSA 3OOSA 1KO7A 2XDWA 4I4NA 3P7MA 4FQ7A 4MUAA 1C2YA 3FH0A 3M3DA 1B43A 2O5CA 5JNWA 1JQ3A 3DKVA 4R68A 2OTCA 3H0EA 2C92A 3C6QA 1RBMA 3WBBA 3GI1A 4RD3A 3BQ9A 2I6QA 1ISSA 3DAHA 4S1OA 1EUDA 2CXHA 4FFVA 3C8MA 1M75A 4BIIA 5MGBA 4FGZA 4W5HA 5EE9A 4DNQA 3HL0A 2NVBA 4DV4B 3IALA 3KOMA 5EHNA 3N2EA 4UHFA 3B7PA 3PUZA 1AKNA 3R0QA 1TF7A 2Y9PB 5DGCA 3UNXA 1UK9A 2HV9A 3RSFA 2FMKA 4EYEA 2PFSA 1ECPA 1YBFA 5CAEB 3SGLA 4DR2B 3HYSA 4D6PA 1Z56C 4AJIA 3RUDA 4N12A 4UUMA 4LY3A 1Q16A 1X86B 4HDRB 2YWCA 5BYKA 1L9XA 4O3FA 5HKOA 2GILA 1RT9A 1M1YA 4OBXA 2M98A 4S0ZA 1EWRA 2AZMA 2GO7A 2BKVA 4F93B 3BMOB 1FLVA 2XTZA 3I2YX 2R8PA 3KYCB 3PQ4A 2P9ZA 3EGEA 1LW6E 2RKBA 3HSYA 1ZK3A 2JFNA 4QXAA 3SIRA 4C2UA 2IS4A 4NV1A 2I4TA 4M1MA 2JFWA 4XQ0A 2PNJA 1MAWA 2EW8A 1RLDS 3OFKA 2C8JA 3I01M 3IP6A 4W9NC 5E7JA 5B55A 4OIMA 1MOZA 2K6GA 3I12A 3T0FA 3MD9A 1EFUA 3A6EA 3AFIA 3FGOA 3RLIA 1C0EA 3UJ3X 2VWPA 4Q82A 3IMKA 2H63A 3N2KB 2NVWA 3ETNA 2ERCA 4UUPA 5JQGA 1NTRA 1HE3A 4QUJA 2PZBA 4JFRA 4ZO4A 1V25A 5EMJA 4OMDA 3MLBA 2D0OB 1SPXA 2EC5A 4UULA 5BN5A 1NXOA 4JHLA 1ZINA 1P4RA 3PFHA 4JJIA 2C0CA 3GGJA 4X97A 1RZRD 5F9HA 4HVAA 2WAMA 4LYEA 3EQ2A 2ODWA 1PWEA 3G8DA 1XK6A 4LCEA 2EP7A 2PX4A 4M9ZA 5DTIA 3WB2A 1QGZA 3NU1A 4G3XA 5FFFA 5GMOA 3NOVA 4ECEA 2P8SA 2YJ6A 1GZVA 1LQTA 3C7AA 3PR2B 4G23A 4RAQA 3RRJA 1CFJA 3SYRA 1K8QA 3H4MA 3K16A 3KLNA 4YUYA 2XEXA 2YFHA 3HA7A 3O9ZA 5DWVA 5A9SA 1A71A 4C87A 5EMMA 1A7AA 3EGDA 4FW9A 4Q1DA 1QWOA 3NYRA 1IIBA 2PLWA 4UAUA 5C8VA 3ZU4A 4XB6B 1BX0A 4HAIA 5I47A 4DMFA 5E8JA 1VJDA 2AEFA 1UDCA 4C07A 1DKUA 1OPRA 3DV0B 9GPBA 2ACVA 3K6RA 5KYUB 1P75A 2BOVA 3N53A 3CVVA 4FX5A 4BBPA 2W83A 1DOAA 3C8DA 4CU2A 4EEXA 3CLHA 1J8YF 1O97C 4U1RA 5EHQA 3QQ5A 3VC2A 4DQ0A 3H83A 3U3OA 1DX4A 4B34A 3HEAA 1H2AS 4BN0A 1XVUA 4DDKA 1K5HA 3L05A 4L5BA 4GPTA 5DV9A 1PD1A 3AM3A 4NBNA 4ZXPA 3VR4H 3VAYA 4DMLA 5DI3B 4IZHA 1E2NA 2I8AA 5ELMA 5CGZA 1D6NA 1ODJA 4KKVA 3H8WA 2NZXA 4PG4A 2VF8A 3PNVA 2FETA 3E5HA 1M2JA 3PQ7A 3TINA 1NSFA 3ND5A 4NFSA 3HBAA 3MXOA 2VRBA 5KWIA 4BXOB 1WLYA 4TXNA 5A3JA 5MDHA 5BVGA 3QVKA 2IZOA 4ZYWA 3G5TA 1NVVQ 3UYKA 1PBNA 1T2FA 4L2IB 2CNWD 1RPJA 3QWIA 4Z8XA 4X60A 1R4NB 3T4PA 1GFZA 3R6DA 4G1CA 1QG4A 3ZOKA 4AG3A 2XQKA 3MINB 3MT7A 1VXOA 3LZCA 4RXUA 3I2JA 1KAQA 4HTFA 3ZQKA 1U0EA 3CX8A 5K0ZA 4YP9A 3PCXA 2XGGA 2QVBA 4YAOA 4F4HA 4LZPA 1JSXA 3MMSA 3RVJA 3L0SA 4JJEA 4XWGA 3C3AA 1QRAA 2NZVG 5AHXA 1C9MA 2Q99A 2ZU0C 4RPLA 5IXJA 3D43A 3DPSA 4F3TA 2WMOB 4HX2A 5IC6A 1FUUA 1VQ1A 3GEMA 3OHPA 1P2VA 4FOSA 2JJ1A 3E9NA 3PGJA 2NSHA 1P17A 2PVSA 1JEJA 1KAOA 1AF4A 1O0SA 1CC1S 3OU2A 1IY0A 1Z7GA 2PXAA 2WU8A 3HB7A 4V39A 2X0EA 2X6TA 4C14A 3AVVA 4RIEA 2Z5GA 3BDAA 3GFOA 3AWDA 4OQPA 5I45A 4DARA 2AR7A 3W2IA 2ZYRA 2GEVA 4X95A 4GX2A 1K8XB 3R6WA 5U4XA 4EY5A 5BMVF 4E3WA 2AFIB 4NSNA 3DCIA 4MV1A 4PLZA 4LKOA 1Y8RB 2O8VA 2C7VA 2ZBGA 3COZA 1NDUA 2XCLA 4C0BA 3CVOA 3EUEA 3EOZA 3RVDA 3P26A 1BDIA 3U44A 2BGRA 1LTHR 3GP5A 4JZKA 3RVRA 4DN6A 1HTTA 3F98A 5LFAA 3LYLA 1QNFA 3AETA 2FH5B 1X9IA 4KU4A 4DL9A 5B6IA 2DF8A 3IC5A 3IT1A 4Y2SA 3UY4A 2BFNA 2I0FA 1KIMA 1E32A 4ERNA 1BHSA 1F0NA 4GS5A 4N3AA 4P92A 4QYXA 2VSOA 4G9BA 4QUKA 1P9WA 1AY0A 1QMPA 3ZGZA 2NXCA 3OFND 2PH1A 3DZIA 4BU0A 2YUIA 4Y2HA 5LLTA 2HM7A 3BD9A 2O3SA 3S8MA 2Y0DA 3MF4A 4ID3A 1CTQA 3UICA 2VHVA 2V9PA 5ED4A 2P3QA 4MWSA 3ZYZA 3COSA 1FZTA 3BIWA 3UT5A 3A6LA 4WBXC 4F11A 5EXXA 3SYMA 2QVCA 4XWTA 3IMCA 1CUDA 4U2CA 2GBCA 3QMMA 2H5EA 4TLLB 2BM0A 4L5CA 4IV5A 3SQDA 2CHVA 2WAYA 2J3EA 4QJ5A 2J8ZA 3KSMA 2QWXA 1TM2A 3VPXA 5AKEA 3H1PA 2AC7A 2Z58A 3IPYA 4TS3A 4EJSB 4K5QA 1LKZA 2PAAA 4Q01A 3TDMA 1QYVA 5CB4A 2Q1SA 2CXNA 5KJEA 4Z3OA 2J0EA 2PMKA 1KBOA 3LO8A 2Q7OE 1KPHA 5DP1A 2H0RA 2D0IA 3JVDA 1CF4A 1T2NA 2O7SA 4YCDA 4M0FA 1CVIA 3MCUA 3UB4A 4UEKA 2DM6A 2JLCA 2KJQA 3A4VA 3URMA 1W0KA 2EERA 2ZE5A 2ZI9A 3KBOA 3FIJA 4KACA 5D84A 3QGMA 4LDJA 4RHTA 2I3GA 3MSCA 3I9V1 2RGYA 1NJFA 5K3DA 2WV9A 3ZBQA 5E2BA 3WXMA 5JAMA 4Y30A 1V26A 2FX2A 4TTSA 2PKEA 5AOCA 2QJOA 2ZKLA 1P5RA 1E79D 1JLLB 2ZUWA 5K8LA 4JI8B 1QHIA 4NENB 3CLSD 2O8DB 3CA8A 4QYIB 4MRVA 2XTMA 3WWZA 3HCRA 3L0YA 2D6FA 2DTDA 2JHPA 3L8GA 3W4IA 2ZANA 1MB2A 5HFNA 3HVRA 2NSYA 4Y9RA 3ASZA 1H3NA 5KNBA 5F4ZA 1SJ9A 3FOBA 1EX6A 3EC1A 3WGTA 4R5MA 1QIKA 1NR5A 2P30A 3IDSA 4W9NA 2C2GA 4LYDA 3SN6A 4AQYB 1W5EA 4TRJA 4YRMA 3EODA 1UPFA 5ADWA 1AQLA 1PFYA 1RU3A 2Z1NA 3EWSA 1MB9A 3C98A 5EWMB 1IY9A 5B58T 2V7WA 3IQFA 2HL6A 4OK5A 1P1HA 5JDCC 2BAGA 3DDSA 1EP9A 3DD5A 2XF8A 1EMDA 2VSXA 2KQUA 3N59A 4OKIA 4QC2A 1UWVA 4BFUA 5BWLA 4DR5B 2PUHA 4OP2A 5TVGA 4UTZA 1ISRA 2X0IA 3R6LA 1T0HB 2WD7A 1DEKA 1F4VA 1IEQA 3F7TA 1NBOA 2WTXA 4QODA 4CEJB 2WK1A 2CFOA 4UUAA 2X9LA 1T0JB 4J76A 3U4MA 5HM8A 1MJFA 3AVOA 3ZWMA 5JCXA 2JI8A 3DTYA 2FGJA 4LBZA 1VA4A 2PO5A 4JBHA 1S4QA 721PA 3P2YA 3JASA 5F2OA 4B43A 3FI9A 1NBEA 4RWEA 3W8FA 3QELB 3KO8A 3H17A 5C5EA 3CYFA 3W6UA 2HCRA 4GBGA 2WWYA 1YMUA 4KN5A 1VDZA 2JVJA 2UXCB 3FI0A 3H2KA 1NMSA 4DILA 1PBTA 5DSTA 2WQ7A 4AKHA 3QY0A 4ZAFA 4GGMX 3CBQA 4O2RA 1VJ0A 1P33A 2B1IA 3TNDA 1WMFA 2HLNA 2JB9A 4G9GA 2HW8A 3A4YA 3DMNA 4KQ1A 3JWJA 1GG5A 4A82A 1YUBA 5FEUA 3A9TA 3L3BA 4IQ4A 1W46A 3CEJA 5FJIA 5IW8A 5HXAA 3FN4A 4IUYA 4X8LA 3SS9X 2MTBA 3X3HA 1RLCS 2D1YA 4J2HA 5DO9A 3WLAA 4F0JA 1PVOA 3Q12A 3CHYA 1G9TA 3PNPA 2AMVA 3DFKA 4KRGA 5HUJA 3ZHCA 5I5GA 4IHAA 2X6QA 4FLFA 1TAHA 1QZTA 1YHZA 1FP1D 5DRTA 1O08A 2JLAA 1UBKS 4D92A 1LI5A 4DZTA 1TNDA 3I6QA 4M1QA 5KQPA 1KXJA 2QAGC 2PMFA 1H5NA 3BTOA 3DZ8A 3ZUGA 4CHTA 1XVTA 1GLGA 2QMOA 3O8NA 4QDOA 1X8JA 2VPIA 3QU2A 1VJTA 1DZ3A 3NAQA 2YR0A 2GCPA 4UHBA 1RAGA 4IYRA 4U7PB 1PZHA 2QTWB 4ZJUA 4BKOA 4PG8A 3L7IA 4HKTA 1YL5A 4PLWA 3W5UA 1DQRA 2G72A 4BYMA 3A11A 3JQ7A 2XWBF 3HJAA 1U5CA 1KKUA 5CVJA 5KTPA 2H1IA 3LTNC 3BVPA 2E49A 4J0IA 3H4IA 4J1TC 1C3OB 3OZIA 4LRTB 3SVZA 1NF9A 3T1HB 4YRDA 5AM5A 3CIFA 2GPWA 4I1OA 3SPXA 1Q15A 3SJBA 4MEAA 1OZFA 3DQZA 3HN6A 4EITA 1Q2UA 1T9KA 1XTUA 2ZIFA 4C1NA 2WWVD 2HLHA 3L6UA 4Q4LA 4LJSA 4PGHA 2CYBA 3UQYS 4J8PA 5LQNA 5CX1B 4RQTA 3DE0X 1WR8A 1NLYA 4DV3B 4N3GA 1L3BA 3K0CA 1JPJA 1XB2A 2C00A 2OZLB 4G37A 3X1ZA 4B6OA 2FG5A 3LC0A 5FYQA 2BFCA 2DWPA 3RK1A 1W52X 2FLKA 4CKZA 5DEIA 2TYSB 4N47A 5BY2A 1PGPA 5HJ5A 2K7ZA 4MMZB 4UHEA 4HNTA 1WCV1 3Q1LA 1GPLA 3CUSA 3N74A 5CVDA 1QDUA 2ANCA 1MO3A 4DDMA 1JG2A 3CWQA 3KZMA 4IXTA 3SS7X 3OBBA 1VECA 3O8OA 4BHTA 3U61B 3R9XB 1U7OA 2D4AA 4JL5A 1EAMA 1XDWA 2ZRHA 4S2EA 3R7WA 1ESNA 3OCWA 2PZ8A 2D2XA 1UBHS 4HY3A 4KVAA 2EEPA 4UAJA 2A5DA 5DNYB 4NYIR 2JFOA 2W37A 1XNHA 4P5DA 2DFNA 2RIRA 5L3QA 3A0UA 2JD0A 1A97A 1B6TA 1VYTA 1IUKA 5T4FA 3RYCB 3ZWDA 3O4HA 1GPYA 2W7TA 3FNFA 3H0CA 1ZG3A 2XVXA 4E21A 3EEOA 1M8JA 1PQUA 4JODA 3E2IA 3TZEA 4BZPA 1KORA 4DIMA 1Q50A 3LXRA 4S1NA 3ZJVA 3PX2A 3KUCA 1K7XB 3H9QA 2UZIR 3JQDA 1WZ2A 1DRUA 1K6MA 3MBOA 1L4UA 4RD6A 4G1BA 3AG5A 3ZQJA 4BFZA 1USUA 4HL6A 2CLEB 5B6JA 2C07A 3R6GA 2J6IA 1Y1QA 1P3DA 3OCVA 2W2NA 1LF5A 2R7KA 2SNIE 3AYXB 4M0LA 3VDRA 4E5KA 1M1NB 3LY7A 2C4HA 1T2AA 3GNLA 4QE3A 5DHUA 1PQ4A 3TEJA 1RQGA 4BO9A 4U6SA 1KJYA 4U6NA 4WW0A 3GA7A 3PYMA 4DJAA 2AXQA 2H54A 3Q41A 3VU9B 2A5LA 2O7RA 5KX5A 1EG2A 1NUQA 2FSIA 4WFQA 1I5RA 3LQFA 4BKMA 5A5VA 1FSGA 1Z5GA 1SUSA 2XUDA 1Z4QA 1VKNA 1SK8A 2IK8A 3MUFA 4HWTA 1P45A 1CUWA 1VE6A 2CD7A 2IU4A 1LZKA 4GPBA 3ZW9A 4DHWA 5FA5A 4ER5A 2Q6OA 5JEEA 4KQGA 1UZLA 1XMSA 1YXMA 4FDTA 4RXMA 4RK6A 4ZJZA 3AHGA 1WBDA 3DHWC 4JZYA 4NMXB 3RIXA 1Z2AA 2IPMA 3F47A 1LTKA 3MTDA 4LX8A 3S2UA 1ZGGA 4OGKA 1VRVA 1L8LA 3AR4A 2AEMA 4NEHB 5AOVA 2IUUA 2C61A 1A76A 2C2WA 3NEPX 2FW6A 2APJA 4FHEA 1MENA 1R2QA 4RACA 3I52A 4BMVA 3TF5A 3OPMA 1L6RA 2KX7A 1YS2X 1JYSA 3DE2X 2HA6A 4KIFA 1M34A 4PXAA 4GI3A 1PLJA 3LKZA 3GCWA 4CQMB 2CBXA 2HK8A 3DTVB 1QFMA 1SFRA 3MXTA 4HSEA 3SYKA 4HB3A 1SBHA 3ZTTA 3T9EA 4CNQA 4QDXA 2J0UA 1RQPA 4MITA 5JS2A 3L8CA 4DBLC 3VR6A 1FSFA 1T2EA 3E9QA 5K05A 1HEYA 2R8BA 1VHLA 5F23A 2DXIA 4L8GA 1U5BA 5AUPB 3LCCA 1Y34E 4IO0A 3VDQA 1HC7A 2Y99A 1AN9A 4TTAA 4HC4A 5H3HA 4KITB 4JKIA 4DE5A 5EHZA 5A0TA 1BE0A 1CQWA 1EAYA 3WL8A 1RI4A 1KOGA 2Z6UA 4PLVA 3KRTA 4U5QA 1NNUA 1OXSC 1X7YA 4AQ7A 5I01A 1Q1EA 3PXDA 5M7EA 4GXNA 4MOWA 5I7WA 2WE7A 1X1CA 1MNAA 2H17A 1ZN8A 2RB5A 2ZWOA 4NZZA 2JIPA 4X8HA 3GEDA 4BVHA 5KEIA 3LECA 1NN0A 4NH0A 5CPFA 1AGPA 3CY6A 4QIHA 3S99A 3TD2A 1PT5A 1SIBE 3UJDA 1A8SA 4BP8A 3AIMA 1HDCA 4KKXB 3PFBA 3WL7A 3OI7A 2CLHB 2X4GA 4EHAA 1CUBA 3I9KA 4LJAA 1JHAA 1U2PA 4TTRA 2OXTA 5IDYA 1P72A 4NR0A 3BMQB 1GUDA 4R9VA 3VYUB 4C7BA 4D8XA 3PLAE 4R3WA 1MV5A 3GRCA 2C03A 3NT4A 521PA 4EPWA 3VPDA 1BX3A 1YJQA 1U7WA 5AMXA 4WOJA 4AW9A 3TLGA 3O2JA 3G9TA 3E3AA 3V8EA 3G3EA 4AKEA 5JMWA 4YYEA 1RQXA 1RVDA 3DWIA 3O83A 3QOFA 1O94C 3RGGA 3HSSA 4CHGA 1P9LA 2PJRA 1RW4A 2CVZA 4FR0A 1MP0A 3ZQ4A 2ISCA 3REGA 5B1DA 2ZBEA 2DUNA 3ZHTA 3P71T 3QVXA 2NG1A 2BFBB 2B1RA 1Y3IA 4YCJA 1TX4B 4GPIB 4CKEA 4GSLA 5JNTA 2VOJA 1UPCA 3MN1A 4NE2A 1CDZA 4FINA 2AXEA 2JFBA 1MOSA 3A6FA 3T5GA 2GM3A 3DFMA 3WWEA 2P6RA 1NGSA 1RYFA 1ZUHA 1SQFA 3CX3A 4NDNE 4M87A 5IAEA 1ONPA 5HRCA 4B87A 4P36A 4YT2A 3U7FB 1GZ7A 2HMUA 2W0MA 5H7XA 1M0SA 3A4TA 5TEVA 1B73A 1PJ2A 3U49A 3JALA 1QZZA 1MJNA 2FRDC 2Q3FA 3SVTA 1TT5A 4J0JA 4RIGA 1YR1A 2PMDA 2UAGA 3ROFA 2QAGA 4Q7MB 4GI2A 5IBPA 2QN3A 3AM1A 3PHIA 2OCKA 5T3YA 3CNNA 1JQ5A 1UDBA 3DKPA 4EJFA 5JD4A 1C7ZA 1WOMA 4FTWA 3B85A 1EDDA 1Y89A 1TJ4A 3FHJA 2E87A 2PAFA 3DE1X 3LKVA 2YUTA 2DUJA 2Y0CA 4EHIA 3EGXA 2IHVA 1ZGAA 1TUGA 2XRFA 4KK4A 2VYCA 3FMFA 4LV8B 4MS1A 4C0WA 1U1GA 1QCDA 1PFKA 3ME5A 1UBTS 4GEGA 4YASA 2QTHA 4LFCB 1SPBS 2HK9A 1JR6A 4RK7A 4AY6A 3EZ2A 3BHIA 2VDQB 2BGUA 1WXFA 1KHTA 1W0JA 2QVZX 2PQ2A 1QBKC 3B2QA 3H5AA 5EZ5A 1E8MA 1JHRA 2UYOA 3O3CA 3RHTA 2EBWA 3MA0A 5C53B 4H18A 5DNAA 3L4SO 2GJKA 4JI0B 2QUHA 1NVXQ 4GKBA 4M83A 2QXUA 1E9RA 4H1WA 2ZAMA 1JVBA 2YWEA 4AMYA 4DY4A 2PT7A 2D0DA 3AQ4A 3RC3A 3VPSA 1Q21A 4IOJA 5J2UF 3H4TA 4P54A 5FOWA 3VO1A 4PW0A 2H29A 1H6BA 2VRWA 5BQXA 2L19A 3RNOA 4Z9BA 1WB9A 1H8HA 1R0WA 1AXGA 2E4XA 2GTHA 1G7SA 1MABA 2D8AA 3JATB 4P5PA 4BCCA 3VNRA 4NAVA 1UQTA 4DR7B 2A30A 2EG9A 2V7GA 1PYGA 3BH6A 4GXTA 1PGOA 3FCUB 3AX6A 3K4PA 3LVBA 4IILA 1E7MA 1HZZA 1O8BA 3F9RA 2RGWA 5FNVA 4BB6A 4CV1A 5JPIA 3EG9B 4Y6SA 2BBTA 1OBHA 2ZYVX 1R7RA 1ACJA 2RGUA 1JG7A 4YRCA 1EFVB 1NMZA 1SEPA 5C8XA 4ZCSA 3K0FB 2ONCA 4HXEB 4YUZA 4JVOA 3WK4A 1Z4MA 4Q4AA 5AKYA 3MB8A 2X2OA 1QXSA 4HH4A 3ROQA 3WYFA 3W2HA 2MDTA 1W0KD 3ZTYA 1QX4A 3I34X 4TLEA 5J5AA 1G291 1SHTX 4PZDA 3GUYA 3N2YA 1DWUA 3VX3A 5EIHA 1I4LD 1L7AA 4EM6A 1PX0A 2OQ2A 3AB3A 5CCEA 3BFKA 2QQ5A 3L1IA 1U63A 2ZB8A 1I7QB 3ACCA 2HD4A 5HS6A 1DELA 2H9IA 2PXHA 4NFLA 5ALEA 5LZ8A 4B7AA 2WP8J 4MV9A 1X2BA 3D0OA 1HX7A 1G42A 2BVNA 3OC0A 3C4QA 2WTAA 3RIGA 3ZDFA 3QEAZ 1AOXA 4TSFA 2QDXA 1U9JA 1QIGA 2WU4A 1JAXA 4RY8A 5T67A 3WK6A 1LV7A 3E48A 4GM1A 4KWEA 4R2IA 1GRRA 3CZ9A 3FSRA 5LMNB 4J6EA 5KNBD 4EQ6A 2MSWA 3ONDA 4YFYA 2Q4TA 4PFKA 5CTJA 1TVKB 3JWIA 5AVKA 4EK9A 1B74A 4ZV9A 3FTDA 3JQ9C 4LTMA 1JH9A 1M6YA 2FFHA 4ES6A 5K0JA 2WKSA 4I99A 2TECE 3AB7A 3GELA 3UPDA 3TDKA 2DQ4A 2NQTA 4IP0A 5BUQA 2VSQA 2J3DA 1SUAA 5THQA 2YN2A 3OT5A 5KUTA 1W29A 4QGBA 1U2DC 1VYHA 4HNAB 1JEQB 3M5PA 3TTSA 3MOGA 2XRYA 5LOVA 2VHCA 3I2GA 3OWHA 3K0BA 3PKZA 2R1VA 3T9FA 4CGYA 3T3NA 4HSGA 2WFLA 2CFSA 2GZ2A 3GRPA 3HXLA 5E0OA 4PVCA 5SZKB 1GQ2A 4QU9A 1TU3A 5HIKA 3AUUA 4TZKA 5CA0B 4WKCA 1ZM4A 4JC8A 3PQ3A 4ZWNA 2RC6A 4EG8A 2Q1XA 5IHXA 3QLEA 4FJ1A 1EQ2A 4PYOA 2P6OA 1N8KA 1QTRA 2GJ4A 4RQBA 4D46A 3HXQA 1CEYA 1OI4A 3ACBA 3GOHA 4FYVA 4B09A 4A0HA 3MAAC 2F1HA 3DMRA 3OX4A 1AHNA 1K5GA 2QMUA 2RHDA 3NM6B 4WOCA 3OX2A 1A9XB 1Z8NA 1Z39A 4QEKA 3RSOA 5KYGA 2PYIA 3L7BA 4LXIA 1G5RA 1VKHA 5D3MB 2H9YA 2Z9CA 1VL6A 4LZAA 4JHXA 4CF7A 4GQIA 3GA0A 5B4TA 5CIYA 1IZ9A 4MH0R 3RK0A 3T3DA 4PLPA 1H5UA 4TLBA 1Q77A 4C0JA 1OXUA 3FRIA 4RTJA 4FCWA 3WVNA 1E4VA 2F1KA 4F2HA 4XQCA 1PJ8A 4NE9A 4YJGB 3ZY4A 3PPIA 1OH7A 4EAQA 4C7OA 1E6LA 1V16B 1O97D 4I5GA 3V8VA 3JQRA 3A1TA 3NYQA 1OH5A 2H2GA 2C4VA 4IH9A 1ZKMA 3WIEA 1T4DA 4BN4A 1EVYA 1OFUX 1EDZA 3FHLA 3WOVA 1MDFA 4LRWA 1KJNA 4E4RA 3P1JA 4TS1A 4DLRA 2ZI7A 2IHTA 5H3CA 4DHEA 3P9IA 4MZDA 3CEPB 4Y2TA 4PINA 2Z4RA 4E2FA 4EI9A 1M2VB 1G63A 1JHOA 4O4JB 3V4LA 3QG5A 3MGGA 4RTLA 4MYHA 5LD2C 3ST7A 2AQHA 4FX2A 3VJLA 1F2TB 3CKYA 2QXTA 1WPXA 3O3MB 5H3LA 1NAHA 3NVKI 3NMUF 1EKXA 1Z28A 5FBQB 5KTSA 1N5LA 2PZLA 1GG2A 2XODA 3GJ3A 4ZYZA 1ZN9A 2DU8A 2FPMA 1XKQA 5CA0F 4FFOA 3L6DA 3OFJA 2IYNA 1L5ZA 3R1IA 2Q5LA 1O94A 1EJ2A 5KAPA 3CPSA 4L08A 4AF6A 4ND7A 3QYAA 1CG6A 4PAWA 1P4SA 2XR1A 3H9GA 1GSAA 4O6VA 2FPLA 4P4SA 4X85A 3IV9A 4U7FA 3HV2A 3UK1A 1W85B 3T4EA 1VP9A 1IBMB 2R751 2EU8A 5T4BA 3ZWXA 2HDHA 4KH0A 1J33A 3WLSA 1FMJA 4YRRA 1V0JA 2GPTA 4MTLA 3MS2A 4JYMA 4NEQA 4B6SA 3DZBA 3W2TA 4F56A 4A73A 2I91A 3JWPA 3V7YA 1Z8HA 3PUXA 1U65A 4UMEA 2PX2A 4ZQIA 4CM7A 4G1VA 5KZMB 3HLYA 4Y9DA 1D7OA 2J4FA 4D82A 1INLA 2JH9A 3AJ8A 2F9LA 3DR3A 1D6JA 2VF5X 1E4YA 4LDQA 4Q9HA 2HHHB 4FJ2A 4K8RB 5K4GA 3EHDA 4H7JA 4I4TB 4WI1A 3QJYA 5G40A 3GUVA 4MWZA 1W1UA 3VAZA 4F04A 1JFFB 2WB4A 3C39A 4TV8B 4E6PA 3SZOA 4YQFA 1FRNA 4XOIA 1SXPA 2Z09A 1TJ5A 3DDNA 1U9YA 1C0LA 4D6XA 5TGTA 5FT9A 1FU7A 1ZICA 3RUBS 3DE4X 4QEDA 1E0DA 1DIOB 2CJFA 2JEOA 1ILWA 4FONA 2JI7A 3GGGA 4MWDA 4OUDA 1KK1A 2Q3EA 3HM2A 2DY0A 4IQ8A 4O4JF 3OJOA 3GP8A 3GG9A 4BNJA 2JJYA 4KDEA 2CCJA 4FXPA 1BE1A 3Q9NA 4F91B 1TRKA 1XZJA 2UXDB 2ZRBA 3DBLA 4W63A 4CLXA 2X1VA 1CY4A 4LYHA 4G5FA 4OHVA 3ZNOA 2C9CA 4X24A 3TRJA 4ZTZB 3PX7A 2BTEA 2IUSA 1MOPA 5TF0A 4JA2A 2QZZA 2AVNA 4K1XA 4RFSB 3QVUA 2JZCA 4Y2UA 3OE4A 5LZ9A 3WOHA 3D2AA 1IFXA 1Q17A 3MJEA 5DCLA 3FNGA 1X6VA 5I4KA 1GGFA 1DC7A 4IFBA 4ER7A 3HABA 2G07A 1NYTA 4HWRA 3R44A 3DNMA 2QPTA 1U7HA 3AVPA 2DPHA 1W49A 2HIAA 4KX3A 4YP6A 2H52A 3NAZA 3C3JA 1H2ZA 1PWXA 1SKBA 3PEEA 4S35A 5EIFA 5BSUA 4I8XA 1RCXC 1RJEA 3H7IA 5CLQA 3TCNA 2XA1A 1CF2O 1FVXA 1CX9B 1GZHB 1IHXA 5HJEA 1PR2A 1IN5A 4X1KB 3HC7A 3P8ZA 1XVLA 3CZCA 3EVEA 3I1IA 3MTJA 1E77A 1G20A 2IY8A 3PQFA 4PO3X 2O6LA 3VO8A 4YUWA 2OHVA 4Q6WA 5CD9A 1NF2A 1UDXA 4C3UA 2C5EA 3E5RA 1DEXA 4H0CA 4DM7A 4WUVA 1BS9A 5BWMA 5JJCA 4N8SA 5C1IA 5GINE 1ITZA 3CPEA 5AXBA 2G6BA 1YUMA 4BX0A 5DYGA 4KR0A 2HHCA 3KJEA 1UOPA 1P77A 2KS6A 1V35A 4TWJA 2Q8QA 4JB2A 5TSDA 5JW6A 4TV8F 3NJ8A 4IDEA 2B2XA 2UUPA 3AKZA 1JFLA 2P2DA 1RSZA 2XI4A 3U7RA 4MQBA 4TROA 3VR6D 1YZLA 3W1VA 3WAGA 1UXHA 3WSTA 1S8FA 1Z88A 1U2TA 3KYBA 4JBNA 1SQ5A 221PA 2DR0A 3K71B 2M9MA 5GPBA 1T6BY 4PYQA 3B1WA 2IZ1A 3NDPA 1BJRE 3OT1B 3UJPA 3VUEA 2XBMA 2H59A 5CW2A 3OWXA 1IEWA 1TMKA 3PTZA 4O33A 1FDRA 4RO0A 4ZANA 2XKJE 5BN3A 6ABPA 3CF2A 2NO7A 4PPFA 4LRXA 5GWXA 2ZTUA 3JQ9A 2GI4A 3PE4A 1FBTA 4W9RA 2XDYA 3K9WA 3E9MA 4EGQA 2JLZA 2EQ5A 2J3QA 3OZTA 3WZ2A 2P2ZA 1MX9A 2VRCA 5MN6A 3IE1A 5IM5A 4I1YA 5DN6A 4AT1A 2BFPA 2OZVA 4N65A 4RLSA 3WRWA 1B1CA 1U2DA 3ETEA 2V6GA 3DM9B 4HNGA 1EX1A 2WM2A 4TT3A 2XMSA 1UEXC 2PN1A 3EAFA 3FPHA 3GAMA 3ICCA 3IUMA 3CC8A 3OMXA 3BN3A 2Y1CA 4JJ4A 1B15A 1HRDA 4PYIA 2ZITA 2NZ8A 1N25A 1Y5MA 3VZQA 1N34B 2J32A 4XD7A 1ZIDA 3HP4A 3LLSA 2IIVA 3MIIA 1JR3A 3LK7A 4IMIB 2GCNA 4HFJA 3WLHA 3I1FA 4K05A 3ZTWA 3FTEA 3LT1A 2RJNA 5AQEA 2BFEA 1RPTA 2GN1A 1DDIA 4JY7A 3EXEB 3LUGA 3UCEA 1L4NA 3TN7A 4P98A 1TECE 2NU7B 4AF7A 4EFLA 4NKRA 4ND8B 4RKFA 1QG0A 2JIMA 3G0OA 1VPWA 3PE6A 4HGYA 1Z0UA 3E0XA 3TBHA 3FOEC 3IJ5A 2XBUA 2J9ZB 3NPMA 1NVUQ 3PIIA 5KDOA 4RZ2A 2VNKA 3MC1A 4J0CA 2PZMA 3NT5A 2DR3A 5AI8A 1QANA 2ZZKA 2GKGA 3BB1A 3BA6A 3S55A 4FFMA 1B3RA 1VBFA 4XM2A 4EG5A 1E6MA 2BY4A 3AJEA 3DEHA 4GZ3A 3KHKA 5ALQA 2LW7A 1CY6A 3QMWA 3T5AA 1MHTA 2VJAA 1WCWA 2P2YA 1WXHA 3PT9A 3WNVA 5KVAA 3ADDA 4B2IA 4CM8A 4MUMA 1EGAA 3S5UA 4XJTA 2BIFA 5E2IA 4J3NA 2V9ZA 4FUTA 3RTCA 3SAJA 1B3BA 4HQLA 3GD5A 3RRYA 1V37A 3LCVB 1GAWA 5DYYA 3SF8B 3ZLVA 1CQXA 4ANFA 3HTXA 3CX4A 3MRTA 4OU5A 4JEUA 1U0TA 5JSZB 1C14A 2OB2A 1Z08A 1KVUA 2D06A 4K9NA 1OLSB 5B1HA 4DLSA 2HK7A 3ITKA 1JE0A 2F1JA 1QB7A 2F7SA 3FYUB 2DPGA 2ORYA 2RDMA 1NHGA 5IUNC 3IVMA 4XYMA 5LC1A 5LP6F 1TKBA 3AUXA 2BMVA 5I7UA 3AEUB 1RYHA 4DLNA 2C59A 4ZPXA 3N75A 5EIEA 1NY5A 3AQIA 4Q48A 1OZAA 4R51A 2ST1A 2VPQA 4MRPA 4X61A 3BTSA 4R2WA 3SHVA 2YC4C 1BW9A 3FB1A 3FOAA 1DX6A 1MC5A 4CDNA 1WB4A 5ARDA 2BHRA 1ZD4A 2XWSA 4YAJA 2K5UA 5SY6A 2C9BA 3UGKA 1MW8X 4OY3A 1W0JD 3BEOA 1IM2A 3K92A 3D8TA 3R24A 1ISHA 4HADA 5CB8A 1A4RA 1B1AA 2RAUA 4F5YA 5DX1A 4D8TA 5KS2A 4R1TA 1H1DA 3LT2A 5FX2A 2XUGA 3NHMA 5DE3A 4ZAYA 1AGYA 1AKTA 2ZJ3A 5ES4B 2GPAA 3M34A 1SUBA 2BCGY 3LUPA 5KYWA 5A5EA 5BR8B 4BVEA 1J5EB 5KYVA 1IDOA 4MVCA 3L0BA 3S2SA 2VBGA 2FG6C 2ZW9A 3F6SA 4GECA 4QO7A 5IDQA 5JECA 1TKRA 1H8HD 1YR7A 2HMAA 3AM4A 3OIDA 3T1QA 1BRTA 1M2GA 1PN3A 4NCHA 5AXDA 4E1VA 1LLDA 3ETGA 3THXA 1E1KA 4IFEA 3NBYC 4NRDA 4W8HA 2ONJA 1P73A 3VDMA 3UPTA 3DWGA 3N8HA 2YYAA 4HVCA 4RPIA 5GADl 3WR5A 4NDAA 1FNBA 1OX4B 1PV1A 1X14A 3ZX4A 2EFYA 1R27A 4EB0A 4PIVA 4MPTA 4UVIA 4GMKA 1XDZA 4C7JA 2P7IA 1L5NA 5K8UA 2R5WA 1FC0A 2WVAA 2UUCB 4LYYA 1USGA 1OYYA 1E5XA 1ZWKA 2IY9A 4KXWA 5DGIA 4N6GA 4GQAA 4RVUA 4AJEA 4HH0A 5HK8A 1C9KA 3QVOA 5A4MS 1KYTA 3FPNA 2OWDA 3E81A 1U8CB 1YRQA 3ANSA 1OREA 1XA3A 1OTXA 2ZGVA 2RBEA 1SD2A 4HDOB 1C7JA 2PPVA 2GK4A 3NB0A 5LYJA 3DZHA 5EZ6B 1QCZA 1W44A 2WW8A 1KEEA 4ZCPA 2VSNA 4PLGA 1ST2A 1B16A 5KSWB 4G0WA 3K09C 3O84A 2VP5A 3AGQA 4LIPD 3ZE6A 4TSFD 3OX3A 4X41A 1KI4A 4ZODA 3G8CA 3EN0A 3T7AA 3BE6A 3PVCA 4BVJA 4PZAA 1LBIA 3GFPA 4YJFA 1SRRA 3U26A 1DC6A 2NO1A 5DMHA 3UMFA 3MHTA 5ALYA 1M6VB 3EH1A 3SZGA 4D96A 5EWLB 4F4JA 2PSHA 3ON5A 2VUHB 1ECGA 1TQHA 3OHMA 1DB3A 1WV0A 3GUZA 3SIPA 2CHFA 3G79A 1DBIA 1W2WB 2CMGA 4PAQA 2JAPA 4Y0NA 1CQIB 3AUKA 3QFSA 3ZIDA 1DP4A 1ZZEA 2I2BA 3PSAA 3GDFA 2GF2A 4TTPA 4A2WA 4UPDA 3I2IA 5J23A 4YPVA 4D6YA 3L0OA 5MHTA 4UBJA 1U8AA 2FPIA 1E2QA 1FFBA 2GPYA 3PXBA 4J03A 4YGYA 3QVLA 1T4BA 3K73O 4MB0A 1U5AA 4XQEA 4HZUB 5NLLA 3W1WA 8GPBA 1P0CA 2AFHA 1UCFA 4JN6B 2CVOA 1E9VA 4FOLA 4IJ6A 4IIYA 2CVHA 1B6RA 3GJ5A 4KQ9A 4R0VA 3K6SA 3LUCA 4BFLA 3EDCA 3PXAA 1L3CA 5DIZA 1LNZA 2ZULA 3ZV7A 5IKPA 3L7DA 3V6LA 4ER6A 3HKDA 5JQWA 5KREA 3FLEA 1XELA 1WMEA 3FUUA 1P3JA 3KNZA 3ZDXB 2GXAA 3VZRA 3GLGA 1CJMA 3JVEA 5DF1A 2HX1A 4CQNA 1UC5B 4HZGA 2O50A 3M1IA 1P2FA 1U1CA 4HGZA 4DSAA 4CKBA 3AP1A 1NC3A 5HKAA 4N41A 1J00A 1EK1A 3U3MA 1W1WA 4DV2B 2YFKA 3T95A 5A6VA 3T3EA 2QI9C 4A5SA 1R8JA 1ELOA 1JQEA 3C3XA 5CEEA 1HXHA 3URKA 1GAQA 4JSYA 4DRZA 3I2HA 5TQ2A 3ZXWB 5J4YA 3QOWA 5CLIA 2XPCA 5AW1A 2R8YA 1U8EA 3VO2A 4AKTA 1EVLA 3QPUA 3K1ZA 3AF0A 3DC7A 3NBUA 4J0EA 4GOMD 3EOBI 4R31A 2R66A 5KHLB 1AKQA 5LQAA 5GIOE 3I4CA 3VC7A 1KXZA 1A9TA 1V5EA 3BIOA 3GJXC 3KKKA 3PS9A 2DBQA 3Q3HA 1FVOA 5H80A 5A04A 2C9DA 4XKJA 4WEOA 5LQRA 1U3VA 1V9CA 3PNSA 4WLFA 4XUGB 4JU8A 2X0DA 4YRKA 2IODA 2FWAA 4L6CA 3VZCA 1OLOA 2JD1A 2DPMA 2C88A 2WT8A 4LQCA 4FI3C 4ZT2A 3MLEA 4IKPA 4B45A 3MJCA 1PJRA 4J94A 5LNK6 1M6NA 1ZJ5A 5JYCA 4FOOA 2NACA 3FTCA 2ZE7A 3NC4A 4RK4A 3ZDYB 2E6KA 4BWGA 4MHSA 4O4HB 3KJZA 4Z54A 2RGRA 1GIAA 3D7LA 4YTEA 4RU1A 1QK5A 1K97A 4UUOA 2GN9A 3CX6A 4AKIA 3NIDB 3TSCA 1XWIA 4B0OA 1OW3B 1PNQA 2R7MA 3CRQA 3N70A 4TS4A 1GSOA 1UXOA 1O94D 2AMYA 2G77B 1H6AA 2VUTA 3DMFA 1CUAA 1WNTA 2NYAA 5CMLA 2F3PA 1D0VA 1H66A 1I4WA 2HH9A 2WNSA 3NOQA 2F9FA 1R9MA 3R7DA 3SE0A 1UOOA 3AF1A 5DBGA 3RNLA 4YRBA 1J4AA 2VJDA 4C5CA 2NVUB 1KO5A 4Q1CA 1Q57A 3EQ9A 3ZN2A 1PVDA 4IDFA 3RS4A 4RVOA 4NYMR 1KF0A 1WCXA 2AFIE 3IAFA 4IOMA 5CNKA 5EJ2A 5LYYA 5DN9A 2WB2A 4L72A 4QU5A 5NULA 3HS3A 3IVCA 4WINA 2RC5A 2OMKA 2IBMA 2CMDA 4FWBA 2FJPA 4W7IA 4JI3B 3T1VA 4YXFA 5ESRA 3KV1A 4L5IA 2FVYA 3CF6R 1GLNA 1YE3A 3G1TA 4LF5B 2ZRMA 2GJ8A 1J97A 3ANTA 3F49S 5CXSA 1ZI6A 1G17A 3OVMA 1BD3A 3JX9A 3GGDA 3FMOB 1C3EA 3UWKA 5A5FA 4CMEC 5KVSA 1X38A 5AKIA 3CJRA 3ICQB 4LXTA 3ZU3A 3QKSA 4UBNA 1Y6RA 1YL7A 2EZ9A 2I87A 3EZ6A 2VZ9A 2O3UA 1IEVA 3A4LA 4QOEA 1B0PA 4ZOLB 4B80A 4MV8A 5BP7A 5KNBH 2MSNA 3E03A 3QPVA 3SSMA 3UIEA 1AHPA 4DCGA 3EVCA 1FX0B 4MUNA 1X42A 1XPJA 4PC1A 3CWCA 2G0NA 1XN1A 2ZJ8A 4DLTA 3PC2A 2VQDA 4HNSA 2Z3VA 2HNKA 3HJTA 1PK9A 4O4HF 3R9WA 2EFHB 1YH3A 1SCUB 2FFJA 2IL1A 3KXIA 2XT6A 3ET4A 1AUOA 3ZD8A 3KCQA 4WZAB 5JHGB 4S05A 3GJQA 3AR7A 3NOOA 4BO3A 2PQ6A 4DQDA 4GMDA 1FP7A 1EFDN 2KSQA 4OMUA 4BVAA 1K3FA 1LJ8A 4NMHA 4Q7EA 3S27A 3F96A 4OQZA 2UZAA 4FZ5A 4L6IA 3UCXA 4RPJA 1KMIY 3DDOA 5AJZA 2GMWA 2QPLA 3PRKE 1ZMBA 3AV3A 5LOVF 1Z36A 1CJKC 2F43A 3L1UA 1ULAA 1UFOA 5LP6C 4A8JA 4LGYA 3DC2A 5G4KA 4LJKA 4R8KA 2IHKA 2P4SA 3UMRA 1R5BA 3HDTA 3TOSA 2DQYA 1BU5A 2GRUA 3DYIA 3WMFA 3UXMA 3ETHA 2DBZA 1IJEA 2B92A 5KI6A 4BMCA 1Z17A 1DI0A 3H1EA 4K6OA 4ZRDA 3U4QB 1VFNA 3V1MA 2P5TB 4ZZ1A 2KM1A 5ALHA 1U7PA 3LIPA 3DEAA 1K7YA 3D8SA 3D8HA 3UXHA 3OM8A 1V6CA 1Z5NA 3R5JA 1USWA 4O1IA 1J1IA 4OD0A 1KEUA 2E4VA 1YNSA 3G2NA 1XNGA 2F48A 4MQFA 4PBRA 5ALLA 3T1TA 4YLYA 5HKLA 4M8KA 3ZV5A 5HF6A 2PEZA 4IMRA 3VZDA 3EIUA 3PQ6A 3CH4B 4RHUA 4JVMA 3UJ7A 2ZBDA 3OTQA 3ROTA 2D7DA 4L22A 3SY8A 3L4KA 1XGKA 4XWYA 3HN2A 3U48A 4BO6A 5CNMA 2PH7A 1EESA 4HLNA 1WHTB 3A9SA 4G0QA 1T0UA 3HFGA 2KI5A 1E69A 1GKIA 4QXRA 4HDSA 2HTFA 2ZB4A 1ADBA 1LZLA 2WLSA 1YHNA 2E4WA 3DFFA 5JS1A 1N2XA 3RJZA 3CLTC 5DXFA 3X43A 1I9CA 1UZMA 1QK4A 3A70A 1FLNA 4DYVA 1IM8A 1QOZA 1NYQA 1X39A 2GM9A 1RAEA 1VIAA 2BUBA 2D8MA 2FQQA 2PV0A 2XD9A 3B13B 3BL5A 4W5OA 3FDJA 4Z7NB 4ME6A 3BERA 2VRCD 3BB3A 4XGNA 5IT5A 2Q4EA 4EMUA 5SZJA 5LQSA 5KOJA 4TT3D 4I8IA 1MAHA 1ML3A 2OBMA 4MYCA 4HK4A 4Z0NA 1DVRA 3EAQA 3S2GA 3VH3A 4IDQA 5AJWA 2D0PB 3LWDA 1WG8A 5CH5A 2QRVB 4N7BA 4NC9A 4KQEA 2PANA 3QLVC 3GPLA 1B76A 1ZOSA 1RAAA 2A5JA 3HGMA 4PICA 4RPGA 1BDHA 1J99A 1BGXT 1KEZA 2NV2B 1JR3D 3A32A 4D9JA 2WF5A 2B7CA 2P77A 1MIOA 4L9RA 4ZQEA 2ZIXB 1KI1A 2N9UA 2I67A 2VDLB 1PT6A 3QHAA 4MUKA 4LDNA 5FRDA 1DBQA 3GJSA 2FLWA 2Z5LA 2JBAB 5EZSA 4XUEA 1EGHA 2F59A 4XVQA 3MWEB 4Z7OB 1TRHA 2IYQA 4I9UA 2AFVA 3BICA 1ORIA 3LWBA 4HMOA 1HT2E 4B6GA 3WS7A 5MGNA 4E12A 2DFPA 2KHZA 1WKCA 1EUCB 1NL3A 6YASA 3WLPA 4F60A 3HV0A 3O6VA 5CT4A 3AERB 2NO5A 1Z8DA 1U3UA 4FKBA 8ATCA 3ENNA 4G4JA 4PM4A 3VRHA 1I32A 4D43A 1ZQ1A 3GT3A 2ZB3A 1PP4A 5EEGA 4B2LA 4KXQA 1YJAA 4C6SA 6REQA 3OP1A 2XMQA 5AD1A 1OR8A 4AU1A 1W4CA 5FOSA 3THSA 5LQUA 2OXRA 3V8RA 4GXQA 5IHPA 4CM9D 3IJRA 3JTMA 1XCOA 4RUBS 2X23A 5L6LB 1N3LA 2V0NA 3OZUA 5BSEA 3EGVA 5COAA 2IS2A 1A8UA 1KAHA 4IXDA 2AWOA 3TXAA 3KAPA 3TIVA 3EZLA 1MTOA 4L0MA 1JECA 2E3JA 3ABQB 1XQXA 2WVGA 1E6CA 5JXHA 4O4IB 4W5JA 2UVPA 4TM8A 3WMRA 1NVEA 2B98A 2GFQA