2HW8A

Structure of ribosomal protein l1-mrna complex at 2.1 resolution.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKMGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/rna
molecule keywords 36-MER
publication title Structure of the ribosomal protein L1-mRNA complex at 2.1 A resolution: common features of crystal packing of L1-RNA complexes.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 62
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 2hw8A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hw8A02
4QG3A 3UMYA 1DWUA 5DM70 1AD2A 1ZHOA 3U4MA 1I2AA 4LQ4A 3TG8A 5DM60 4F9TA 3ZQJA 3QOYA 3FPNA 2HW8A 4QGBA 4QVIA 3U56A 1MZPA 1U63A 1CJSA 4DFCB 4REOA
chains in the Genus database with same CATH superfamily
3DULA 4N76A 5LBTA 4PZLA 3STUA 2AW5A 3MUFA 1I2CA 3EY9A 3R76A 5C8YA 3V33A 3QNMA 5BSTA 3VOTA 5LQMA 2XT6A 5FTMA 2VYCA 1C1DB 3TG2A 2C97A 4O2BA 2VJPA 1VE3A 3FNEA 4ZOAA 4IIFA 3AETA 4QOGA 1LWNA 3PT5A 4PAGA 4XR9A 4ZV7A 4RZ3A 1KAQA 1VP9A 5LP6A 2RHRA 1QF9A 1JLHA 4K8OA 1E69A 1T9GR 2XDYA 3F96A 2HREA 3A70A 4E5UA 1NQAO 1AA9A 5P21A 3RIGA 4K26A 1N57A 1YHZA 5JEEA 1JQDA 3EAQA 3KUXA 1WW8A 2VDOB 4INPA 3N70A 2Z2YA 2CMGA 4ILKA 3VKVA 4NBWA 2NYUA 2ZB7A 3OECA 3QUSA 1CS0A 1FIUA 2QAJA 1QU2A 2BZGA 4DWWA 2Y6UA 3DOUA 5ALYA 4XDZA 3NBUA 5D2CA 3VR2A 4E2ZA 1TYAE 3H2BA 5C18A 1GU1A 4GC9A 1EGMB 1GPUA 4EJ6A 1NUUA 3O1LA 3JPYA 4DILA 4EWLA 1PO7A 4G0NA 2DM6A 4IMRA 3NHUA 3R20A 3ASUA 3DKVA 4IEFB 3EOAI 4G41A 3EG5A 4QYWA 2DFDA 4J0IA 3F8WA 5E4TA 3I0MA 3R09A 1BS9A 4NCNA 4W5TA 2H54A 5FNVF 1VGQA 1XU7A 1RACA 1W47A 2CLFB 3GOHA 3GFOA 3MGGA 4GZ3A 4JLMA 4TQ9A 4DCCA 2JLAA 4Q4DA 1CUYA 4DJTA 1UMCA 2FN3A 3U3ZA 5JDIA 5DPMA 3RYFB 1H8EA 2O8CA 1NHWA 4PXSA 1MNAA 1Z7WA 2PFSA 2DRIA 3E05A 2J48A 4Y2VA 4AAYA 3FFXA 4ND8A 2CNBA 4P5PA 1Y1TA 2P1RA 2VT2A 3BXPA 4Q3KA 2DFPA 4F9TA 3ZI7A 1X38A 3ZE1B 5L45A 4JB0A 2HPHA 4N7JA 5EIAA 2BMJA 4X8LA 2RAUA 3G5UA 4NBVA 1PBNA 3NXSA 3BIFA 1H3FA 3L0PA 1W49A 1BXGA 3GDOA 3IRUA 1N0VC 4G84A 2FJ0A 3SKVA 5I45A 4D74A 1FJXA 4UVIA 4ZJZA 3OPQA 2H17A 2OZVA 3DOJA 1TVKB 2REXB 4IFEA 2CFSA 3LC0A 4G25A 5CTAA 3RFXA 2CE7A 3GQVA 4FBMA 3VOBA 4RDCA 3D8RA 2PU5A 4Q3NA 4I46A 2F59A 2H3HA 1HTTA 5A5EA 9LDBA 1BCRA 2BTQB 3OKCA 2Z8YM 5DI3A 2HA0A 3QG5A 1VGRA 1AT1A 2VEDA 2Z2IA 3HB7A 3BWVA 4JJEA 5H7XA 2HMYB 1TU4A 4K1XA 3HC7A 5I7VA 1JR3A 1L7VC 2IF2A 2X22A 1G3RA 4OMCA 3N6VA 1GCOA 1UPAA 1P2SA 3DE0X 1W36D 1Y9EA 4KR7A 1H2EA 4UUBA 2CHFA 4EG0A 1W4BA 5FBLB 3LWDA 4I50F 2R6HA 3DFKA 5EE1A 2JGEA 1EXNA 3IAHA 5F1KA 2ZJ6A 2EIHA 4L1KA 4NENB 4KQ6A 3KYIB 4I4CA 2PX6A 4JMLA 2VS1A 1VA5A 1Y4UA 2W2KA 3D8SA 1FDSA 5JS7A 5J47A 1Q84A 4KK4A 1MFPA 1JW9B 2C42A 4R69A 4R2IA 2O48X 4F9FA 1GGMA 2ZR9A 1NVWQ 3QTBA 3DOIA 3JASB 1RVDA 4KODA 3ZWXA 1H6DA 1P8JA 4BO7A 3PHIA 4UUNA 5G41A 1YR6A 1E2QA 3R41A 3K70C 2DVMA 5A03A 2XUPA 4P1ZA 4PCLA 1GXSB 1AE1A 4FR0A 1G17A 4OYHA 5BRJA 3HEBA 2IT1A 3VPDA 3K5PA 3QYPA 1VG0B 1RM5A 1UDBA 2ZJ2A 2P6PA 2VRWA 3L8HA 4J2HA 3ILVA 2FUEA 3H86A 1QUFA 1Z56C 1RFGE 3ML1A 4MPRA 1HM5A 3SYTA 3P5SA 2OECA 1W1UA 1ZK0A 3BULA 4HQ0A 5I51A 2UUBB 2G9VA 4MKIA 3OX4A 2AUNA 3TRDA 3Q2OA 2ZBQA 2XQVA 3RK0A 4IVNA 5CDTA 2J07A 2O50A 4OBEA 5K0ZA 2YNMA 3H1PA 2WKRA 3KXKA 4OBXA 4XA8A 4X1KB 2CXNA 3D3JA 3DB1A 1XRMA 3BSSA 2WF5A 4P58A 2GBLA 3I9OA 2REOA 3H5OA 5GY7A 4QUEA 3G9XA 4B3BA 1M34B 4AQYB 4S12A 4ZVOA 3N9IA 5DRYA 2OQRA 2JI6A 3LVBA 1IN8A 2R44A 4X95A 3EFHA 5DN6D 1E0SA 2UUPA 3NMUF 4PONA 2VH2A 1KDPA 3OQVA 1GTJ1 1TUBA 3IQGX 4LF7B 4A0QA 1PFQA 4E12A 2MSWA 5TC4A 3GLIA 3ZV3A 4ZQFA 3CX4A 4LKRA 2Q6LA 5C1OA 1RXUA 3TOXA 5LJLA 3NNNA 3MA0A 4HRXA 3H11B 5A6SB 2PE5A 2V1UA 1SXHA 1HKHA 1N6PA 4B2PA 2Z98A 1L5FA 1THZA 4RLSA 3TQQA 3IDSA 2O3SA 4TZKA 1KFBB 3A9CA 2GD0A 4M8NE 3BOSA 1Q6ZA 2IZ7A 4QQKA 1KMHB 3BD9A 3WRWA 4MWEA 4ESEA 1JKMA 4A10A 4XD7A 5BNTA 3SG0A 2J46A 2UDPA 4KQHA 3CCCA 4HEQA 4NCKA 2AFIA 3IAAA 4TQGA 2RE8A 4YAUA 2VC2B 3EWAA 1A5ZA 3KWLA 2O52A 4GX5A 1GUBA 3EXG2 1W36C 4PN7A 1T1RA 4AXXA 5JJLA 1JHVA 3E27A 4IVQA 1N25A 1A96A 1X1QA 2C4KA 4R54A 5LP6C 3C3KA 2HYIC 4OLBA 4Q16A 5GP1A 2CXTA 4EY8A 1XHEA 2XNHA 3LK7A 4R8LA 4BLTA 2O8EB 3ZDFA 3OTWA 3LGAA 3QIVA 4KE9A 1I7LA 3E70C 1UPXA 3EVCA 3QVWA 4HGZA 4NBLA 3BJIC 4LJ9A 2Q49A 4OXQA 2RH8A 5CT8A 3UANA 2GZMA 3B6IA 3HA3A 1H2YA 4GLLA 4DV0B 1KVQA 3P2KA 1Y1QA 4P92A 3TKYA 1MQ8B 4EYEA 4F7WA 1FTGA 4YRPA 3LFUA 2D1SA 2D54A 4LHVA 4UBKA 1G9XA 3CRW1 1G9SA 1COWD 2C5FA 3D7NA 3LCUA 1RCOC 3RHSA 3HEAA 5YASA 3WB2A 3GGPA 5BN4B 4AZ0B 4C01A 2TS1A 2Q3HA 5C81A 5ER9A 1SVMA 4OHBA 3OO1A 4LN1A 2UVQA 4QJ5A 4GW3A 4CF6A 3S2SA 1T3ZA 1Z06A 3BSYA 3COJA 1Z3IX 3WIUA 5LP1A 1WCWA 1U99A 1NDHA 1MPXA 1YK1A 3AIKA 1N6NA 3LYAA 1M1YB 3BK7A 4HUQA 1A5SB 4LOAA 3WDMA 1L5OA 2JCXA 3GQBA 3UJHA 3VDMA 1Y1RA 1USIA 4IJUA 5BSFA 3UZUA 1Z34A 2Y4NA 5FPSA 1WSAA 4BNUA 4OXYA 1E61A 3D3QA 2QLFA 5I7FA 5JDIC 1H22A 4HXGA 1F51E 1OAOA 3KD2A 3KKKA 1CX9B 2QDXA 2H92A 2XA1A 3ZHCA 2Q1XA 3EVDA 3OZVA 4PYLA 4US0R 4K6OA 4ZT4A 5FULA 1C4XA 2H57A 4MJ7A 5JMWA 2PN1A 4W6QA 2DSTA 3QU4A 1Q7TA 1AHIA 3JQPA 3TYXA 2V7WA 1LDGA 4ABYA 1WW2A 4QUJA 1SKQA 4GP7A 2VJQA 3LOPA 1G5QA 6ADHA 1U2DA 1EVJA 2EZTA 1DVRA 3V4OA 3HDHA 4BJ6A 3TZEA 3W5DA 2CVZA 1DZ3A 4D8YA 4CLDA 3H5AA 3TRIA 1LY1A 2P5YA 3FMVA 1BX1A 3Q7QA 4QE3A 3NT5A 1J8DA 2A0YA 1OASA 4Z9BA 4QREA 3HYLA 5F76A 1XZMA 2IPXA 2Y9PB 1ATZA 3DWIA 2O0LA 3PHLA 4I1RA 3NX4A 1UPBA 2FXIA 1P1KA 4OX9B 2J5BA 4IJMA 1NXTA 3ZNNA 3RSHA 1C50A 1LZKA 5CH3A 5CD9A 5KQRA 1PR6A 1P81A 2EFGA 1R37A 4LOLA 4UD6A 3HCAA 4I9NA 5E6SB 1C8VB 1HOXA 2YHIA 5EKDA 4BS9A 5BMOA 1KO5A 4ER7A 3O8OA 3H1TA 4R41A 5L40A 1SBNE 2EC5A 2QE6A 5FD8A 2H1VA 3STWA 4CPDA 4RORA 4W1QA 1TGYA 3UMGA 1CFJA 3DAFA 4EHDA 2E4UA 4YC7A 4RHTA 3H1BA 5DN9A 1D4AA 1NYTA 1KAHA 3LMKA 5HIIA 4O2AF 2ACKA 3FWNA 2QSUA 3EXHB 3G2MA 2IU6A 4GVPA 4N6GA 4Q7MB 4WK2B 2QG4A 5HXAA 1C1DA 5ITSA 4RTJA 2R5FA 3CKLA 4HLUA 4MROA 1YVPA 1ADYA 5JMOA 3D31A 2AOWA 4LISA 4UPVA 1GITA 5EZ6B 1E4OA 1O03A 4FZJA 3LUCA 3RVRA 3ISJA 4D82A 1GYPA 5I9BA 3NIFB 3KB2A 4PTLA 4MWSA 3CQ9A 4J76A 4NFLA 1KIFA 4MLCA 3A6HA 3WK7A 4FZRA 4BO8A 5KWJA 1JI0A 5GONA 1KEKA 1MAAA 3T52A 4JI7B 3AUFA 4IVPA 2MDTA 4L16A 3RJ5A 4DLSA 1P6XA 1AF4A 1K5PA 2WKPA 2EJCA 4OUDA 4Z7NB 5A7FA 3WIDA 2FUG6 2NG1A 2L19A 1UJ5A 3JWPA 5CPBA 1T36B 1J23A 3MINB 4RTSA 1K7XB 1J09A 4HGQA 4EZEA 2CXPA 3AEKB 4CCSA 3WMXA 3FI0A 1SHLA 5ALLA 4JBYA 3W5VA 4E6PA 3FJ1A 3GDHA 4L5AA 4PR3A 5JLAA 1BVRA 4XIGS 4ZICA 3OPMA 2ODNA 3NTXA 4D8XA 4F3TA 1Z33A 1Z07A 1A3CA 4LXUA 3SE0A 4QM6A 1MG0A 4BVAA 4G0ZA 3WK8A 4M1KA 3VO9A 1MX1A 1EXDA 1YDWA 4UTVA 1W73A 2HTFA 2VN8A 3FDIA 2VRBA 4D97A 4ECEA 4XB1A 1D2CA 2RIRA 1G0OA 3AHIA 3G5MA 3QOFA 3PQ4A 3AVQA 4YMTA 4RUBS 4A4DA 3ECCA 3TO5A 1DJNA 1U0LA 4MMYB 4A1FA 2I62A 3PE4A 2YWJA 2GBLC 4IMPA 1IQUA 1BKYA 4YMVA 3QLVA 3PQ2A 5GWXA 1V5IA 4A6PA 1Z4KA 4H0NA 4FFWA 3IILA 4K9OA 1WXXA 4RVDA 1OUMA 2VG8A 3S2ZA 3I4LA 2W2QA 4FTWA 4GT1A 3GNSA 1GQRA 2ESRA 3MW8A 3C41J 1GQOA 4EG6A 5AKHA 5CBKA 3JD4A 2I2DA 3OT4A 3IFSA 3QRWA 1F1JA 5EWJB 1DIAA 3KG2A 1KSJA 2GK4A 3C43A 1DIRA 1U2TA 2BJHA 2JGMA 3TVTA 1XQYA 4JI4B 3ZWMA 1TFUA 5IX8A 1V25A 3MWDA 4QJIA 2BTQA 1GN9A 2GWRA 1EFRA 1R18A 3S40A 1XYGA 4KJXA 3U7FB 5K0JA 3ICOA 3GMDA 4ZCPA 3RCBA 3V3KA 2J9RA 4GZMA 4MUFA 1QVRA 1ZMOA 3EIQA 5D5PA 4QZVA 5I9TA 3DBOB 3W5BA 1E7RA 1TMGE 2FK8A 4MV0A 3V8MA 1BN6A 2FKNA 2AN1A 3CGGA 5LBUA 3UT5A 1PNOA 3ZDZB 1WZIA 1YB2A 1O3YA 5JLJA 3AR5A 4I1IA 5CYOA 3S7TA 5K0CA 5DISB 4QUAA 4LNUB 2PX4A 1OZAA 4UASA 3KT6A 4G85A 1KJ9A 5EINA 2FLWA 2VP4A 1NURA 1Q1AA 2ETVA 2EL9A 3G79A 5JRJA 1UC9A 2CW5A 2VR1A 4RU1A 2OC4A 3OETA 3BE6A 3RT1A 4GOND 4IWYA 2EDCA 3QFTA 4NENA 4YPOA 2G5GX 2XBLA 4IDQA 4KRXA 4V0MA 3ZU6A 1NBAA 4BGDA 4K6GA 1RJDA 1TK2A 4JBIA 4LYAA 1QQ5A 4HQKA 4RSRA 1AK1A 4NEQA 5IEJA 3TOSA 3W5AA 3DD1A 3F6CA 3NPMA 1S4MA 1E7YA 2CNWD 1A5AB 1LQTA 4HH0A 1FP1D 3JASA 4QBKA 4BMDA 3O93A 2V5VA 5E4FA 3S4YA 3IIJA 2QROA 3FRIA 1GXSA 4LBVA 1XDBA 3H5VA 4Z53A 2C98A 4EPTA 2OD7A 1T3TA 1B8OA 2JIRA 4B7UA 1IL0A 4EUNA 2ZI5A 5CK4A 1ZCAA 4CV2A 4EG1A 5HPYB 3D4IA 4BNLA 4PYOA 2OXEA 4YUVA 4FKZA 3PJGA 1RPZA 3V3TA 2H2GA 2IYFA 3G5TA 1EVYA 1KAGA 3RAEC 1EB8A 4IS2A 2VXCA 3PXGA 1F8YA 1XQWA 3L6BA 3K4PA 3KDPA 5E3HA 2NO4A 3SEAA 1VJGA 1Y6ZA 4X8OA 1Y3AA 5FYQA 3L9XA 2AF4C 2ZR0A 1IHYA 3JVIA 1KMQA 1HLDA 4DHWA 3MD9A 4DXAA 1W19A 5ABPA 2BSXA 3EAGA 4H27A 3W9UA 4DS3A 3ZU4A 4ZO7A 5KYVA 3IAM6 5LZ4A 3VVBA 3TQSA 3TTVA 1ZMBA 1M34A 5L3SB 4OEHA 1RZVA 2DY0A 2E55A 3MOIA 1U2DC 1AS3A 1L4KA 3FSGA 1EIWA 3WI7A 1OGIA 5GAJA 1G6KA 4BMPB 3M5DA 1NWCA 2FN8A 1CE8B 1Z6YA 2RMKA 4CLHA 5LQUA 1XT6A 3ZBQA 1XTJA 5HTKA 1K8XB 1NE2A 3I8OA 3DLTA 1PSZA 5C46F 2B4QA 1H42A 3NTLA 4HWSA 1ZJZA 3L5KA 1E60A 2WJGA 3EBOA 3LXXA 3EGDB 4B8ZA 1EE9A 3JVEA 2RCNA 1NPTO 4HXEB 5KQGA 3RT7A 1MIHA 3B51X 4KPUA 1JNYA 5ILGA 2PXCA 5LR6A 1CYDA 1KPIA 5E6RB 1J2YA 1R6AA 2RB4A 4EECA 1GUZA 3QEOA 4EG7A 1E94E 4TVBA 3MZ0A 4HLUC 1YQXA 1RZUA 1SKYB 2XYHA 3USCS 3RBAA 5BN3B 3E0XA 5BW8A 1Z39A 1IN6A 4R5MA 3KEOA 4DNXA 4UPEA 3U61B 5EE0A 2WVAA 4EHAA 1GNSA 2Q4EA 1GAEO 1U8XX 3ZE9A 4ZOCA 4RK1A 3GGSA 2O8EA 2OENG 2BGKA 1K92A 4Q4HB 3VAAA 3SYNA 4M98A 4RF2A 4MWZA 1EJ2A 1TKBA 2YV4A 4MVJA 1OZFA 4FXOA 3C8UA 4F46A 3R3WA 1SXIA 2DJ5A 1KKUA 2J9FB 5JALA 1UWVA 4WZBB 2FP4B 1AKEA 3QI2A 1GUDA 5BSKA 3CNOA 1FDIA 2VAWA 2PSJA 1S7CA 4RIEA 3WHLA 3J81A 1MJGM 4A15A 1QOZA 1RM0A 4AZ0A 3O6VA 3OESA 3H9GA 2ENWA 2EJVA 5AQEA 4HB3A 1JHZA 3KPWA 1J00A 4FMDF 2XZOA 4IIJF 1U3TA 1AZSC 4ZOEA 2AMVA 3W2EA 5C1BA 2AR7A 1YWGO 3IIKA 1M1YA 3ENQA 4US2R 4MGEA 3CVUA 4LFBB 4BVEA 3LTEA 4IXTA 1P44A 2XT9A 2NZUG 4WZAA 3HB5X 5SY4A 1OC4A 1BTOA 4N12A 3DFZA 4M83A 3LZDA 2GD1O 2J3QA 3QLVC 1C4KA 3WB1A 4UD2A 3KXLA 3LHDA 3O1IC 5AJTA 1GPDG 1CNEA 3G1UA 5HBGA 1Q74A 3F2IA 2NU9B 2FQ1A 3W3AD 2JFFA 1I0LA 2QVGA 1R10A 1JI3A 2H51A 5FUBA 1USKA 1W2HA 1Z13A 4GXRA 3PWTA 1UJ4A 4BE9A 4J03A 1E9BA 3TW8B 2CLLB 4MQMA 1L7NA 1LQUA 1BKDR 1KBOA 4FE4A 3H7AA 4KO3S 3U1BA 2VZ9A 4JOSA 4Z99A 1Z7EA 1CKEA 1E3LA 1W6UA 3N8HA 5IK2A 1XRJA 4MUYA 1HFKA 2JCYA 5DM0A 1SVSA 2HWWA 3TDKA 1S6YA 3NO4A 2CLOB 2BBTA 1G21B 2DUJA 3CB4A 3R6DA 5I9MA 4RZQA 3W8FA 1THTA 5E6SA 5EWLA 3VR6H 3R5TA 1V8DA 4HJXA 4R83A 2E89A 3ZWCA 4EKNB 4ZIRA 2PQ0A 3H0EA 3ONNA 3VHQA 2FSSA 4LK2A 1LFAA 3IAEA 1P4GA 5AOAA 3TLMA 4DRYA 4KXLA 1NULA 1KOFA 2H5EA 1YDMA 2K2QB 5F5XA 4LTNA 3FWHA 5JH7B 5HKKD 3UMSA 4N5HX 4AZSA 2GHIA 3L7OA 1DTSA 3AZOA 5CP8A 2B25A 2ZDGA 3U5TA 1Z2OX 1OX5A 4CODB 2F48A 2QF7A 5C5EA 1KJ8A 1YUMA 4PSKA 3AYXB 2DY1A 1YGYA 4PRYA 1YU6A 2AOXA 3IDFA 1F8XA 1FU4A 2IBMA 4HGPA 2C4VA 2CBZA 3EF1A 4EJ2A 1O5IA 5JAUA 5FWYB 3OIDA 1JFTA 4KKXB 2VHEA 3WNZA 1JDTA 4CIBA 1IRIA 3QIAA 2IHUA 2JI8A 3PSHA 2UZ1B 3QVJA 1Q92A 4C06A 4ZCRA 3SQNA 1GJRA 2I4NA 2JH3A 4NJEB 4QDXA 5ELXA 3H4VA 2H1OA 1T36A 3MINA 1PDWA 4LOJA 3KQOA 1E2FA 3IQEA 5EPEA 3AEKA 3BA6A 4Q3EA 3AIIA 1L4FA 4MCHA 4KDFA 1I2MA 4LYJA 1TMYA 5H1YA 1X1SA 2CHGA 3L7JA 1OBVA 4X90A 4QFCA 1FW6A 4HDRB 4YXWA 1OW3B 3AKDA 2W2TA 4TV9F 3WWPA 4Z8XA 1LX7A 4X7RA 5JFOA 2QLTA 2ZU6A 3VZDA 4CQJA 3NH6A 5FRDA 3WZMA 3ZD9A 4X84A 4H16A 4JZYA 4B71A 2PEYA 1YCGA 2NUTB 5DBHX 2ANCA 1F2TB 2XIQA 4DA7A 1F7UA 2VYFA 2QORA 3H05A 4K0RA 5JW6A 1QIDA 3H1GA 2QX7A 3SS9X 4M1YA 3DWEX 3LLSA 3FVTA 4MOWA 4LGVA 4XM1A 3UH0A 4AUMA 1XRNA 2ODBA 2IOHA 1EWTA 2BGMA 5B4VA 3T4UA 4NNPA 1VBKA 2XAUA 3UAVA 4DREA 4BMOB 4YAGA 4RLQA 1QQTA 2EX0A 2ISSD 4ETMA 1BROA 1YFKA 2WYVA 3AU9A 1UAGA 3URKA 1I4LD 1OXUA 5EWJA 2BGGA 1JIUA 1U81A 2X0IA 1OX4B 1P1FA 1DWUA 2PAFA 2WKWA 1C0KA 3LBYA 4YRQA 1YHYA 2KMLA 4YWHA 4P5EA 4QPDA 3BGWA 2RK4A 3PFHA 4IQFA 4BFWA 3ET4A 3KVOA 1NJ5A 1T2FA 3FGNA 2ZJ4A 1QGAA 3D7LA 3WNDA 1HYBA 4TSFD 2QPLA 5EYPB 3K5HA 3RNLA 2YDXA 2P40A 1EDEA 3TM5A 3KB8A 5JPIA 5DNAA 2D0DA 3OQJA 1MRSA 3DVQX 1S3FA 2UZ0A 1GNTA 2Q1TA 3A9UA 4CQMB 1PJTA 1O97D 1MGOA 4NOKA 2BMVA 1T3LA 4KGXA 1RAEA 4ZT7A 3PDIB 1P3DA 3L02A 3A0UA 4OGGA 4DIDA 4YAWA 1A9YA 3JWIA 4OQPA 5EESA 1H6BA 3UH1A 4O1HA 5IRCD 4ZTUB 2G8NA 2YZNA 2IH4A 4ETIA 1WY5A 4C4SA 2QD4A 1ZW6A 1T6YA 3KOWA 2VKQA 1Q19A 1V3VA 1KFKB 2LBPA 3NORA 1DEHA 2J33A 4RMNA 4K28A 4QOHA 2O3TA 4IJVA 3C5EA 4U8GA 1Y5NA 5TVKA 2ZAMA 1QH8A 1EHYA 4MUEA 1KYZA 1RP1A 4BFUA 1R00A 5E4YA 2FSPA 2IK8A 5JD4A 4CMAA 2CJXA 1Y1KE 1YJ5A 2PD4A 4MKZA 4EUSA 4BP1A 4LCBA 4EFMA 1E9CA 1NQOA 4UEOA 3O2NA 1T6BY 1EK5A 1U9IA 4PYMA 4Q4JA 4OHZA 4LHZA 4XDGA 2GVNA 2JAOA 1ZWLA 1TO6A 2ZWIA 1E92A 2WSIA 3IODA 4HVCA 2RH9B 3ZIUA 3CN9A 2GBGA 4EGAA 3C7DB 2WWGA 1Q7EA 4N3CA 2NTVA 2PXHA 1U8TA 5FO0A 4D8TA 3MS7A 1H2AS 5AXCA 4CEJB 3UKJA 3NM4A 3DAPA 1VL1A 1LSJA 2QN8A 1V0JA 3DT9A 3G2JA 1Q7GA 3M3PA 4EQZA 4KR3A 5HW0A 5LQDA 1UM9B 1ISHA 1YKFA 4DRXA 3AR7A 2R2GA 4ML3A 3TUIC 2FR8A 1CNFA 2HBYA 3O82A 1JIKA 1RR6A 1IFXA 1Q5PA 3BGOS 3W6NA 4F0JA 4WBNB 4ETWA 3QENA 1OTXA 2QE7D 3Q7EA 4QM7A 1BE6A 3L7CA 3A27A 3BG5A 4ZFNA 4PC7A 5LZ7A 3S68A 5T8KA 3ND7A 3NOOA 4HAWA 3GGDA 4GP9A 2JAXA 3ABOB 4MV4A 4N54A 5ALIA 2JJ1A 2O57A 3ZIDA 1HDYA 3WA6A 7REQA 4CEHA 5TEWA 2VZ8A 1JHMA 5EHZA 3OCUA 1C5KA 4F96A 2WNIA 4P7JA 2W4QA 1SQ5A 3VX3A 2WZCA 3FN4A 1Z4PX 3R8CA 3S2GA 2NTEA 3T15A 1CE8A 4TT3D 3AEYA 1A2KC 4DLAA 3ZV6A 2YXNA 4URWR 4XKJA 1JXAA 1ZRMA 2CHEA 1SD2A 2EEPA 3JR3A 3NOVA 4MLDA 1GAQA 3HR7A 3C6XA 1EIZA 1M6EX 3G2LA 5DYGA 4AIRA 3MT9A 4D2IA 4M87A 4GF5A 2OL4A 4DV7B 5ALGA 5HF9A 4EVQA 5FFFA 1N77A 3KCQA 1TAGA 1C0EA 3EGDA 1SKYE 2ZS9A 2W6QA 2M32A 4EF5A 2A2ZA 1H6AA 4IIHA 1XCBA 3A1NA 3GUZA 4NZPA 3MCWA 3QMWA 4I3HA 3U48A 3ANSA 4CM6A 2D1QA 4A6XA 4J1QA 2QTNA 4KVGA 1V8OA 1FLDA 1Z28A 3AHCA 3Q9SA 4P6VF 4X92A 1FA9A 3RD5A 3LOUA 3N58A 5IDWA 2IH5A 4M1TA 4LKOA 3B13B 2YWXA 2P6NA 3P94A 3Q1LA 1R9GA 2JCSA 3O2QB 4MGHA 5BN3A 5T5QA 5B36A 5K5EA 3RADC 3V8EA 5BVGB 1OYOA 3OCJA 2BJVA 3P0HA 1IY9A 4WZBE 2BR5A 1FNCA 1L5YA 2FN7A 4DQVA 4F6RB 1J0CA 1Z2PX 3D1JA 1SU8A 1YMQA 4PSAA 4Q4HA 1HSOA 1Y6JA 3UMRA 2CHUA 4I1OA 6PFKA 4JASB 3ZCXA 3GRZA 4ZMBA 4PYJA 1K86A 3U40A 1G2QA 1CUZA 1DMRA 4INJA 5J4KA 2BFPA 5JWOA 4FJ0A 2VK4A 3K20A 4J49A 3HVIA 1RXSA 1DAMA 3KSUA 1S9DA 3H2ZA 1Y4DE 1LC0A 2V59A 3MELA 2FN9A 3EFEA 3HJAA 1WZUA 3FMOB 1B0UA 2J6CA 4LMRA 2IIBA 1C7ZA 3C2QA 1V26A 4PZYA 1ZXLA 2D3TA 2OGSA 4OY3A 1ZQ1A 2WJ6A 1N2CE 2HJVA 3FKQA 4OOEA 3R75A 2WV7A 1Z4NA 4NQRA 3ZXSA 3AM5A 4C04A 5HOQA 5LDDC 1LPOA 4UPDA 3BK1A 1KBQA 3TDMA 4ZZ3A 1D6SA 4NF2A 2ZDQA 4CMKA 1M5RA 4OKIA 3Q11A 1D7AA 2R86A 4PG5A 8ABPA 1GLVA 1QBKC 5JTUA 2WT8A 3JARB 4ZQHA 3L7YA 1WF6A 4PQEA 2B99A 4S2EA 1H1DA 2OYRA 2COUA 1FU8A 2FZ5A 2NNLD 4E1AA 1NW3A 4NARA 2VT7A 2Z5FA 3ZBUA 3ADBA 5JY1A 3N2GB 1G7SA 4Q9LA 4EVRA 3FKSD 3GPCA 3N7AA 1TJPB 3R7SA 1CSEE 3NNSA 2FSHA 3DL0A 5U1PA 3L46A 4D9GA 1QONA 2OLEA 2VYND 4YJ2A 1ZVQA 3P2OA 4GXNA 4R1UA 1EI9A 3V1LA 4B4KA 4E4YA 2G1UA 4DR4B 2KB0A 4TPKA 1OLXA 4AROA 3IUYA 1NJ1A 4RC9A 2WUDA 4DRZA 3FLBA 3WXBA 1AY0A 1NMZA 4MKXA 4YMIA 4YUZA 1Q1NA 5BORA 1VKHA 4Z0NA 1DSSG 5FTKA 1PTJA 5IKXA 2ZSUA 3N2KA 1HETA 1M1XB 3TH5A 1RHQA 4MDYA 2H52A 5G0UA 3VDXA 3WWOA 4EA9A 1MH1A 4TSKA 2GHQA 5HRAA 1FC0A 2JLCA 1G21A 3BORA 2DLNA 2PQMA 4EITA 4JHXA 1KMNA 5B5SA 1DC4A 5I7EA 4RM3A 1ZMXA 3O3MB 2J3JA 1I9GA 3DP9A 3F2VA 5EI5A 4AUNA 3H2IA 1GL7A 2IHTA 3ZDEA 1S2NA 4IEEA 1T9KA 2F7SA 2AG6A 1KZGB 1QYXA 1A7AA 3O1HB 2ZBEA 3WLIA 5JH7A 1JSCA 2IX9A 3KOMA 2HOQA 3NQ41 3NZEA 4OAOA 1MOQA 2D13A 4A82A 2P68A 4DVJA 5KAMA 4Z9XA 3OF2A 4O63O 5IDYA 5IDQA 2G80A 1YL6A 4LJLA 3WSVA 1CZOA 3FOCA 3ROQA 1YJQA 3C45A 4RV5A 1FYDA 1DX6A 1E3SA 1KI6A 3TI9A 3JAKB 3QYJA 5IZ4A 2QJFA 2WIDA 5DHPA 1RMTA 2RHTA 3IKVA 4NYIQ 1E4EA 4UVEA 4YRLA 3INYA 1HYEA 4UCWA 1ORRA 4H4DA 1ZUIA 3OLXA 2W58A 4H7HA 4K6CA 5AVRA 1DDOA 1KEPA 1ONPA 2ZYSA 4HWKA 4P80A 4RHYA 5ADUS 1PNQA 2Q2NA 2P75A 2UZ1A 5IM4F 5A6VA 3FPNA 4F2WA 4ZC1A 3IP7A 3P20A 4EO9A 2M6RA 3UN1A 3SSNA 3TJRA 4Z3DA 3C7TA 2V97A 2XCUA 3EZLA 1U9IC 4BN5A 3H04A 1QIHA 4CUKA 3HFSA 2HA5A 1NQ5A 2QIPA 4KXVA 4V0RA 3ZGZA 2PVPA 1YL5A 4I4TB 1U3FA 4AXBA 3MVEA 1YRBA 3BXOA 3EX7C 2C4UA 2ORED 2VSXA 1R9MA 2HMSA 4LFCB 3EXAA 4CTOA 2UVDA 1RAAA 3HJFA 3CPHA 2X5OA 1KMIY 4MQUA 5D1NA 3NW9A 1Z38A 3VZCA 2PWPA 3F71A 2BH2A 4FFBB 4G01B 1J0DA 2PVCA 5DBEX 1M8GA 2IZ5A 4DVGA 2GN8A 5LD2B 2FR8C 4HV4A 3CZ5A 1GZDA 1YQTA 3AC0A 1QZTA 3STXA 3VNRA 1ST2A 1VCMA 4L9SA 4M99A 3CM0A 4A16A 3KEGA 4CM4B 1WKBA 3QE4A 1SOMA 5HJEA 3NBAA 1FFAA 3ZGVA 1F2TA 5FNZA 4IOMA 2SBTA 3MTDA 5KYXB 4D26A 3G59A 5T8KC 1P4AA 1OXBB 3SDSA 2H4FA 2BCGY 2NX2A 2DH5A 4CG3A 3UAGA 3IVRA 5A4KA 3ZE0B 1H9CA 3U3RA 1NZFA 5CB0A 1DEOA 2VQSA 3JQCA 2DERA 4DIEA 1WB4A 3TLAA 1NVKA 3ROKA 4AUKA 4N39A 3VKUA 1ZFNA 1QAQA 1GUAA 1JEQA 3IR7A 3WLJA 2KLHA 1U2PA 3G2QA 4BV8A 2PL3A 4EJSB 1GPYA 5DLQC 1OX4A 5AICA 3R7NA 3A11A 4DCMA 1SUFA 4TMWA 1ZK2A 3MPOA 4DE5A 2OSVA 1N0UA 1S89A 3I01M 1WXQA 2NZJA 4N6NA 4W99A 5J9FA 2G28A 1PJ2A 1TO1E 4DLVA 3ANYB 1ELOA 1F8UA 2VDWB 4KMOA 4X9XA 2C03A 3RPEA 3GG2A 1WMEA 4BO0A 1DCKA 3QUTA 4KAJA 2ZM6B 2R1ZA 4PCUA 4WADA 1JQBA 4V02A 4KEAA 4CQMA 2H85A 2BRUC 5HK9A 2OGTA 5JCZA 4ME6A 3UVEA 1JE1A 5A0TA 4JI6B 3PDIA 1A50B 1CUWA 2CGEA 3JRXA 1I94B 3NHAA 2VZLA 1NN3A 5EKUA 2G71A 3O92A 2YUIA 1LA2A 5F51A 2LW7A 5FI0B 4G1MB 1DHTA 1JU9A 1XXHA 2HHAA 2JFUA 5DEOA 1QGYA 5KYKA 3OAAD 2OV3A 4UDXX 3VTFA 2UKDA 5E2AA 4G5FA 5DWQA 3WE7A 3IQZA 2X5JO 3A4IA 4MKFA 1WZEA 3DR5A 4NE9A 3L1HA 4ZT5A 2GXSA 2AR0A 1ZLXA 1SVNA 3F6BX 1H5QA 4HFNA 4RVHA 4B3GA 1T15A 2NTNA 4JJAA 2HC9A 4UTOA 4NR0A 4Q4LA 4BXOA 1D0SA 2XKKA 2JEOA 5D5QA 3Q87B 1KVUA 4ZQBA 1HDZA 1NT2A 2O8FB 1H0KA 1CY0A 2MIIA 3N0WA 1X7WB 2YASA 1ENOA 3NM6B 3ELUA 3PRYA 4O33A 4REQB 4RJLA 2J6IA 1CZKA 2RBGA 5JSUA 2E18A 3NHFA 1KP2A 1XHLA 4D7AA 1KBZA 4ROTA 1UK8A 4JX9A 3C3PA 4EHIA 1JLKA 1V16B 1ZWKA 2AEFA 3BWDD 4W82A 4CEJA 4LXHA 1YIDA 1FVXA 5DLYA 2WUFA 5J2TB 4G09A 4MWDA 2P69A 4LHWA 3KDAA 1L5RA 4OGKA 1UM9A 5KU7A 5L53A 2EP8A 3SSAA 1MH9A 2N1MA 3AF1A 3C8DA 3MCZA 3N28A 4L2IB 2WSMA 3CX7A 2EF0A 3QHQA 3RSLA 1VFPA 1E2JA 1CZNA 1X0VA 4YRTA 1CQJB 1BXNI 1X92A 1A8UA 2CCGA 2H11A 3I5UA 2MWMA 1ZSVA 4ZO6A 4B0PA 3WC4A 1MORA 1G4AE 1PV4A 3PPYA 3G2KA 4XX0B 3PNPA 3U4GA 4HYEA 3QA3E 1J5XA 1QHYA 2EWWA 4LMPA 4M21A 4WOBA 2GNAA 1LK7A 1U9ZA 4ZCSA 1AGPA 1RRPA 5GGXA 3EOBI 3LHIA 4NICA 3R0ZA 2BDUA 3M2PA 5DLDA 4URYR 1WD7A 5FWAA 3NC4A 1DQRA 1OYWA 3U4QB 1E89A 3SIPA 1UODA 5BR8B 3KTAA 2OZLA 4CBVA 4PVCA 3GJYA 4GI1A 4U6NA 1XDUA 4JEIA 4RWZA 1PTJC 3EJWA 3ZDBA 4FEEA 5CCDA 2EAUA 3UJ3X 3THYA 2QM0A 4YGXB 4LRXA 4JI1B 2WJPA 2WRZA 3N0RA 1PDOA 2QMZA 2DTXA 2FKAA 4BO9A 1F0NA 5CB4A 2WTNA 1DU4A 2QW0X 2BBSA 2WZBA 4KDEA 3RK1A 3D7KA 4D3DA 3Q72A 1MX9A 2VAPA 3QXGA 2YZMA 5HNKA 1FLVA 3BHJA 5H3HA 1CBUA 3G0OA 5AESA 2X8BA 3DE5X 5IJ0A 1PGOA 3K1AB 2AWOA 5AHXA 5K8TA 3G0BA 3KTOA 1X13A 1NV8A 3HBAA 3CVWA 3K73O 4KCGA 3R0IA 1DBPA 2Y67A 3VOAA 3FTEA 3WICA 4BKUA 1PZHA 4EFLA 5AI4A 1IIRA 1WDLA 4RADA 4WXHA 5EL0A 4NBSA 4Q3LA 1KETA 1NZJA 4LOHA 1QVAA 4CN9A 3IR5A 4RTPA 1G5PA 5EHGA 5TX7A 3UT6A 2YBVB 1LBHA 3NPAA 4B6RA 4DMGA 4NYJR 1A88A 5U4QA 5IT4A 4I99A 3OZ7A 4FIZA 2X9GA 3V7UA 2A5JA 1C41A 1GZSA 1PT6A 1LS1A 2CCKA 3DVRX 4I36A 2VK1A 1NUAA 3QWBA 3PHBE 3KYBA 5BVGA 2GASA 4GOLD 1WTCA 2GTHA 3Q41A 3K6JA 4GM4A 2VP2A 1YS4A 2YFHA 1P4SA 1GSOA 1ZD4A 3PEYA 2VJBA 3KKLA 1PUJA 4UCQA 4ZGBA 3IV7A 3HG7A 4BDSA 3GMIA 3UWMA 2QUKA 1JZSA 3OO0A 1AHPA 3TUZC 3K0FB 3IVCA 1A8PA 4BX0A 1A04A 2FPUA 1ECFA 3EQ9A 2FMIA 2XUQA 4EB8A 5EE5B 3GN2A 1IQ0A 4EKYA 2H59A 2QL6A 3ZHQA 5FH9A 4O08A 4L73A 5B64A 1IJBA 2B4KA 3ETNA 1TD1A 2ZE7A 1CERA 3KKMA 4GYYA 4LDJA 4WLUA 1RHUA 1YTUA 2O5EA 5IZCA 2XZLA 2BFEA 3OE5A 3FLMA 1I6MA 1SG9A 4RF3A 5DHUA 3K2IA 1KC1A 4AZTA 1MG5A 2GCIA 2QXYA 5EJ4A 2VNJA 1JVSA 4JS0A 4JY7A 4P4GA 4W5HA 2OYCA 1MDBA 4ZAVA 1FFBA 4D4JA 4O4IF 1WD5A 3TR0A 1JT9A 2ZBGA 3P9NA 1VLVA 1HT2E 2OTCA 4L78A 1Y9DA 1KAEA 1GQQA 1PJCA 4KXUA 4ARUA 4RIFA 1YTLA 1IC6A 2AKAB 2AJTA 3Q9NA 4RKRA 2Q0SA 2QSJA 2IYWA 4MVWA 2JKVA 3NNDA 4M9RA 3ZEIA 3QLEA 3TWOA 1UJNA 1P33A 1VMDA 1DIBA 1KJJA 4XIYA 2IY9A 3PC8A 2GEFA 3HU1A 4WK6A 2G1AA 2XKBA 2BGLA 2RK6A 5LXTB 4B6PA 2RB5A 2CKMA 4X3OA 2VBCA 3G9QA 5CPFA 4Q21A 3J80A 1TJ5A 3CZPA 3SX4A 4YRIA 4LMAA 2HXYA 1CUEA 3DMRA 1WVIA 4A2PA 3ZJYA 4Y2YA 1DEXA 1PHRA 5B2ZA 2YOFA 3TK1A 2FR0A 1FPMA 3ID6C 4G6ZA 4G3XA 4XLTA 2JBWA 4Y98A 2Y9MB 1HQKA 2WU4A 2Z09A 3FGPA 4Q24A 4XYBA 5A7GA 4AM8A 4D9HA 4F71A 1MC8A 3N07A 5EA2A 2EGHA 1O4WA 3RSZA 1LK5A 2H8KA 1TEZA 2LKDA 3EDCA 1GT91 1VPVA 4I9HA 2D5BA 3KXPA 4JYZA 1FTNA 2BONA 3DNMA 3PZBA 3SR3A 1F2VA 4DR6B 1DIGA 4JIMA 2VCYA 1P91A 2OZEA 3ZV4A 3A2NA 4YIHA 3FNGA 4FLFA 4AP9A 1M2GA 1HDXA 1K97A 2KYRA 3KX2A 3WLNA 3NKVA 4HS4A 4E32A 3MTEA 3ETHA 1BH6A 1ZM3A 2AD5A 3JAKA 4OQNA 2ZRIA 1K75A 2AYZA 1LWOA 1NZDA 2GBPA 3VR4A 4B7XA 2ZJBA 1NVAA 2AN9A 5BP7A 5EXDA 1NY6A 4DBLE 1RRKA 2QM7A 5LQSA 4MAMA 3ZJUA 1KERA 3CLVA 1IEWA 2HSDA 1X7DA 2BZ0A 5AJWA 2W4IA 1LBTA 3KALA 1M1UA 3UMFA 1RRVA 2G4VA 2RH5A 4KN6A 1KI1A 4RKQA 5HZMA 4B44A 3FWPA 1T3GA 1BD3A 1GKUB 2J67A 3VFDA 4LJRA 1HY3A 4IG4A 1XVIA 2WA2A 4WXYB 1CUVA 4DGSA 2VSYA 1QXSA 2ECQA 3U4IA 1JVNA 2OCDA 4JVMA 4CGZA 1H8HD 2DFLA 1Y9AA 1X74A 3PX2A 3TLYA 4BNWA 5IU6A 5I4CA 2YJ6A 2GXUA 3CPJB 5B58C 2ZB2A 4JJGA 5FP0A 1VHQA 1BO6A 1HXHA 2J0UB 3DDCA 3AMVA 4FGUA 4AFNA 3EWIA 1QGUA 3GJQA 2I9PA 2XB6A 2NU6B 1XRPA 3MGCA 1NR1A 5DVZA 1E1RD 3TD6A 3B20A 2XCIA 1J7KA 1NJ2A 1UZUA 4K9DA 4G23A 1JHPA 1NKVA 1BVYF 3QXXA 4FYIA 3VSBA 3E8MA 4JOQA 1EVIA 3EDMA 4L6CA 1GGHA 4R84A 4TX1A 5IAEA 4CM4A 5KX5F 5KTTA 1XD2B 1SCNE 3FJYA 4C5AA 4TTAA 3I1IA 4ND5A 3SZ3A 5AKKA 1T8RA 2F3QA 1QR6A 1W7AA 2VTDA 2NP7A 2AF3C 4A2WA 4B9AA 4QC2A 3VPXA 1K7CA 4HL6A 2Q3JA 3WYBA 3T3OA 2DR0A 1NIPA 2IW1A 4Q93A 3MD0A 4QVKA 5JFGA 1WXIA 3DBLA 3AUKA 3HSKA 4J1SA 3UHFA 4LJ4A 2GAIA 3CKKA 4YPVA 2YY7A 1YVDA 1BWSA 1FYEA 1QK5A 2GFQA 3EDQA 1J25A 3QITA 4ILEA 3O3CA 4EJSA 3A37A 3QJ5A 4MQ6A 3FYUB 4RTQA 3HVRA 3ES9A 4N47A 1N7GA 4ND6A 4BAUA 5EJ6A 2AL7A 3LVQE 1OC2A 1SVUA 4I3FA 4KE7A 1T43A 3WLRA 2NO6A 1ZM9A 2IE8A 3STYA 4AIIA 2AQHA 1I2ZA 3EC7A 2A88A 5EE3A 4JI5B 1RAFA 2VDWA 3PXXA 4X1IA 1WA5A 5DO9A 1Z62A 2JCBA 3GFQA 1QRRA 5LNK1 2YRWA 1LTHR 3J81k 3QKIA 2PQ2A 4KQ9A 1XMPA 4A0SA 2WZQA 1IM8A 4B09A 1GTSA 3LZ6A 3CF4G 1IBMB 4CTMA 3TF5A 4FJ1A 5CITA 4H7DA 4J3JA 1L4YA 1KJIA 3WZLA 1WVMA 4Z4EA 2IUYA 2ODPA 3HADA 3JZMA 4MI1A 4WLOA 2PZBA 2Y2VA 3GAMA 4TM7A 3T9FA 2QW1A 4Z4QA 4L4YA 2VT3A 2NOAA 3JVUA 2WWIA 1L4NA 3QYFA 3TX6A 2LE0A 2R7NA 4KXWA 2AYXA 3DD5A 3F98A 1ZKMA 3H13A 1GRCA 4YRNA 1ISMA 1CR1A 5ADHA 4DQKA 1ZI6A 3OC6A 4JIGA 5FLYA 2IUUA 4JODA 1E5LA 3LM8A 1WIWA 1QTIA 4WGFA 3NTOA 2PS3A 2VDNB 1EFPA 3QG1A 4LDAA 5FOSA 4AKIA 2OCBA 4A1OA 5JAQA 1WVGA 1BE0A 1CC1S 3JALB 1GY8A 1QP8A 3QWIA 4L85A 4R6XA 4CYMA 2VRCD 4KMSA 1BMFA 4FI3C 3ZZTA 2VP0A 3IX7A 1LPSA 4BGEA 1FY2A 3ZWYA 4A03A 1UOEA 2BCJQ 2PH3A 4X6LA 1FSPA 4F1JA 2AA3A 1E8DA 2UVPA 3HP1A 5EWMB 2C7QA 2CV2A 2O8FA 2VF7A 2X9VA 1X7WA 5IZCC 4REQA 3GA5A 3F6YA 2DG2A 2IZZA 3HFGA 4D3FA 4EJMA 4G0QA 2VDII 3FBTA 4HT3B 1CLUA 1PX2A 2PZGA 3LX6A 3OUUA 3LPCA 1D6NA 1V8FA 1DKOA 1V16A 1Z8NA 2H1CA 3B78A 3L0SA 4C14A 4CKYA 2QRGA 4ZK2A 4R5HA 4PIVA 3O1JC 2DH6A 2VHCA 3AY6A 2Y1CA 1B42A 1IDOA 3B2EA 3FIJA 3GRAA 3RIXA 1BVHA 1O8CA 1WY7A 4GO1A 4PW0A 4U02A 5LSAA 4L2IA 1X7XB 1XCMA 4PNZA 4CW7A 1B4DA 5IG2A 1U63A 2WU3A 3LD9A 3D3KA 4M0LA 4BQSA 1CQJA 1TUGA 3VJRA 4BCDA 1SY7A 3O8NA 2X7XA 2CBGA 3DEYX 4Y0NA 3P9XA 2VATA 4XX0A 3AONB 3PC8C 5E1BA 2BLLA 2OCAA 1H5NA 1ZZEA 2R97A 2XNDA 2I33A 3NBFA 3OIFA 4ND7A 5EGNA 5KJEA 3UA4A 3THRA 5MGNA 4LJAA 1U2ZA 2BMEA 2CDCA 5CLFA 3T0GA 5ED4A 4NZ9A 3PDUA 1DAOA 2WTAA 4G36A 3V5NA 1AC5A 3ER9A 3U4QA 3RWMB 1L7EA 4WTOA 4NK5A 1N5OX 3UEOA 5HR5A 1EWRA 2XCRB 1N8SA 5FQNA 2PZEA 2XNSA 1XSEA 4PLVA 3WLPA 3ICEA 3DM5A 4R3NA 1ATIA 1KEWA 3G5LA 3SDZA 3FWYA 1DPFA 3LF2A 1R3UA 1A4IA 4KVFA 3AI7A 1EUDB 1K5HA 2JAPA 1JUDA 4GM1A 1OSNA 5CM8B 5DLEA 4A7PA 3FVQA 3BWBA 2VJLA 2QQFA 1BJKA 3MUOA 1UJMA 2HRQA 4UUOA 4D44A 5CFQA 4B7AA 4E33A 3IDZA 4XDHA 2HZ7A 4DA4A 3MJVA 4HWPA 4N03A 4LX0A 3AERA 3E9EA 4DDUA 4YXFA 4MJLA 5FPYA 1T4BA 4JDUA 3HLKA 4LZNA 1IZ8A 3MWEA 1W29A 3HXTA 3NGLA 1T2AA 1O9BA 1ZD3A 2E3JA 1SBIA 5K4GA 4RH3A 1JA0A 2PZFA 1LZLA 2GCEA 3ZE2B 3PI6A 4UHEA 3PLRA 4OIFA 4WV3A 1EDBA 4B3MB 3GJ7A 3WJ2A 4V0OA 1WUTA 4H4CA 1J2RA 1SD5A 2CE2X 3ZK8A 1VLQA 2E4WA 4ARIA 3AP1A 2O7SA 4PLHA 1KEVA 4QFMA 2ECKA 2YS6A 3S1LA 1I51A 3K71B 4JB3A 3HCRA 3D5QA 4D0RA 1KS9A 1HK7A 2JEZA 4LF5B 3KFXA 3SJUA 4AKGA 3NJ4A 2JGAA 4B83A 1OWLA 4JI0B 5BUCA 3UWKA 4XYMA 1AM4D 1JA9A 4LJKA 3N2LA 4O4HF 3HKEB 1U2RA 1DFGA 5AI6A 4J0GA 3UC9A 3WGQA 1YB5A 2VH5R 4PG4A 1P1HA 3EVBA 2CD9A 4OTZA 3ILXA 4C29A 2O1WA 4ENRA 2AMFA 3C3XA 5TQ0B 4ZEMA 3FRJA 5I5EA 5AP9A 4WZ6A 1KZ6A 3PE3A 4HTAA 1OD6A 4HDMB 4PSVA 1AMOA 4KR6A 3KSDO 3ZVKA 1QCYA 2I6FA 4E2WA 5LD2C 1IBRA 4I1YA 5AUNB 4D99A 3EXEB 1GAJA 3AEXA 5FBQB 2A58A 4MV6A 5ALQA 3EQ6A 3LECA 2R00A 2JGFA 2ZFUA 3DV2A 2XECA 4MUXA 1N9ZA 1PQ4A 2FHZA 1XVTA 3FPKA 4TZTA 3ZWVA 3UAOA 4B6OA 5KS2A 1ZH6A 3GX1A 1BWPA 2EKDA 2EX1A 4FHCA 1YQUA 4UMEA 3BHIA 5G0TA 3ER6A 5DYYA 1EHIA 2G36A 1JHOA 2H65A 4H6WA 2DCMA 4HWOA 5D3MB 1VI2A 5KC8A 1F9EA 4XX1A 3L40A 4ZOBA 2IIQA 2ZSBA 3DHNA 2NV6A 4J94A 4B73A 4DSUA 3U3MA 4I8DA 4OJKA 1W4LA 4HWTA 4RM2A 1PK8A 4FX5A 1XMJA 1C9KA 3EOZA 4GMFA 4TGLA 1J97A 1M2VB 2I1QA 1R0SA 5COQA 2O2IA 4EJSC 1HZZC 2A0WA 5JXHA 2PJRA 1NRIA 1KOLA 5KYGA 3HHPA 4PHTA 4Q37A 2VOEA 3ZXXA 4FZ3A 4OHPA 1RXCA 3FVRA 5IN5A 2AFHE 1QFJA 4S05A 1K4MA 1NJGA 3VH2A 1LLUA 3DL2A 1E2IA 1Q0PA 4CF5A 5HGXA 5F5LA 4ZALA 3RBZA 3MJCA 2QTRA 3SF0A 1KK2A 4I5IA 1N36B 2P27A 4GBED 4WPGA 5K2OA 2QX8A 3M9XA 4LY6A 4LZJA 3Q3IA 3RQIA 1G18A 2B94A 3BZUA 1WG8A 3R4CA 2BVNA 5DHSA 3ZUPA 5BN1A 4OGLA 3TLBA 1Z0DA 2QRVB 1OFVA 4G67A 3VC1A 1UT8A 1UQTA 2QKYA 1NBMA 1I1OA 4WY2A 5KKCA 1E77A 1K3TA 3L0OA 3JPWA 4H1HA 4Q3CA 3RVBA 1NG9A 2DR2A 2J3IA 1N2SA 1UMDB 3M4YA 1I7NA 4OXIA 3LUDA 4WECA 3VSDA 3NTUA 2BTOA 2ZUCA 1GYQA 4OB8A 3UKDA 6Q21A 3TZLA 5IF9A 4PF1A 5CEEA 1UIMA 4EKEA 5ERYA 2XRFA 1C0PA 4NZYA 1GV1A 3FSRA 5B6PA 1IXRC 4X91A 4YAEA 1Q50A 4LYGA 3ZHYA 1FFSA 3GLKA 3OF5A 2PXXA 3QLTA 5EXPA 4BZXA 3PG5A 4ENSA 3AJRA 3R4VA 6REQA 1RLCS 1DKPA 3ENKA 3HH8A 3RHFA 1C3EA 3DLAA 3EZ7A 3L0YA 3LQ4A 3C3AA 3E8SA 4B7ZA 4YUXA 5HP4A 4WL0A 5C7OO 4ZHQA 2JHGA 3HGQA 5KTOA 1JHQA 4IW3B 4ZEVA 2WYHA 5DXAA 1SOVA 1N2IA 1Z36A 3PRHA 2VJAA 4BIIA 4AQ7A 2CXXA 3JZFA 1C9NA 3Q7SA 1GR1A 1KTIA 1MABB 5REQB 3X1JA 3GLFA 2JGDB 3ETJA 2CMFA 2FR1A 1LPMA 3QV1A 2AMJA 3KYDB 4JJ4A 4L3WA 4WNAB 2NU6A 3K70D 1JH9A 4PNEA 5F9MA 1PHPA 1W88A 2DUUA 2F8TA 3Q8LA 1GA6A 3X2FA 4F84A 4PZ9A 2YW2A 4CLOB 3GNLA 3OEWA 3H18A 3RC3A 1H5UA 4ZVPA 5KU1A 4N0EA 5B57C 5C3UA 1XD2A 4YRRA 2PIAA 1UP4A 4M6WA 1QB7A 3GEHA 4MR9B 4UZEA 1XRRA 5KYUB 1IR21 2H1LA 3L0BA 4J91A 4RE5A 4C76A 1LRJA 1DBVO 1WPRA 5CT9A 2AVDA 1WXHA 3E9YA 3PD1A 3CCFA 1TZBA 4QDOA 2F1RA 3K31A 3C5VA 3PNSA 4HEJA 1SKBA 4DLUA 2XIJA 3EYWA 5HSGA 1HT1E 5HQJA 4ZWNA 4Y2SA 5IM5A 4FDMA 3FYUA 1R9NA 1SCUB 4YAJA 3T5DA 4AY3A 1VM6A 3AQ4A 4GPAA 4YCSA 4AK9A 3BS4A 4FHEA 5TPZA 3VX4A 4EY3A 1QV9A 3ITDA 2GO1A 3W9YA 4D9EA 2JFHA 2R47A 3BWXA 5LMCA 2XE6A 2ZIXA 1S8NA 3AUUA 4DYDA 1EGHA 4KZPA 4E5DA 2BM8A 4WK4B 3S70A 4FT4A 2KHZA 4P3PA 3RU9A 4XGRA 5BW4A 4H7FA 4C0SA 3QEKA 3WHKA 4PAMA 5FR2A 1LX6A 1XFAA 1P5RA 5I4BA 4PXYA 4QVGA 3ITNA 2DPHA 2HA2A 4IFTA 4DIKA 1RDFA 2IPNA 4MRVA 1UFRA 1N6KA 3W1EA 2O7NA 3NIDB 1R7RA 4DXDA 1VG1A 3LX5A 4IQ0A 4PSUA 1ARZA 2BHSA 2OFPA 4U2DA 3TSCA 1E1MA 1RYHA 5FX2A 1WF3A 2C7GA 1D07A 2MYTA 2Z1NA 5AVSA 1J70A 4NNJA 4IV5A 4DEYA 1G5HA 3HPRA 1G8PA 3NRJA 4CTKA 5B1YA 5CFRA 2XGGA 5IT0A 4GL4A 1SU6A 3T94A 1UKZA 3OOSA 2A4MA 3TZBA 5AD1A 2IA5A 1DLIA 2WF7A 2Y0BA 5A5DA 1L5HB 3CLRC 3KKQA 4WLEA 1MX3A 1EX6A 1YMUA 2ZUVA 1N4AA 2IV7A 2BY4A 2NUBA 2ZSEA 1CV2A 3HGTA 3I9NA 1DAEA 2QP9X 3SIXA 2OFFA 3C70A 1B3RA 1PZXA 2HU8A 3DC7A 3DC2A 5FBRB 5TQ2B 3RS4A 3N8KA 4NYMQ 5JQGB 1C4OA 1X3LA 2H07A 4G5OA 4DG5A 5I3CA 2IDJA 1U98A 3S2EA 1Z8DA 2IYUA 2PL1A 2PV0A 2XVZA 1KEEB 4HCJA 3KEMA 4JKOA 2V7TA 4D3SA 4DY6A 2DJIA 2ZIZA 2PSEA 4P93A 4GL2A 3A3PA 1NAHA 3ESAA 4RZIA 3RJ9A 4WACA 4JOBA 2R00C 1TCAA 4BNJA 3DLPX 3VR2D 1BQEA 4Z0HO 2HK9A 3DQQA 2UU9B 2P9YA 4EAQA 4IM7A 1O89A 4XGQA 2DQ4A 1VG9B 2DBQA 3CLKA 3QZUA 4XOUA 1YE5A 4RAQA 3U9TA 4LWPA 1FDRA 3I9FA 4K6KA 4CNBA 1GTL1 1IBSA 4RD0A 4RA6B 4IQGA 3ZHXA 4RZHA 3MS2A 3BXXA 4GS5A 3KBOA 1UC8A 1U4SA 3B1JA 2ZRLA 4YAOA 2OXIA 3K96A 5IT9A 5KINB 1BYIA 1Z37A 3GP5A 2PYZA 3IQDB 1H8ED 4LTMA 3NHBA 4W9NC 1NKSA 1KYIA 3RAPR 3A1UA 2HI0A 4ICIA 1TNDA 3EIFA 4B4WA 1B93A 1CIPA 3LFHA 3G9UA 1Z88A 4FWBA 5DX8A 5ED0A 2GSDA 3VYSB 2C99A 3AJDA 4L6IA 5DWVA 5EWLB 1IQPA 2ZB3A 2F00A 2VI5A 4UMDA 3MLEA 4PBSA 1U2EA 5AO9A 4DV2B 1WZ2A 2F3PA 4TQAA 4OXKA 5FV4A 4NBUA 2JHAA 3V8BA 2QTZA 3IIMA 2XOXA 4FCVA 3RGWS 4CRWB 5EJGA 3UJ8A 4UNQA 4G8CA 5IJXA 2J0QA 1ZM7A 2P2YA 3KB6A 3QK7A 5ITZA 3WGKA 1Q0TA 4MUHA 1KJQA 1PEDA 4UNPA 4V2UA 3GD7A 1HA3A 5DYIA 4QQFA 4YRAA 4GLFA 5BR7A 2XGJA 2OCIA 3TLJA 3AUSA 4WKNA 1U7DA 1WL8A 3QVGB 4PRZA 3KQQA 5AXBA 5FKJA 4B6EA 3D5TA 4OP1A 2P4HX 4TZ0A 3RUBS 1VKZA 1JR3D 2GM5A 1ZSNA 2I6UA 4L3OA 4I4LA 3RB8A 5E7IA 1CQIA 1I7SB 3L6OO 1SPBS 5JV5A 3JQBA 1BS1A 1LF0A 4FR5A 1TC1A 3R7AA 3K0AA 2UZ3A 3IO3A 5AVXA 3VGPA 4GFDA 3C4VA 3OKFA 2HO5A 2QL9A 3SQOA 3I30X 2X1LA 4WT7A 2F6RA 1SA0B 1NBHA 4CKBA 1ZDMA 3DDOA 4V38A 5A5VA 4LI0A 6CHYA 3USZA 3GGCA 4JLNA 5F12A 3V32A 1TX4B 1JWLA 4TYYA 2QVLA 1QZXA 1T8SA 2PPVA 3LU1A 4JR2A 4C2BA 1CS4C 3HKEA 4O4JF 4PV7A 5IH3A 4XB6B 4XYLA 5AKYA 2C9DA 2DUNA 1JKXA 2OM2A 4HBGA 5KVQA 1KE2A 3SR0A 3I62A 1G4HA 2H7CA 3FPBA 3N3BC 4YLEA 1WMSA 3VC7A 2XXBA 2IYYA 4JLAA 3ZWKA 3UA3A 2JD0A 2ATIA 5IUNC 4EDHA 1FFYA 4DR5B 1BWQA 3CTMA 1M2HA 1CRZA 4Q39A 3V8VA 4F2GA 1HEUA 3UMVA 1BXZA 1E3JA 3LP6A 3LUAA 3KZ1E 4HAYA 4J4BA 4UCFA 1MTOA 1Z0IA 4KGDA 4C7XA 4ZOQI 3PQEA 1XMSA 1MC1A 4Q9NA 1MXHA 3DOHA 1C9EA 1CHDA 3ZY4A 2BF4A 4LXTA 1BDHA 5JXWA 2A0XA 1ZGHA 4M76B 4RSHA 2CV0A 2WD9A 1CW2B 2QVZX 1JYSA 1OPXA 1VHLA 2EATA 3CRQA 3KSZO 3HBFA 1PQUA 3O0DA 5D3MA 3RC9A 2HLDA 4HGYA 4BE7B 2VDLB 4YJGB 3RWBA 1U9JA 4L9AA 1ZPDA 3HXPA 1RJGA 3RUAA 3TKAA 3V8QA 4CTNA 3KUCA 1X9IA 3C5HA 4GEGA 1B00A 1VXOA 1A77A 1QH1B 2BI8A 1E7QA 1PZMA 3BFXA 3DB2A 4D80A 3ED1A 4EHNA 3PGMA 3U2QA 5AM3A 4DV1B 1FUIA 3DQPA 4PYIA 1HE4A 4YR9A 5JS1A 1D4OA 2FFJA 4K6HA 3FYUC 2NM0A 3JD1A 5IAGA 1RCXC 2H1SA 5KREA 2BLNA 3I76A 1C0IA 4PC2A 4OG2A 2PNFA 1U7TA 4MTCA 4YV0A 4MW9A 2QRZA 3PLAE 3AR3A 4DZTA 2AUMA 2CYAA 2Z9DA 3OM1A 4B1FA 4BWYA 2Y1DA 4R2XA 2HRBA 2FZKA 1JNXX 1OI4A 3W5IA 2Q2OA 4K7JA 1Q3TA 1UDRA 2ILVA 1JXOA 2R1UA 2NVOA 3P5BA 4HN9A 2HF7A 2O1SA 3HO1A 3UV6A 2ZUUA 2H31A 3HJHA 3I32A 4FONA 3T1QA 2B3DA 1QQ7A 4DJ5X 3TMAA 3NWEA 5FLXA 5CVDA 2QRVA 1UXOA 5PNTA 4P0PB 2HDWA 2K2WA 4QARA 3KPUA 3KOXA 1HNWB 4TTTS 5JG7A 4K9PA 1E1CB 4AMZA 3UJDA 1IK4A 4HHEA 4OJQA 4X7BA 2NZ8A 3OPXA 4XD7D 2R65A 3HJBA 1L5KA 4DF3A 1XD9A 2ZDHA 3HFRA 4DT1B 4JV5B 4EA8A 2GCPA 2B0JA 1E2BA 2A9KA 4P3OA 3E3NA 1A1VA 2DWCA 3VVMA 3R7BA 3HP4A 4FSHA 4Y1EA 2Y6VA 4Z3KA 2HRZA 2XXAB 4YAFA 3ORQA 4A36A 1E2GA 4M49A 3PWKA 1P61B 4QJBA 2G72A 4LE0A 2NP6A 4QOFA 3WAJA 2O5VA 1QZZA 1TM7E 3B3FA 5HCUA 3V2HA 1H23A 5JPDA 4AKTA 4WA7A 7ABPA 2PSHA 5H02A 4CHTA 2BGTA 2GEBA 4JP3A 1V5EA 2G07A 3DO6A 2FVYA 16PKA 1FFXB 2FFQA 4GU5A 4IIYA 3P9SA 2R7MA 1BN7A 3JTMA 1DS6A 1QO9A 4QXOA 2V6IA 4W1RA 3LDHA 1I2DA 4OATA 5HFAA 2G3YA 4C4XA 3ZVNA 2GHRA 1EFVA 1MABA 5REQA 3MXOA 4JP5A 2YJZA 2ECOA 4OREX 2C4MA 3A1VA 1MO6A 1RYFA 1BFDA 4QUBA 3FNIA 1OFGA 3KYDA 3M4NA 5CCEA 5KJ6A 2BM1A 2GTPA 3M1YA 3C6MA 3TLGB 4FMBB 4B76A 5IM4A 1Z6GA 2ZPAA 4WVFA 2YXDA 3W7BA 4KQJA 3ZQUA 1KAOA 1N1GA 4CLOA 4L5JA 3DLCA 1HPLA 4G5HA 5KNDD 3RC2A 3P9RA 4QIHA 1D5CA 4WDQA 4KBFA 4MR9A 1QWSA 3W7VA 3NHRA 4AULA 1Y7IA 3PC3A 1JHYA 1T1JA 2PX5A 3HMQA 5KYUA 5JXIA 1Y5LA 2GJ4A 4QWWA 5BWOA 4HH3C 1ZK4A 3HR8A 3Q2KA 2NZXA 5DGCA 3IL2A 3PZRA 2I3BA 3NV7A 4CKEB 2AX3A 4BP9A 1Y1SA 2UYQA 4I2VA 3TAHA 5DM70 2QMYA 4OK5A 4RYLA 1RLUA 3MF4A 3TIXB 3B1FA 3U17A 4DEXA 4DJJA 1JR2A 1KNQA 3KUKA 5KNCD 1NSTA 3FFAA 3QKSA 2NT3A 5EJ5A 1ZOOA 3O4HA 1Q0RA 3RLIA 1SCUA 1NI5A 2IVZA 3FTFA 3SM3A 3FHLA 1ESDA 2PV7A 3PC6A 3BSWA 4HEA1 5DK6A 4D3XA 4OOFA 1N2GA 1B1CA 3HZZA 3OFJA 3ITKA 2N75A 3IA7A 3BH7A 4PS0A 1WM1A 2OHJA 4K5QA 3T8YA 2C54A 2PVSA 4Z7OB 4I55B 1N5KA 3W9BA 4P2BA 4F12A 4JXXA 1W581 1F9AA 5ES4B 1O4VA 2OBLA 2RI6A 2CXQA 4MS1A 4EG5A 4EABA 1I33A 3VVLA 3TINA 3OZCA 2IXDA 1CRWG 1E5QA 2NSHA 3BMCB 3H9BA 4Z9FA 8ADHA 5K3FB 1T24A 1PZNA 5LQRA 1VL5A 4UHHA 3IS3A 5KC9A 2GQ0A 2B30A 1XWIA 2J7KA 4PGHA 4CL8A 2VQFB 2QW8A 1BQ3A 5JO9A 3CVJA 2R6GA 5EOVA 5HDBB 3WX0A 4TKMA 3JQBC 2HWKA 4PPGA 3CH4B 3FTNA 4X71A 2C2GA 2R84A 4ZT3A 5DM2A 1O77A 1QPBA 2GKSA 4U0KA 1KARA 4N5IX 1YJAA 5K9ZA 3N74A 1L5HA 3FZYA 4FFNA 1K8ZB 3C24A 3OWXA 4Q48A 1NM5C 2JJ8A 1QJCA 2Y8EA 3OHMA 3FR8A 1NIJA 5J2UB 3CH5A 3VVCA 3OBBA 1YS6A 2FWNA 3G7UA 4YEDA 3P0FA 4HVAA 1KFEB 1E7WA 3L6RA 2PGOA 3SEQA 5B1EA 3IQXA 4QD3A 4I50B 1LDYA 4HC4A 4B4OA 3DBVO 2JZCA 1QG2A 1M2KA 1CVIA 3SMQA 1KYVA 4BFTA 3A1EA 1DARA 2WIAA 1J21A 4ZTBA 4F60A 3H5LA 1DJPA 3G7SA 1RCTE 3OMXA 2PUFA 1QFZA 5KQMA 4Q00A 4QPPA 4WKGA 5AI9A 4XPIB 3VPGA 1ZD2P 5DV9A 2IGBA 3AFNA 4DQUA 1EEHA 1MVOA 2H4YA 3CRRA 4LRSB 2P2LA 3IESA 1GGKA 2XQJA 3SGLA 4MEAA 3D81A 3DNPA 3BDIA 2FPMA 1QO7A 2VHZA 2ZYVX 3D43A 3G13A 3NDIA 4XQ0A 3AL0C 4Q66C 1MVNA 2R6ZA 4YCMA 2OXRA 3BIXA 4HDCA 3GVXA 3A9TA 4B3SB 1PBTA 1Q0UA 1T2VA 2D59A 3GEIA 4P3YA 4OXRA 3IGFA 5GZ3A 2D5IA 2EZ9A 3SY8A 4RA6A 4YS6A 1XFDA 2CUKA 3OZEA 1IZ9A 1O0SA 5LYYA 9GPBA 5CJJA 1Z22A 3KR0A 1E7MA 4DBVO 1JKIA 4U3JB 5H68A 2ID9A 4PR0A 1SM4A 3CKMA 2EZ8A 1PL7A 4NDAA 5BR4A 2OPHA 2OA0A 1KRHA 3FTCA 1O2DA 4LQLA 4MMXB 1AQIA 2FWPA 3FCOA 2GZDA 2EYQA 3K92A 4JQYA 1R88A 2VPXA 4ZAXA 2DKNA 1N4DA 3LSYA 4PTZA 5C2JB 4RVOA 3ZHUA 2OO3A 3KXIA 4C05A 1JEYA 2JLUA 3IQIX 5ALPA 1WZNA 1XU9A 4AKEA 2HGSA 1TXGA 3ZC3A 1E66A 4XE5A 3HL4A 3GPIA 5K3EA 4I19A 5FI1B 2HBZA 1TYEB 3IOEA 4DABA 1V6SA 3EW9A 2FZVA 2PFGA 1H4VB 4R2KA 1JJFA 2RHDA 3VR5H 5K8CA 2Z08A 2DT8A 4GMGA 4BPBA 2VHYA 1WU8A 5K4AA 3RUFA 1NG1A 4C7VA 4OPMA 5DFAA 3IJ5A 1NAIA 5MGBA 4BQFA 4EG3A 3B36A 2NZ2A 2AXNA 2D0IA 3IR6A 1EFRD 2MU1A 3SZGA 3P9KA 2TMYA 3QVGA 4KQCA 4ASUA 3HWWA 2VDMB 3ZJ4A 2WQ6A 2G1JA 3L9WA 5LYJB 4Q1FA 2H9AA 3H17A 1KH2A 2CXSA 4HAIA 1QYVA 3NDRA 1ILWA 4JUDX 1P4RA 3R5KA 5L3VA 1OBOA 2OLJA 4XASA 4TXHA 2E4VA 2HZBA 1SHTX 3AL3A 5IVKA 2YVAA 1SAYA 2P78A 4HVLA 3OZIA 3LKBA 3C5WP 4G81A 2X0EA 1YH3A 3ZHSA 5C7IO 1E6KA 5FXMA 3ZE8A 3C98A 1FTSA 1GGNA 4WXPA 3FSJX 5D5HA 2C0CA 3C7AA 2ZZNA 1Q2UA 1V4BA 2I54A 3B70A 4HMOA 4LS3A 2FMXA 2G25A 4N3GA 3WOVA 2R1VA 3JR7A 3WIOA 3TOZA 4KRGA 2G7ZA 3R0XA 2BFFB 5L6LB 4RUKA 1LD3A 2DT5A 2XF8A 4F38A 1XZLA 3PX7A 1KGSA 1XTPA 4ROSA 2A4KA 1FF9A 3IT1A 2P9JA 1N3IA 2XR1A 2ZYGA 3DVSX 3GARA 4OHFA 4U6QA 2V4UA 1G66A 3I8XA 4QXAA 4IUBS 5ECGC 4HAXA 4LRQA 2H4XA 1TVCA 2WE8A 2DBVO 3TRFA 1WB9A 4QTUB 3WJAA 2YXBA 1DXOA 1Z0SA 3I42A 3B2QA 1PR5A 3NB0A 2FSIA 4F0HB 2GDJA 2NQ8A 3LVRE 4K2HA 4OKSA 3RU2A 1F8GA 1V6CA 2VAVA 3Q6MA 1U0HC 4AMUA 3K6SB 1UT6A 2AJLI 3UK2A 2Q3MA 3GUHA 5TEVA 3HKCB 2I66A 1KZYC 2V7EA 1YACA 3GLVA 1BMDA 5K1ZA 2JDIA 1QNLA 3L1UA 1KZ4A 3F8TA 4DV6B 2VTVA 4E2FA 1BHQ1 3ZGLA 1LPNA 5E9QA 2EFYA 5JBNA 5LB4A 1X7GA 1E64A 4PGGA 4V3CA 4FWIB 1QH1A 3AEQB 2HJ9A 2PS9A 4RPIA 5KYYA 1LRKA 1DB3A 1RLJA 2QZ9A 1JU4A 1DUIA 4QO7A 4D9JA 2FJPA 4GX0A 3OCXA 1ODCA 5BPFA 2OAP1 4Q03A 1GA1A 1YR3A 3TB4A 2QEQA 2ZVQX 1D6MA 2E6UX 1WPGA 4XJVA 2ZRNA 1ULZA 4JENA 1DO2A 2FRDA 4ID3A 4LY9A 1C9DB 2HEGA 2JAQA 4PC6A 2ONYA 3E3MA 2CUTA 2I8LA 4TUYB 5HQ3B 5KMGA 4QHSA 1BE8A 3A6FA 1JAXA 1CEQA 2HLHA 2E5LB 4DA8A 4RD4A 5FUWA 5L8VA 2KWIA 4LXGA 1OXKB 1PYDA 3MQ4A 5HMLA 3UNXA 1N5IA 1XAIA 3K8YA 1KFCB 1ADGA 2ZRBA 3K3PA 3OZSA 4X3PA 2IX3A 2IHNA 1Y6RA 1EX7A 1YFZA 4HDNA 1TZJA 1UOQA 3LYHA 1ZXXA 1CDOA 2CMDA 1WHTB 4I8XA 4OAPA 3OIYA 3ENVA 4DLPA 1GPMA 3TLXA 4LJSA 5C8YF 1NI4B 4RK7A 4C21A 1VJ5A 1E1CA 2WOOA 4FW9A 4H3KB 4RS4A 2QRJA 1G55A 3ACDA 4O2BF 3I23A 4PQGA 5IBRA 2W00A 2WWRA 1U5AA 4PZEA 3OIGA 2AHRA 3E7WA 3SBDA 2ZI7A 1FOEB 5D8DA 4BPRA 2JRLA 1T13A 2JH8A 4YYEA 5LP6F 1U3VA 1U0EA 4ZI2A 5JCJA 3IP9A 4J1NA 4U7FA 5K01A 1O9GA 3D02A 1UPPI 1X15A 1NONA 2P0YA 3CY6A 1GRVA 1XEXA 4WNCA 2PSDA 4QTXA 3ZOZA 1L3IA 1EFAA 1BFUA 2E21A 2EX4A 2R87A 3HKDB 3FFBA 4MW4A 2RC5A 4IWXA 4BMVA 4ARZA 5LLTA 2Q21A 2FQXA 2VJNA 1U0JA 5IKOA 3E7FA 4JXJA 4C3ZA 2BFDB 3IIIA 4LG1A 1NOJA 4XCVA 3EEBA 1FFXA 3FYTA 1RJFA 1E1QA 1AZTA 1GILA 3AVPA 3BERA 3U6KA 1IN1A 2YJ4A 4E70A 4G0WA 2O0MA 1O87A 3KQKA 1H2ZA 2QYTA 3ZXWB 3PC2A 4MS3A 5ALSA 2PD6A 5EC8A 4ERXA 4MQ4A 4U7PB 1KIMA 5CUQA 3ASVA 3LQYA 2XLBA 4OAQA 5JNRA 1B6TA 4C43A 1A8SA 1NXOA 4O5AA 3LQFA 1ORHA 1AN9A 1PL6A 2DWQA 3IEIA 3O75A 2QRNA 3TZHA 4XVCA 1DDIA 4EB6B 2HCRA 2DHQA 2XGMA 1PD1A 3VBEA 4XXHA 1OBHA 1RLDS 1WNTA 3AESB 4KO1S 3ASYA 1O0CA 2D5CA 1ABBA 3WDKA 4KL8S 3ZD7A 5K8UA 1YBAA 1BNCA 1NTRA 3IALA 1K63A 3HV2A 3OI7A 4TWBA 3FTDA 2W2NA 4LZAA 5DCLA 1SOUA 3MRVA 1JX6A 2RGYA 2P4EA 3SYMA 3IAFA 4HJRA 4OFXA 4D46A 1QLJA 4NCIA 1QGOA 4L9WA 5IJZA 1W4RA 2A35A 1WUHS 2HT1A 1F2UB 1ZIXA 3HDVA 4HNUA 3M33A 1IB0A 3F78A 3RV4A 5HEKA 4L0MA 4M0PA 2IWHA 4MA0A 3ZWWA 3NAQA 2QPOA 3VOSA 3BJZA 1K8QA 3L84A 3FNQA 2H2IA 1QV6A 1K08A 1N1MA 2CLIB 2HX1A 4WK0B 3AVTA 1D1PA 1DX4A 5KX5A 5DW3A 3RUEA 3QYAA 4ZO4A 4L9RA 4HMQA 4RPJA 1UBTS 4I55A 5CT6A 3OEEA 4AVYA 4DC1A 2PRIA 2VAXA 1KO8A 5IK2D 1OOEA 4R1MA 2GXQA 5THQA 2YYSA 1AGXA 2GPTA 2JW5A 1K68A 3BMCA 5ALJA 5IDVA 3HXQA 3K0KA 2RGGA 4JYBA 3TTUA 3EPHA 2O5CA 3LY5A 2ZJFA 4DJDC 3HJRA 4ENVA 3ORFA 1MAVA 1NYQA 4AW9A 1H0RA 3GN1A 4KQ1A 4RNDB 5DU2A 1SQFA 4E88A 4AP6A 3C3BA 5C52B 1J8MF 3E5NA 1Y3FE 1FRNA 3FYHA 3HN7A 4ISBA 3SD7A 1JFFB 1YJXA 2JNWA 1H93A 1ZL0A 3QU9A 4XPZA 3D2LA 5DGTA 1SBQA 2QTWB 2OM6A 5CVEA 2IYVA 1EE1A 1KSHA 4G0XA 2R1TA 3GGOA 2HHLA 3NDPA 1XROA 3I92A 2MSEB 2B5OA 3RJMA 4RD6A 3BWMA 4N5NA 5GGYA 5CGQB 2C9YA 4MVJH 4MVYA 3G89A 3OZWA 4XEHA 1HURA 3F5FA 4GQAA 3W2TA 4AC9A 5IPFA 1QH9A 2EJUA 5DYTA 2QGZA 2WF9A 1YFLA 4LHSA 2AYYA 4OQDA 1XZQA 1Q12A 2JBAA 2RGXA 3CBGA 1G8SA 3W4JA 1CFZA 4UAUA 4UM9D 3IUQA 2HA7A 3B2NA 4N8EA 3X1ZA 2FNAA 7MHTA 3DKKA 4FIDA 3EIOA 4XPIA 2XVXA 2YUTA 2NXWA 4S1OA 4PPQA 1CY2A 4M7RA 3WFZA 3J7TA 1YSCA 5KSOA 5EZYA 3WNBA 3H7IA 2DETA 3PR2B 2WOJA 2BEKA 2EBHX 2D2FA 13PKA 2X2FA 4FD3A 4CFZA 1C8KA 1IAVA 1XK6A 2Z1DA 4XWAA 4YAKA 1ZBQA 3D6JA 3NRCA 5F2KA 1U0GA 4YXWD 5JZSA 1DTEA 2DBZA 3CLTC 1K8YB 1OI7A 3RI3A 1K7FB 2E5FA 4PLZA 1FRZA 3RTBA 2OZPA 1GGVA 2QD5A 1UKVY 4OXNA 2WZDA 5T6MA 1KMMA 1L5SA 2QVBA 1JYEA 5T4EA 1QK3A 2WDZA 3I6IA 3MNFA 2ZTSA 3AKYA 3BFKA 4O6VA 4GUAA 3GCDA 4BX8A 5HUJA 3C85A 5AKGA 1RWOA 1EBBA 4Y7DA 1DCMA 3KLPX 1H1LB 5MN4A 1ETUA 2GARA 2FRDC 1G98A 1EK0A 1OI2A 1SB8A 3DZGA 1HDEA 5B3KA 4DFDA 1GGFA 6LDHA 5IASA 3Q8KA 1RKUA 4A73A 1HDCA 1BC5A 1P0QA 1WCV1 3MPUA 3ABQB 4TSRA 1D2GA 1P0PA 3DZDA 3GFRA 4FW8A 2CZGA 2MSCB 3BX1A 4Y2HA 3NVAA 2EKBA 2QN1A 1CNMA 3F3KA 3CCBA 4DM3A 2QNIA 3ADDA 1IPEA 1PVDA 3NHWA 4J16A 1A9TA 3ICVA 4ONEA 4OQFA 5CM2Z 1RC8A 2I4LA 4RVFA 1U7WA 1AO3A 1INLA 2C1EA 2WHPB 4FDAA 4KE6A 4P86A 5DI9A 2X0FA 1JB1A 2V0NA 3IT2A 3X1KA 1N5LA 3E0QA 4CN8A 3SZOA 3ZYCA 3B1WA 1PJBA 3LQ2A 3Q85A 2UUAB 3IOCA 1N5DA 3Q3EA 1USUA 5KKAA 2X2EA 1V3QE 2XX3A 1VDMA 3JWGA 5BV1A 4EI2A 4IGEA 1OB5A 4HX9A 3AGQA 4MPTA 5LYJA 2J4CA 1J8QA 1RWPA 2QN2A 3LC2O 3L82B 1M0SA 1TI7A 2ZIWB 4GMDA 3E1SA 2W6ZA 1JDNA 3OC0A 3PGVA 2VK8A 4L8LA 1C30B 3RRMA 3SHVA 2BOVA 2V68I 1SCKA 1A9RA 2PWAA 3G1TA 2ZRDA 3LCVB 4LGYA 1XRLA 2A5DA 3BB4A 4LDQA 3WB0A 2BR4A 5TGDA 2WE7A 1AUVA 1KO7A 1M6YA 2XE8A 2XZPA 1L5NA 3UUGA 1QYCA 4K87A 2IS4A 1QZUA 1SCBA 1LLCA 4FCTA 1E9AA 2GBFA 3DW3X 3L1VA 4GVXA 4PGMA 5DTJA 4KQGA 2ZTLA 4K86A 3C1TA 4XSVA 5BNIA 1O6ZA 2XNJA 4DCPA 4LJ8A 5AXAA 3W5CA 3JD2A 2Y2UA 5F1PA 1FNBA 3K5IA 1SO8A 4NNOA 1L5MA 4RJ2A 2IXGA 4L08A 1PQWA 3ONFA 2C2XA 2AN3A 1GG9A 2ZROA 2ADFA 3O4GA 4OI2A 1NUPA 2HCBA 2V55B 1KVTA 1ZC3A 4H59A 5EMHA 3H2YA 4Y2XA 4DSAA 5JJKA 4A8JB 1IVSA 1N3YA 1G5TA 3G0HA 3I5AA 4UNSA 2IEBA 3S27A 4B3HA 2NO7A 2PZKA 3AF5A 4Z2AA 2G63A 5ULLA 2IIPA 2GBCA 3A9WA 3M2TA 4HZIA 2R5WA 5L3ZA 4BX2A 1KZ7B 3K6SA 2QJRA 2YJ3A 2MR6A 2X77A 1AV7A 1U8CB 2BEVA 2NO9A 3HKCA 3M34A 4GECA 4L22A 5JS8A 1G5FA 4Z1MA 4I08A 5K0NA 2BKVA 2NNWB 1IOLA 1G4UR 1Q0QA 2OT3B 3HDQA 4TLLB 4YJDA 5MF6A 2RSLA 4KC0A 3LHSA 1OFIA 1Z5UA 3PR1A 4ER0A 1Y63A 1NXWA 1SKUA 2Z5LA 1B8PA 1ZVVA 2A78A 3IJRA 1YAHA 1JLMA 1JPNA 3QEMB 2K5UA 4UUPA 1K89A 3W0LB 2JJ1D 4PAWA 4Y2UA 5KVCA 2NV0A 3MWGA 5J4YA 1E3WB 3C3EA 1XTQA 4FOPA 4QU0A 2IOFA 5IC6A 1KQPA 2A1TR 3MMZA 3SBOA 2L18A 4BGUA 4TUYA 5HQ3A 2GBIA 1K66A 4CMIA 3NHLA 1AIPA 3AKCA 1QGED 3KOUA 1ECBA 4U2CA 1IEQA 3KZCA 1TJYA 2RHJA 4UBIA 3H3JA 1WDWB 5B4UA 1QHEA 1OCEA 2P9GA 2QG6A 3KQWA 4HQRA 3CPSA 4I3GA 5ICCA 1AXGA 3OY2A 2DWPA 4BASA 3JWJA 5CX1B 2OHGA 1WCIA 2ISQA 2Q8NA 1VGVA 2QPAA 1MMFB 1OREA 4PNHA 2VRNA 1BXKA 5FB3A 5I7UA 2ERCA 1NI4A 2OUIA 3NWJA 4OLFA 1HFJA 1UXJA 4PNPA 2QWXA 3MWLA 4KO2S 4XSHA 1NUTA 4QJ3A 4YUAA 5KYWA 4ATNA 3FY4A 3BFJA 4XWWA 1QRUA 3AV0B 3HFJA 4X54A 3KB1A 4JB2A 1YE3A 4II3A 1CHNA 2FF7A 1YIOA 2HCTA 4PHHA 4JMPA 1V45E 3BD8A 2YXPX 1US8B 3HCDA 4K9SA 2JRCA 3M6VA 2V0GA 1OFUX 3IAXA 3QW2A 4NYJQ 4ZZIA 4X64B 5GONF 4C0QC 5DNEA 4PN3A 4YQFA 1XZEA 2EFHB 2O5RA 2OGWA 3OD5A 5HFNA 4HB2A 3JQ7A 2VWPA 3GJ4A 3HCNA 5AWFC 1JR4A 3CSUA 2QLNA 2K7FA 1XNJA 1XG5A 3UJPA 3L0IB 3DE6X 4BKPA 2OR3A 4W1SA 2Q6OA 4AY4A 4XRGA 5F73A 1NMXA 2I4RA 3OAAA 4NFHA 2G08A 4HR7A 2GS9A 2X0DA 5MFZA 1VJ0A 4LY3A 2YIMA 3N87A 2E9SA 1DRJA 1SC3A 1UL1X 4JVSB 1TGVA 3KPVA 4LJ5A 4UMVA 10MHA 3S1AB 2XKJE 5FL7A 1MEOA 3AVOA 1W96A 3L49A 4RULA 4UOZA 1VJTA 2WM3A 3COZA 5HDQA 4BATA 1SBTA 2MSNA 2X76A 4C0KA