2HW8A

Structure of ribosomal protein l1-mrna complex at 2.1 resolution.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
228
structure length
228
Chain Sequence
b'PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKMGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 36-MER
publication title Structure of the ribosomal protein L1-mRNA complex at 2.1 A resolution: common features of crystal packing of L1-RNA complexes.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein/rna
total genus 62
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 2hw8A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hw8A02
1I2AA 3FPNA 4DFCB 3ZQJA 1U63A 1AD2A 3U4MA 3UMYA 4LQ4A 1ZHOA 4QG3A 3U56A 4REOA 4QVIA 1MZPA 1CJSA 5DM60 4F9TA 5DM70 3QOYA 2HW8A 3TG8A 1DWUA 4QGBA
chains in the Genus database with same CATH superfamily
1Z0ZA 1WMDA 1BD4A 1V5WA 3FPSA 4C89A 3AF2A 3FB1A 4CMIA 1KAMA 4R3WA 1D7AA 2HHLA 2I0FA 3O83A 4JR2A 2ZREA 4ICIA 1I3MA 3F71A 1ULBA 2O4UX 4KAAA 4PZ0A 4WW0A 2O3RA 4NDNE 1S2IA 4PINA 3T8YA 4H9GA 3A11A 4QJ5A 3NNSA 2VAXA 4KXYA 2FZVA 2PXCA 4XM2A 5K0GA 2XEDA 1XMSA 1YH3A 4YPOA 5CFNA 5KYXB 2WWYA 2Q3MA 2OFXA 2ISQA 3PXGA 2RG7A 3IDFA 3DVSX 1GRRA 3DDWA 3IDAA 3KLMX 3TPZA 3WDLA 3UMMA 2HJWA 2VF5X 2X9VA 1PGNA 4I9UA 1A9OA 2XJ9A 5LA6F 3VR2A 4AO7A 1RRGA 1PW7A 3JZAA 1G8MA 2ZXEA 2WYVA 5UKDA 2D4HA 1ZM3A 4QQKA 1Q74A 2C5AA 3PPYA 3VDNB 3FPNA 4JQYA 3DS8A 4PHHA 4UCWA 4FJ2A 2VH1A 5FL3A 2VDOB 2OPHA 4D79A 2BC9A 4D96A 1QNFA 2WOOA 5DRYA 1E2PA 2KB0A 5F73A 4Q4DA 1KYTA 4L6IA 3FOCA 4FLFA 1N7JA 1GPMA 1KRHA 1N6LA 3L6BA 6Q21A 5KZMB 4JLOA 4Z9FA 3UAYA 3ML1A 5FPQA 4YDQA 4Z3KA 5IK2D 5HEKA 4D3YA 3ZGNA 3BMCA 4AX4A 2OOKA 2AFHB 4WLOA 4C08A 1QVVA 1XEXB 2BJHA 2JATA 2OCLA 1WVIA 2Q4RA 5DULA 3ZGLA 2BFAA 4KRGA 4HYYA 1U11A 1X86B 5LZ8A 1FYXA 1MC5A 1Y4DE 2AH5A 2VBFA 4KYVA 3ORQA 2AF3C 4KXUA 3RUDA 5HZMA 1S1CA 2B5VA 1DBPA 3I2YX 2P6MA 3LU1A 1J2RA 4FYYA 4R05A 4UVHA 4C4PA 1RWNA 3K3PA 2DUJA 3TLGA 2GPAA 4L9WA 1Z62A 3NYWA 4GP6A 1YFLA 1KFEB 1IUKA 3JRXA 4UHFA 3RWMB 2F9FA 3U4MA 3IVMA 1V9LA 1QVZA 1YRQA 2FEAA 2RKOA 3FPKA 2UZ4A 1OBOA 5CW1A 2AXPA 3SX0A 5E6SA 3K1ZA 1KDTA 4O0MA 5CP8A 1SUDA 3ADCA 2PUCA 3IIJA 5FKJA 1E3MA 3W6PA 1O9GA 1ZM4A 3TECE 4G67A 2WQ6A 1SXIA 4Y6OA 4COKA 1XZIA 5AXBA 1J5PA 1X7XB 4C05A 4B3IA 1Z5ZA 1B74A 1ES9A 3TZQA 1G20A 1WHTA 4WZBA 1IHPA 1LJ8A 3SDZA 1SCNE 3Q6MA 2XA2A 2EBFX 4G5QA 5P21A 2AW5A 3ANMA 3OTGA 3GQVA 4YT8A 4C1BA 1AKUA 1REQB 5ALIA 1ULTA 4Y0AA 4BVKA 5JANA 3JQAD 1YVDA 3HNOA 4PC3A 4MITA 4OHYA 2JL1A 3MS4A 4I8IA 4TTSA 4DUGA 3HACA 3OOHA 1K7SN 2F55A 3R5XA 4HNVA 5BVGA 4J0DA 1PJ2A 1PN3A 2GWRA 2WU1A 1JHVA 4V0KA 1VMIA 3ILHA 4HUTA 3PHCA 1Y6JA 2IUFA 4OHFA 2QU7A 4RFVA 3MWYW 4REOA 5AJYA 5FPPA 3ZQ4A 5IBCA 2VQEB 2NV6A 3LLSA 2M9MA 3R4VA 2R1VB 2JEZA 4YREA 3TRFA 1V2GA 3KEMA 3BGVA 1QKKA 1CV2A 2P6OA 3LZ6A 4J1TA 1ZESA 3E23A 1W0KD 3Q41A 4B6PA 3RUEA 5I9LA 2YVUA 2QYTA 2CGEA 2JS7A 1IR1S 3HV2A 3E4DA 4ZVNA 3T9DA 3UQZA 3DXFA 4AZWA 4BZWA 1CIJA 2REQA 4ECEA 3EHEA 1I6LA 4IBOA 4RKEA 1FQJA 2JIBA 1CWUA 3GDHA 2W0SA 3I73A 1AO0A 5IC6A 2D7DA 4QNNA 1N0WA 1LLCA 3R5SA 1F12A 2WILA 3WLNA 2CXOA 5FNVA 4MPPA 1NWHA 5EWJB 2ZR7A 3DOIA 4HG2A 1ZGJA 1IUOA 4TTVA 3V6LA 1UWAC 4FSXA 1AURA 3SKVA 3VR3D 1NVBA 4D6PA 2HRQA 1RI2A 3A7DA 4D6YA 1RP7A 2G9QA 3ANYB 1Q20A 3WG9A 2FQYA 2CJXA 4DADA 4F6LA 3DMGA 4WXHA 3AMVA 2A67A 4CODB 1U2DC 1LCIA 2LCFA 1NW7A 3EGOA 1E32A 1JQBA 2QQEA 4QOGA 1NYTA 4I9FA 4RJ2A 3EMDA 1C9NA 1MJNA 5INTA 5KPDA 3SQXA 2G4VA 1SD1A 1YVEI 1E5XA 1MOQA 1XZGA 5FBWB 2AZDA 5IABA 5ALPA 5J3JA 1EDOA 4GGOA 4IG4A 4IWXA 5B1DA 1HNXB 2ZQZA 3SVTA 3H2JA 4LBYA 1WABA 4YRRA 1T1EA 1ZC4A 3CC8A 5FYQA 4BNFA 4KO4S 5KVQA 1XU4A 2O06A 5FQNA 2ZIUB 4DCOA 3U7RA 3LIPA 4QT4A 4DCNA 5F7XA 1JS1X 5GY7A 3IUEA 5A02A 2H2IA 3G68A 3EQ7A 4HXFB 2YIDA 5IKPA 4M8NE 3LXXA 4RQAA 1PKXA 4XYGA 4M0KA 5FOWA 4MLCA 4BBZA 1MC4A 3CXUA 5CH5A 1EGAA 1JYFA 1YR6A 2OBMA 1U1FA 1OE0A 4KWHA 1TIBA 4US2R 3WYNA 1UKEA 1T4DA 3H2YA 2XUHA 5AJVB 4OOEA 1OH8A 2RONA 1VI5A 1GDHA 1MGOA 2W6CX 2XRYA 4RIHA 5ULLA 4C4OA 3VNSA 1R16A 1EUCB 1VJCA 4DUYB 5I45A 3SY8A 4UJ5A 3N8DA 2ZTVA 5IJZA 4DIKA 2V7BA 3H19A 1YXMA 3ISJA 1X2BA 2PUJA 3PUYA 1ODKA 2UUAB 1T2UA 4UUPA 4W5WA 3UTCA 2AR0A 2PX4A 2NP6A 3O92A 1H3EA 3M1YA 4QEKA 2DT5A 1HQKA 3BMNB 1JHXA 1XTJA 1ZRSA 4DCSA 4LHEA 2AN4A 4I2VA 3EXG2 2XYVA 5CNIA 5FI0B 3MJHA 4UFPA 1VM6A 3TE7A 1E4VA 5BQXA 1V8FA 3FCXA 5FNZA 2HGSA 1FVXA 4EYEA 1UIRA 2WSMA 3OPNA 4KOAA 3ZV4A 1CIVA 2PSHA 5ALXA 2Y9MB 2PZGA 4ZCRA 3LH5A 3HKEA 3OT1A 5TDHA 1Z8HA 3U56A 3M4ZA 2ZJZA 4ZTUB 5FP0A 1FW6A 5DOZA 3FF1A 3ZE7A 3ZWCA 5KTPA 4WK2B 5IC5A 1NAHA 5CVVA 3N3AC 2OGUA 3HFGA 3LBIA 3REFA 5BY2A 4X92A 4O1IA 3JD0A 5SV2A 8ADHA 1TU4A 3OQHA 1COZA 3EZGA 2MMGA 4QO8A 4OCZA 4PG8A 1UKYA 3G2IA 3V8BA 5AW8A 5KSZA 2J45A 1I2AA 4DZTA 2A94A 2R751 2V58A 4KC0A 4IV8A 5JSYA 3S55A 2BDEA 3A1DA 4UD6A 2DFVA 4OG2A 1Y8AA 1NBMD 1YACA 2Q7OE 5JC8A 4MKHA 3UF0A 3IKLA 1PFWA 3OQOA 3EA4A 2V7WA 1J20A 3DLCA 2CNWA 3ZZNA 4BFCA 3MT7A 3PNSA 3GN1A 2YTZA 2CFIA 3O7MA 2XVYA 2Z1DA 1KJ8A 3U81A 2OCGA 4CTJA 1YRBA 1T6YA 1JGTA 1Z5WA 3BC1A 5HCIA 1M5UA 4HXYA 3RYHB 4MLDA 2PVPA 1G21A 3T06B 1WB9A 3ANXA 3CV3A 3DEAA 4F84A 2DHDA 2P9BA 3RKUA 3C87A 4R1TA 1AJEA 2XYHA 4J4TA 5IULC 2B78A 1RAGA 3D5TA 4OREX 3KVRA 2W37A 4BC1A 3WIUA 1IR21 2SKCA 1JLKA 3MLBA 3MT8A 3Q3EA 3QKIA 4EHIA 3TF5A 3ZDQA 3ROZA 4KR9A 3F7TA 1QYWA 2RGEA 2IZ5A 2AOTA 4O3FA 2H07A 5CRIA 3S27A 1J7JA 3MB5A 1XKTA 5FOUA 3WHLA 1O77A 4H7FA 5REQB 5JZ9A 3KCQA 1A5AB 4Q4AB 2LP4Y 2VJMB 3JPWA 2VHZA 1MZPA 5ALHA 3HHPA 3SKXA 2CXHA 1UFOA 2CCJA 3WZMA 1EG2A 3OZXA 4Z4GA 2I8LA 4LF6B 4KVFA 2Q21A 3OAAD 4FHCA 1TX4B 4UEOA 1PT7A 4WE3A 3WJ7A 1E8MA 1E1RA 3UHJA 3MGGA 4B7ZA 1G8GA 2AS0A 4KJXA 5KJFA 4QOJA 4V02A 1E2UA 4NPCA 1E7SA 5J4HA 5L4SA 1D1TA 1JXAA 6YASA 5EWLA 4RD3A 1FCJA 3V1TC 3WRYA 2AQHA 3WLRA 4E03A 3ESDA 2LIPA 2BBWA 2HJVA 4PAWA 2FW7A 3RU3A 4EA8A 1L8QA 1SB8A 3MLEA 2Q5JA 4OHOA 2B8JA 1EESA 3R7SA 1HE2A 3G1UA 2H2FA 3CUYA 3R3XA 4HH1A 4MQBA 5IFKA 1XX6A 4UM9B 4LXQA 5E9JA 3UXHA 4A92A 4HDQB 3WWZA 4EABA 5A0TA 3ISVA 3E7FA 3ENKA 4MA4A 4UMVA 2NQ2C 5ALKA 3W9UA 5ARDA 2IQIA 1OAKA 3JZIA 3B60A 5FOSA 1VKZA 3AR2A 3H1PA 3HBJA 2QLNA 3C6BA 3CJRA 3LUKA 2V5UA 5AQEA 4KI7A 2YYSA 1WSDA 3P32A 5EUCA 1U65A 3BCHA 1HDGO 4P4UA 3SLGA 2HYIC 2V5AA 4G5SA 1O2DA 3BKXA 3O4RA 3OE7D 2QW0X 3CZAA 5I9MA 4DUZB 2DR0A 1RVV1 3DQPA 3W77A 4M8SA 2NAFA 1OT5A 2OESA 5L45A 3OEHD 1GQFA 3K0EA 3Q1KA 2PN1A 4CFSA 1H6CA 4FMDF 2A5JA 4DBLC 4LZOA 5LU9A 4ID3A 1TW2A 3PEWA 4NCJA 3C3WA 4M46A 1E3WB 2ONCA 1YZGA 4FFMA 1N7HA 1E0AA 2ZZKA 3KNZA 4V0NA 1N3IA 3SMQA 1R0WA 3QFTA 1KGDA 4U39A 5C0OE 3FLBA 4GZ6A 4R68A 4RFLA 4CR6A 3TB4A 3H8SA 4DSOA 5ESWA 1KFKB 2VRCD 3EIWA 3DUFB 3G8BA 4I99A 4KH1A 1JKJA 4R01A 3WLTA 1BDIA 2C59A 4P4SB 5B30A 1E6UA 2HQSA 5B37A 4MS3A 3PLAE 3K9CA 3M2TA 3ZK8A 2VNJA 4YRLA 2YJ5A 3GLQA 2CLDX 8ATCA 2R7LA 4QULA 2OBFA 1HEUA 5E8JA 2GAIA 2C5EA 5CTJA 4PX9A 2PSJA 4WN9A 3MJFA 1UEXC 2ZEJA 1T6ZA 5DDIP 2Z3WA 1QKIA 5K0SA 1U98A 3OOEA 2Z9BA 1DRUA 5I4BA 4JZYA 1PD1A 3CX6A 1GRVA 1UQTA 3GZJA 3OQVA 3S28A 3KYBA 4A2WA 5ED4A 2ET6A 2PGLA 1VJ0A 4MB6A 3M9XA 4XX1A 3ACBA 4FDLA 3C5VA 2D1RA 3MJ4A 3A2KA 4UBNA 3T7DA 3S1SA 1ZVQA 1B3RA 5JCXA 3OAAA 3QTTA 2BF4A 3A06A 3P9SA 4J7UA 4LXUA 4R3UC 4P7GA 3NRJA 4R0VA 2GRUA 2BM0A 1CRZA 2WJIA 1PX0A 4FONA 3U3ZA 4I0WB 3ROKA 3QUTA 1JNXX 3OJ0A 4AZ0B 2G9RA 4B2LA 1FEZA 2R2AA 2R85A 3O4HA 1OV4A 5AVUA 1RLIA 4WVLA 3TOVA 1DX6A 1DO8A 2F4VB 1R18A 2CHQA 4Y7CA 5T3UA 2J6CA 4BVJA 5EJ6A 1UDRA 1QLWA 5TMPA 1XOIA 4NV3A 4S04A 3VC1A 5IM5A 3MWEB 3B1FA 1AZTA 1WCIB 2F8LA 4QASA 4JC8A 4RPLA 2ZR0A 2HLDA 4ZTZB 3QHQA 1AUOA 4HZUA 3KLNA 2OXRA 4FILA 1RSZA 2EHJA 5JDCC 1IOLA 1QG2A 5B57C 1RWVA 3D4LA 1NPYA 2AN9A 1GLGA 2OV8A 3JTMA 3DMRA 1X7WB 4IXTA 4NBLA 5F51A 2HA2A 3D4NA 4DR7B 4BXOB 1RWPA 3FJOA 3RVBA 2GTHA 1GUFA 2NO4A 4GX5A 3MW8A 4MHOA 2OM6A 5FAXA 3GEEA 4B4DA 1NC1A 3GJ3A 5FDFA 5AICA 4YIHA 3IQXA 3A6PC 3M6WA 2XDAA 4B6RA 3H65A 5IJAA 3NHSA 4AJ9A 2QAIA 4ISBA 3GFOA 5KNDA 1WDTA 1YRYE 3BQNB 1NU6A 5DX8A 3T0IA 3H1EA 3UVEA 4X95A 2FV8A 5A62A 3FWKA 1ZD9A 5CB8A 4AL4A 4EZIA 3LQ4A 2H06A 1HNWB 2G5CA 1E96A 3QA9A 3ZCSA 4FR2A 1JG1A 4X54A 4W9NC 3DVRX 4LCJA 2DGDA 1C2TA 2OZPA 1CY4A 1LKZA 5J63A 4OKNA 5T5QA 4DLTA 1EUQA 3D6UA 3FNQA 2XWQA 1USWA 1AKVA 2CD9A 4JSYA 5AM5A 4Y2UA 3H2HA 1JW9B 2W6ZA 2XRFA 3N76A 2PBRA 3UW3A 3UBTA 1YZHA 1ISPA 1IZ0A 2H4YA 4E5PA 1AKTA 3AJDA 3QBEA 1ZD1A 3T5CA 3RPEA 1X92A 2DCMA 1TVKA 3LHIA 1MV5A 1XZPA 3W9BA 4MQMA 3AVVA 4ZOLB 3GDFA 3HJAA 3OC6A 1B15A 3KYDB 4BMPB 3MINB 2XZTA 1T5OA 3ZY3A 3LM8A 3G7NA 1Y6QA 2G7ZA 5F2EA 3SBXA 4URXR 1KI4A 4JUBA 4DY4A 3PNOA 3DR3A 3IO3A 1TECE 5KYNA 4GI1A 2WJZB 3DC7A 1Z9BA 3WOVA 3ZU6A 5AK6A 1AK9A 1KYVA 4PYKA 5TXGA 3WWDA 1TTTA 3NIWA 1R9NA 3WSTA 1RCTE 2G67A 3QWBA 3GFQA 5I7RA 4R6XA 1QRRA 1BDHA 5GM2A 1DTWB 1K8QA 4HEHA 2RCNA 5FPHA 1JBKA 1VLVA 3IMGA 3UJPA 4ZI7B 2R0QC 4P3XA 2A4KA 1A98A 4OLHA 1OBCA 2SCUB 4E0BA 4G86A 1NKVA 4KQGA 1ZLYA 3DEKA 3EG9A 3RIGA 1GZ3A 4FI3C 3TIGA 2YUTA 3E9EA 3HY6A 2ZYDA 4GOJA 2NSLA 4AJOA 2Q4BA 5EIXA 2R4QA 3MFQA 1JJFA 1JLLA 2OSBA 4NLLA 4N0QA 4NMHA 4ZT4A 2VC2B 1NN1A 4QDJA 4EEXA 3FUWA 5HM6A 5TQ2B 3OZCA 4IIHA 3MSXA 3I52A 3W06A 1N2SA 1YB4A 3RS5A 1OLSB 1X94A 1Z74A 3C7DB 2CYAA 4OQQA 2OO3A 2J0UB 1X3LA 4X71A 4C0JA 4WZAA 2VI5A 3UB3A 1XTKA 2J3LA 1WX1A 3HY3A 3FFBA 1KI1A 1W46A 2CW5A 1N2HA 2FKAA 3KYCB 3P0HA 4WESA 4WFKA 2OP0A 4XEHA 4I55F 4LOIA 5K3SA 3TNLA 3ZHQA 5DZSA 2P27A 5M2QA 4KMSA 3YASA 2XDQB 3EMKA 1GGVA 1MMFB 2AMJA 4H08A 1E69A 3SZUA 4LF8B 4YJHA 3LPNA 3UH0A 3M49A 1QH8A 5H02A 4LUCA 1PG0A 4UU0A 1L1RA 5G2OA 3A1FA 3W1EA 4HVLA 3DZ8A 5EP2A 3EAFA 4JCOA 1ZN2A 2IY7A 4WBNB 4ZT6A 4WOKA 2O1WA 3D0RA 2V1UA 2AFIA 3ZWWA 4YJGA 4LRWA 1I7LA 1PG5A 1A4IA 1C1DA 2ANBA 3PQDA 3R09A 1R6VA 1NQXA 2PFGA 3D6TB 3ORYA 4H15A 4CL8A 3C6QA 4FSDA 2O0HA 4GKAA 2H4XA 4N18A 4Q7JB 1KQ3A 5BV8A 3RAPR 3O8QA 2JD2A 3NBUA 3BTVA 3HJRA 5DIZA 5E7JA 2I4LA 1CF2O 1EM6A 3MT0A 2HA6A 2XE4A 1B42A 4WOBA 3EW7A 3ZEIA 4KI0A 2IHNA 1OHHD 4NYIR 1WTCA 1SB9A 4RMHA 4M7PA 4NMLA 4Q9HA 3EOAI 5BWNA 3LCJA 5ARBA 2WIBA 1Z25A 3BHIA 4P54A 2CB0A 1V71A 3E6AA 4J4HA 5ITZB 4HXEB 2YMPA 3FUVA 1WF3A 5E0KB 3MG9A 3M9LA 5B58T 4EGQA 2I9PA 1F8XA 1R0LA 4MQFA 4BMNA 4G41A 3DVAB 4R5MA 1HTTA 1A8UA 1SOAA 1LV8A 1U6KA 1Y8QB 5AHXA 1I4WA 3RVNA 3ST7A 1DWOA 1MH9A 4ND8A 1WMFA 2X9LA 4IF6A 4RKQA 4M55A 4GDFA 3L9XA 4ZXFA 2G06A 1RR6A 5HKLA 3D54D 5C53B 4EK9A 3RYFA 5L3SA 2V7GA 2LCQA 2ZQYA 2C2YA 1SVOA 4JC4A 3B1WA 2IU4A 2Y0CA 2UVPB 4UBJA 1TUIA 1TC1A 4Y2JA 4YC7A 2OEPA 2OG2A 3BYZA 5HGJA 2GPSA 1S2NA 1E9RA 1GKIA 4OP1A 1YBVA 3KJIA 2ZIEA 3OM0A 1QG6A 3F6RA 3ZNNA 1VCOA 2Q29A 2BP7A 5FTMA 2VJKA 4RY8A 4WGGA 4CVNA 7MDHA 4MGKR 1BSVA 1B7GO 4FX5A 1U9CA 4L7QA 3CUTA 3PQ7A 1L4YA 2HYDA 2YJZA 3IC5A 4EZBA 1OPXA 4XIJA 2IHKA 5LM3A 1QC5A 2JFNA 3F4LA 3LUPA 5A4IS 2Q3HA 3ZDCA 5DLEA 2H2GA 1K5DA 1ZU5A 4WKCA 1R9JA 2VG8A 1U5AA 4KRXA 1PR6A 3EIXA 3PRHA 3D3KA 1HTBA 2CFTA 2CD7A 4MVJA 4KB5A 3L8CA 1WPQA 5JRDS 2R60A 4BO1A 1M2VA 7ABPA 4Z1OA 4MR9B 2HCJB 3D4IA 4NBNA 5BN1A 2X7XA 3QVLA 1NQUA 2I33A 2PVSA 4F72A 1K6EA 2WHYA 4D26A 2JGLA 2EL7A 4JJZA 2G8NA 5K3FB 3TDMA 5JLJA 3NM4A 1JSXA 4ZO8A 2KLHA 2Y77A 5DGXA 1YK0A 3BCUA 1Z0DA 1TA0A 5E8RA 4FKMA 1NF3A 1ZSYA 3FRHA 4A26A 5JCJD 1LQ2A 5IS2A 1JILA 2B6HA 2J31A 1O94D 3IELA 3THYA 3GGSA 2PSDA 3D4PA 3UWPA 1EA5A 3F5MA 5JTUA 1ABFA 3KOOA 2C8LA 1XJCA 4Q4JA 4A8TA 2WTAA 4KUGA 2QD3A 3MERA 4R8RA 1Y1PA 1YZQA 2RAUA 4K8RB 4OBWA 4LE2A 4MX8A 1WOMA 4EJ0A 1B73A 1KOLA 1QO0A 3LZDA 1XDWA 2PX8A 5F1YA 4O2BB 5JCZA 1W30A 3I92A 2O59A 1H2RS 2I7XA 2ZQ5A 2WT9A 2ZB2A 2PEZA 1EK2A 3VA7A 4P93A 4EJMA 5HRCA 4XRGA 3MGCA 1QGAA 3KCNA 1BZYA 4QRIA 2VNKA 1H5UA 2B1GA 2IEIA 3B3QA 1SY7A 3FLAA 3IP9A 5CB0A 1AQIA 1RQ2A 2C5FA 3OJXA 4AS3A 1R27A 5CFMA 1YMVA 3T1VA 1F0NA 3EJ6A 4LXGA 3TX6A 4UNRA 5ERYA 2R4UA 4CV0A 1LDYA 2GNPA 3VJKA 3PLNA 1A9SA 3ZWVA 3G9UA 1L1FA 3TO5A 1CFZA 2E85A 1QS0B 4CWAA 2RGRA 2P2YA 3M6VA 3WQHA 1YDFA 4DCVA 2JAHA 3E5MA 3BICA 4YBRA 4A7PA 1ZK0A 3U44B 3U3KA 2WHEA 1CUHA 5EJ8A 3H83A 4NZNA 1E0DA 4DIFA 3KPJA 1L5KA 1XCGB 2ZDHA 1Y1RA 5EJ4A 4YCNA 2IT1A 4R1OA 5CYFA 5FPYA 3ZR4B 4EHBA 4L74A 3P7MA 4AICA 1YZFA 4WXYB 3U0BA 2QX6A 2G1UA 2GYYA 1VSVA 1XQXA 3CHYA 1JTFA 3MHPA 5B1IA 1W49A 1DCMA 5AKXA 1G4AE 2OQIA 4DNOA 4RV5A 5IUNC 4YR7A 5EN4A 4O2AA 3GLSA 1UODA 2HPHA 3KT0A 4WKBA 4XXHA 3URMA 3WLHA 3EZ7A 1Z34A 2QTRA 2Z6VA 1XDDA 2QL6A 2VXCA 5FAKA 1G8PA 1V41E 2XUZA 4GMXA 4DWWA 3WL6A 4CLEA 1JE1A 1Q7EA 1C2YA 2AIRA 1Q2XA 4RY9A 3MF4A 3ZU4A 1BEUB 5AI5A 4LRXA 5I4IA 2N1MA 4DM4A 4FBMA 1Z73A 2XUGA 2ZAIA 4Z0NA 3RYIA 3ZWQA 2CSXA 4ND6A 5JADA 3ZWYA 1EFAA 3U1VA 4XWWA 2BGRA 1MD9A 2Y2UA 2DETA 1EP3B 4H27A 2WSSD 1Y3CE 2EGHA 2XSZA 3DV0B 4F96A 4KSCA 2PTHA 2P7IA 3M8KA 4FNMA 1KO8A 2DQZA 2O5VA 4XSVA 5M3BA 2JJ2A 4BNLA 1JH9A 5LMUB 1Z13A 1NSYA 2ZYIA 2HSGA 2RBEA 2W2XA 5PGMA 5A9SB 2VPZA 2V45A 2ZIXB 2BHNA 2ZE5A 3GLIA 1C9YA 1M9NA 2BONA 2O6HA 5E3IA 1YR8A 1G8KA 5EVJA 1CX9B 1NLYA 3BE5A 3HRIA 5BWCA 3DMHA 4ITUA 3CXRA 4HH0A 2BFBA 2DFTA 3VGPA 3I2FA 5LXTB 1DQSA 2AD1A 5JFTA 1S8FA 2QRPA 4RESA 3O03A 2ZJ5A 3G0OA 2VOEA 4BRUA 4CM4B 1T9DA 2P9TA 3EGCA 4LDJA 3GT0A 5FA8A 1NW6A 2W7TA 3E3LA 4H7PA 4YV2A 3B78A 1TQDA 2AUMA 1EDEA 1GL3A 4JT4A 5C81A 3PUHA 1NJ6A 2NN3C 4XKJA 4BNDB 2JIOA 2ZANA 4YI5A 4CIDA 2IYPA 1M2OB 2BGIA 4CGZA 3Q5GA 3LFHA 2GM4A 1T36B 1GPUA 1JV2B 2A9RA 3CISA 1EP9A 4JLMA 1G4HA 1DIGA 2G5TA 3IAHA 4WOJA 3WGMA 4TSKA 4BEBA 2D00A 3REQB 3J7TA 2ZRIA 4G4IA 5FTNA 5SYNA 2QVGA 4YP5A 1J00A 3AF3A 4J29A 3VHLB 2BFWA 3DTYA 4CT5A 1D03A 3OWXA 4Y9SA 2W2MA 4R81A 3T4XA 3JQDA 2PS9A 4CMJA 4KQKA 1NN5A 3NDPA 4JQCA 4UE6A 4Q9IA 2EIXA 4U9IS 3GLRA 2AI3A 5F23A 1R0SA 1GSHA 4KFTA 2JLVA 2XB9A 2W6MA 5DN9A 3Q3CA 1L5MA 2Q0XA 1MCZA 1JYEA 5LFAA 3LX5A 4HUQA 5B3AA 3PD7A 2KBEA 2O8EB 2H1WA 1B76A 2A1TS 1NQOA 1HOXA 2WAMA 3A0RB 3VZDA 1JJIA 1TLTA 1T10A 3GLGA 1J8VA 2F43B 2QT9A 4LYFA 4ARVA 5ALNA 1P4JA 3C24A 4EB3A 3EIHA 4EEZA 3GJ8A 3WLAA 1L7VC 3A1EA 1UINA 1L7NA 1JQAA 1RJ9A 2BMDA 2G72A 1HV8A 2GN9A 2P2GA 3P9YA 4R83A 1SBIA 5K1ZA 5KHLB 3KE8A 2KYRA 3QU5A 3FUUA 3RADC 4IIUA 5KOHA 4IGFA 2XADA 4GAEA 3CF0A 2ZYVX 2X5XA 3IMEA 4RVGA 3ELUA 4P3OA 3UG6A 5E38A 1DOAA 2EFCB 3PUIA 2JGDA 1YNOA 2MSWA 3HCEA 3W3ZB 3K7EA 2PRYA 1R00A 3QEBZ 2OXFA 2OV3A 3OIFA 2FK8A 2Q41A 3PG5A 4UEWA 2VXYA 5BV7A 1IXYA 1I33A 3G9QA 2GUWA 1N0UA 2P5TB 4RW0A 5TSDA 2XWPA 4PBRA 2QE6A 2G36A 2ZRMA 2BIFA 1B8UA 3UXEA 3DEFA 5C4GB 4PW0A 4JJGA 2H1IA 3IHLA 3HVHA 2RB4A 4V2IA 1Z5OA 2JI6A 1XYVA 4ZQCB 1VPVA 4N7BA 4DJAA 2D4AA 3K0HA 2QPLA 2PZ8A 2VWPA 3PVCA 4P31A 1JSRA 4LBVA 4G5OA 4Z86A 3TMAA 2Y6VA 3O47A 1F5NA 2Q62A 1NR5A 1L4FA 3TLGB 1HT1E 3L04A 4DLRA 3TMYA 5B7GA 2FSUA 2AZMA 2G3YA 2NACA 3HBFA 5AMXA 2WTBA 1S89A 1ZNXA 2HZ7A 1IY8A 3PGJA 4GKVA 2PNJA 3GIDA 1X8KA 1M67A 3TRDA 4C7JA 3NBZC 4ZVTA 5IZ4A 2H2AA 3PCTA 4JXJA 3RJ9A 1HLFA 3QHPA 2VHYA 1XKQA 2B94A 4R16A 1B0AA 1RM5A 2C7BA 1T9GR 1NKTA 3T7IA 4ARZB 5CA1B 3EZ9A 5LQRA 4RD2A 1LSOA 1NT4A 5BUSA 5ILQA 3AV0B 4E5MA 2DSTA 3GA7A 4M1WA 4CCWA 1BCRA 2P0YA 4G97A 1QMPA 1I3NA 5IJ9B 3UV7A 4EGJA 4N82A 5DYTA 2IPNA 1H4TA 3KJXA 3B8EA 5EJ7A 3IILA 3DE4X 5H16A 1GGHA 1ZUWA 5C1BA 4YJ3F 1OJLA 2MSDB 1PV4A 5DI3A 3FVTA 3P5BA 5H3HA 4DA4A 1O0SA 2X77A 4Q18A 5CCEA 3O8RA 4PYLA 3VPCA 4NCNA 2WM8A 4AUMA 4XIYA 2NW6A 1KVRA 1XYGA 3F7MA 1NF9A 2FF5A 1UK8A 1QHFA 4X65B 3DTVA 5JXHA 2ZXFA 3IX7A 3RB8A 3H5NA 4JJIA 1ZXLA 3HJNA 1V8ZA 4QICA 1J9EA 3E22B 1FFHA 4HGPA 4TVSA 5CDHA 1VOTA 1QFJA 2HXGA 2J7PA 4TTQA 1O9HA 3EYWA 3SBOA 3C4JA 4BJ3A 1JDPA 2JLRA 3PFWO 3NIBA 2ZIFA 1XVLA 2ZS7A 1EBBA 1XROA 2AJDA 1EP1B 1KI2A 4CKZA 3COPA 2MSKA 1IN6A 4HBGA 5CHEA 5C51B 1T2FA 4OHMA 4QPCA 3K9FC 1MB2A 3OTOB 1G41A 1JHZA 1UC9A 1VI2A 3G23A 3OBBA 4P3YA 1YUMA 4PO3X 1BMFD 2AK2A 3KJNA 1B1AA 3Q8XB 4O2LA 1Y7HA 4PPQA 4LYDA 4PPYA 4BLUA 5JDIA 4BX2A 2WQZA 2FZGA 1Z22A 3PNYA 1TD1A 2OD9A 3ZLUA 4F8EA 3AX6A 4K26A 4QO7A 1KDOA 3ABZA 4LX0A 3FPFA 3I34X 4OXQA 3OZWA 1W2GA 2B69A 2A9KA 4ZHQF 2PPLA 2GDJA 5C8VA 5IWCA 2XXBA 2IS2A 3EC1A 1Y8RB 4L73A 2J08A 1NVDA 3GWZA 1PZXA 2YFHA 4DIDA 2ROQA 4B45A 3PE4A 2YZMA 3RF7A 3VKWA 1ZNWA 1XIVA 3M4JA 2HSEA 1HSZA 1AZLA 5F98A 3CLKA 3WGLA 3E3MA 3QVXA 5EKSA 3VI3B 4X8OA 3ZKAA 1DHTA 3LCRA 5KYTA 1ZGGA 4QUEA 3KB1A 3D4BA 2OG1A 2IY9A 4EB6A 1FTWA 4L9AA 4OYYA 4DLNA 5C5DA 2ZYRA 121PA 5FO1A 3AM3A 1TMKA 4HEA1 2F3RA 2N42A 3A9VA 1WCYA 2R6HA 4DB2A 1E3DA 3LXUX 2B99A 2FG5A 1DP4A 4NULA 4CUZA 1VFNA 3B6EA 4DT1B 2PZBA 3GRYA 1J6UA 3FIUA 4OQNA 1MJHA 1PNRA 1Y7LA 3KHTA 5JQGA 1Z0JA 3CN9A 2XDYA 4RTMA 4CLXA 2COEA 2UV8A 4QPZA 2WFLB 4XYBA 2OZEA 1M2GA 3JD1A 4FDUA 1Z0UA 2QPAA 4Y2XA 3ER9A 1USGA 4D41A 5KHAA 1GG2A 2CCKA 3CY6A 3LF1A 3OC0A 4IIGA 1Q6ZA 1MU0A 5CX4A 2MCFA 3LGXA 4EEKA 3VVMA 4PWYA 1P1CA 5ENVA 5GZ6A 3A6DA 2Q6IA 3BIXA 3IT1A 4PBSA 2HNKA 1I80A 1JHRA 2QS9A 2WC1A 2Z0MA 1WEKA 4ARAA 2CUTA 1P2BA 3G5LA 4NK4A 2VYNA 4WL0A 4BEJA 3TGPA 3HUTA 3N6VA 1MNQA 3K9LA 1A8PA 1JKMA 4UU1A 4URZR 3EQ2A 1ST2A 3I8OA 4MV7A 4BVBA 4C03A 2ZIAA 1QTNA 1JXOA 4RDXA 3KWJA 5ARCA 3I5XA 1JECA 1Z0SA 3HUEA 2OHHA 2ZRGA 5FX2A 5HIKA 2D0IA 5ICSA 2I4RA 2Z56A 3AEXA 5JZOA 2ECFA 1ZEJA 4J0GA 4P08A 2PANA 3JS5A 1CETA 2N75A 1BVYF 1QP4A 4QGGA 5CT9A 5AKYA 4G4SP 2HJRA 4PV7A 3IDOA 2IS4A 3KAQA 4HDKA 4IXWA 5IASA 5CIYA 3OT1B 2WHPA 4HGRA 3ZWAA 2VJDA 3N2KB 1Y6FA 1OOEA 4D5GA 5KQSA 3JQ7B 3LYLA 4M60A 1TUEA 1V2HE 1CUBA 2FN9A 2W43A 3IVAA 4KK3A 2J7KA 5LN1A 1E4OA 1NZFA 4B7UA 4XB1A 3BREA 3PTAA 2ZBVA 3T3HA 3OCJA 4FW8A 4LCBA 1SMKA 4R2JA 2C5SA 4TQ9A 1HETA 1TIPA 2CLSA 1D04A 5KYUB 2OFOA 4TLEA 2CHFA 2J41A 4PAOA 5F3DA 1BXZA 1WE2A 1Y7IA 2FEOA 2Q2OA 3H5VA 3IE0A 1NFRA 2PU7A 3KQWA 4J8PA 4NCXA 4X91A 5DW3A 5BN5B 1QP7A 3P19A 3AZOA 3EODA 5EZYF 1KMCA 4ZYUA 4MW5A 5HIAA 1J2UA 4MI3A 1T8WA 2BLNA 2O7RA 4BP3A 1NP6A 2C9CA 5KS2A 1ZM7A 4K9LA 4TL8A 4I1PA 3AB3A 2QMQA 3JYQA 3OM8A 1Z56C 4FYKA 4KQFA 4FYXA 2NSHA 3OQBA 2QRQA 2FB9A 1H2AS 4DLAA 5JI3E 1A1SA 3LQRA 1MRSA 4RL4A 1NMZA 3E48A 3QYAA 4J75A 3UENA 5JYEA 3HTXA 3U9TA 3NBMA 1AV7A 2A9QA 5JHHB 2P4UA 2PX0A 4RSMA 1T2VA 3MCUA 4DMHA 5C1DA 3FTPA 3F3KA 4BKUA 3RJ5A 4ROSA 3GRCA 1QONA 3K09A 5KINB 3EUFA 4ZEOA 3MNFA 2IXDA 2O7QA 4M53A 1ISMA 1VKHA 4LZWA 4XH9B 5AW6A 5DTJA 3EXG1 4OQDA 5BW5A 1PBNA 1Y5LA 2IEBA 4EKDA 3AY0A 3O7WA 1JTVA 2C42A 1RZRA 2OGSA 1TMGE 2VDRB 3WVNA 4YJFB 3X2FA 1K8ZB 4IY1A 3B3GA 3I64A 5KNCA 3O8OA 1GFWA 1JDSA 2O2HA 3EQ8A 1UBTS 3OJEA 2XB4A 4Z0TA 2EQBA 4AKSA 3F6CA 3OOWA 1FS4A 4NAVA 1ECPA 5EGNA 1P1IA 1T0UA 3DFZA 4PNHA 4Q47A 2HRCA 2XUOA 2B4QA 2R47A 3A9RA 3A32A 2Z04A 3GD5A 3GHHA 4EQZA 4F6RA 3CR8A 5CB4F 2QGFA 1E79A 4GOOD 5EMHA 2O5CA 3KQPA 3PQ6A 5AK5A 1YB6A 1RWMA 3F7NA 4KIGA 1PUIA 3WKAA 2I55A 1NR1A 2CDCA 4TTRA 4ENVA 2B2XA 4BO9A 4F4JA 5DJ5A 1PKEA 2YWFA 4HPWA 2OCXA 3LKVA 4F7DA 2X4LA 3IALA 4N03A 1U8YA 5KJCA 4MA0A 2XH8A 3JARA 4O4LB 2Q1TA 1ZG3A 3M70A 1KEVA 2FWBA 4TWAA 2BDUA 3DH0A 3RHSA 1UEJA 2FUG1 1E20A 1RLUA 2ZI5A 4IQ8A 3DJYA 5LZ2A 5BQFA 2VZ9A 5FTJA 1L4GA 2C2GA 1NVAA 1S7GA 3KYIB 3HP4A 5CH3A 1PYDA 1AT1A 3C3DA 2WTNA 3B9BA 4XIIA 3RFVA 4DQKA 2X0IA 3KB6A 4I4TF 4W9MC 3ZDDA 1E63A 1PU2A 1K8XB 3GGCA 4FOTA 4LE0A 5CNJA 4RZIA 1G5RA 2CHEA 2ZWAA 4ME6A 4IDQA 4KDFA 2JK0A 2XBMA 1Z45A 1C7RA 1SBNE 3WV4A 4OJNA 3S8MA 5G0SA 3UT5A 1GPBA 5FV4A 4EFNA 1BS2A 2Q0SA 5DN6D 1W4RA 2BFPA 3LUBA 1WY7A 3UH1A 2D2IA 4RIFA 1F4PA 2GWHA 1P81A 3AL3A 3IQHX 5EPEA 1RYHA 1EJBA 1PV2A 1I3KA 2VJOA 1DINA 3AOEA 4TMWA 5AVWA 1OKKD 1KK1A 1SUEA 1A9QA 2B4KA 4EGAA 1AQYA 3RVOA 1T3ZA 3CNHA 4EIWA 1IEVA 1AHNA 2W6QA 2J0VA 5ALWA 1A72A 1M8FA 1ZL2A 2FCRA 4M76B 3WK9A 3IO5A 3UUWA 1UPAA 2PIAA 3GYBA 1P4HA 4MKZA 4TKVB 4M9ZA 2VP6A 1NP3A 1EUDA 1IZYA 1SUIA 1WS6A 3KJEA 4K2AA 2ERCA 4QT0A 1CUFA 3C8ZA 4Y1FA 4A8PA 5ALVA 8GPBA 4HOYA 3ZU3A 3VAAA 3NEJA 4MCAA 4Q3DA 5F2OA 3T3MB 2Y68A 2NPIA 4FTWA 4HC4A 4JB2A 4GWGA 4JWKA 3B5EA 4KYUA 4ZZ1A 3VNBA 1M1NA 4JLVA 3KXDA 1JZSA 2O7SA 3SXUA 4DE5A 4EHNA 1M1XB 1Q6YA 5CBPA 1M34B 3L7KA 1TZMA 4REQB 5FL7D 1YJCA 2I80A 4X64B 5D3MB 4DDMA 3H3FA 2YN2A 4MYUA 2GM9A 1CD5A 1LSSA 1QHHB 3DAYA 1FU8A 3GEIA 4YCAA 4K88A 2RGUA 2WE8A 4OXIA 4J0QA 1W85A 1MABA 1U2QA 2A0XA 3C5HA 3FNRA 4B47A 1Z4JA 3OZAA 4B8YA 1B8VA 5T4FA 4QATA 3I58A 2AHOA 4HHHS 4L8VA 4M99A 4MAAA 4X62B 1FP1D 1XMPA 1AXRA 1PTJA 1L8XA 1RRMA 5FWYB 2WTXA 3L9WA 1M2FA 3FIJA 4CIXA 1GY8A 3J81k 3SHWA 2ORYA 3ADPA 3LPMA 2BFFA 1GDDA 1CXZA 4F97A 5MGBA 3JQQA 1FP2A 2O54A 5FA5A 2VHVA 3B7PA 4QQFA 4F2WA 1RSCI 1J23A 1UBEA 2HWYA 5MF6A 2ATVA 4AF8A 3TZKA 1OCEA 5C4MA 4UBIA 4MKGA 4L5YA 1KZ4A 4BJ6A 3E9YA 2NO1A 4J43A 4TRJA 5L53A 2RE8A 4FD3A 3HZRA 3WL5A 2O8CA 4OAQA 2J32A 3HUFA 5JCOC 3PYLA 3C3MA 1MG0A 1NURA 2VP9A 3EXIB 3HO6A 4KP7A 4RDIA 3VAYA 3I01A 4F7WA 3IDZA 4YJKA 4OX9B 2A5YB 3OZIA 1XXHE 4MRPA 4U6SA 1Z5GA 2YQ4A 1H1TA 3G0GA 3KPVA 4JT9A 2ZRQA 2G6BA 1ADBA 1TFUA 1UMKA 2ONZA 4NWIA 4X7MA 3V80A 2J3KA 2OAP1 3PCXA 4AJKA 3P8ZA 3WYAA 2ZCUA 2PMDA 1GV0A 2FZKA 3FCSB 2EATA 2VRNA 4J1QA 4Y2TA 4CM6A 2JDIA 2AQ8A 1J8QA 1UOEA 2C1EA 1G3IA 3AP3A 1JQJC 4OUKX 4J6FA 3BXGA 1QR6A 3K8YA 2QR3A 1OKKA 4IDOA 1L5ZA 4KIJA 1NQAO 4L8FA 2LVBA 3ZE2B 3L84A 5A0VA 4LZJA 4AT1A 5M29A 3ACCA 4B5KA 3LQQA 3FNEA 5CG2A 3OMWA 4IUDS 4PAGA 4V0OA 4CRWB 1W93A 3W5CA 2B4TO 3QOYA 1DXOA 1TVKB 3ZD6A 3JY6A 5C3MA 3AI2A 1U0FA 2J33A 4RLFA 1CY8A 1DAKA 2H5JA 4YB8A 3MELA 4TTTS 3TEJA 3WJ2A 1SC3A 3DT6A 4UVEA 3PL5A 2GYVA 2LR0A 2W6NA 1UDAA 5DSZA 2BVNA 2HCBA 5DNUA 2HXSA 3A9TA 3VYWA 1C7FA 2V9ZA 3T99A 2YJ6A 4HF7A 3V34A 5HM8A 4LJYA 2C7QA 4YP0A 5JASA 5C9ZA 2JKVA 4HK4A 4P35A 2FRDC 1O7JA 3WHPA 3L8HA 3ZDFA 3DZDA 3KWFA 2HDHA 4L1KA 3KQLA 5FBRB 5J9FA 2CSUA 3IKMB 4TTAA 4DMRA 2V98A 3MQ4A 4DRXA 3MRVA 2ZRPA 3NM5A 1VPEA 3B5JA 2CUZA 2OYRA 3EOZA 1BD3A 3I3OA 4XLLA 4K0KB 4MSUA 2C57A 4U1RA 2Q4DA 4MICA 3OTWA 3BH0A 1JDNA 4RGQA 2XTZA 4V0SA 4N0PA 2AGVA 2JAPA 2P2DA 4GQIA 3SC2B 3FR7A 2EKDA 3EG5A 4LZZA 1HQYE 3AEUB 4QU5A 2VBGA 2I6SA 4N5NA 4EAQA 1SHZA 4R98A 2OQ2A 3A6FA 5A3RA 3LX4A 3P4UA 4NEHB 3ZXIA 3VKHA 2VTDA 2XTNA 4A23A 1X19A 1U02A 2IXEA 4MROA 3I2JA 1CNMA 2AD5A 4Y9UA 1QV7A 5KNDH 4E94A 3QX8A 3UA3A 1IEQA 4LE1A 4Q9JA 2BEWA 1P2GA 1U0LA 4KQCA 5ALUA 1LSJA 3WKCA 3ZV3A 4BFLA 5KWEA 4MUIA 1NYQA 2H1VA 3Q7TA 2B9EA 1M2NA 4I6GA 3TW8A 2BR4A 3D1JA 2VZ8A 1YZKA 4WZZA 4WK4B 4DILA 1V5FA 1YRLA 2OCAA 1SXJD 3JQ8B 2WJ3A 1H0SA 1VIVA 3ZY2A 4MQ6A 2RGGA 3RBVA 1QH8B 1WBBA 1PNTA 3EC7A 3L43A 4XQEA 2VT7A 5IM4A 3VH1A 2QM0A 2WJYA 1KI8A 1GNPA 1ZIYA 4HADA 4L2IB 1YJBA 2C9OA 2BEVB 2GHRA 3FG9A 1Z2AA 3QY0A 3TDNA 4AZ3B 5KYKA 1Y9DA 1T0HB 4QGSA 1D07A 1H22A 1Z15A 3ESRA 3FBGA 4P3KA 4O4HB 5HIIA 4K9SA 3N74A 1CQJB 1JZQA 2AFIB 3CR7A 3O82A 5AVVA 1TF2A 4NE9A 4YJGB 5E4JA 5LLSA 4C2UA 4BV3A 4G63A 1K3UB 1LZLA 5HMMA 4FB4A 4YCLA 3IIKA 2ARKA 1RMQA 1SZJG 1YL6A 3IAFA 4ZYLA 1YZ3A 3O8QB 3ZHRA 4NR0A 1NY5A 5DCLA 3O3MB 2PY6A 4TN5A 2QX7A 4A8JA 5G40A 2QMYA 1K89A 4ALLA 5FTLA 1ABBA 4CGYA 1H3FA 2EYQA 1GKUB 1OBVA 3C6XA 3RRNA 1EJ7S 2O4CA 2DH6A 5BRJA 5H4GA 2XVXA 2CCGA 1L4KA 1LF0A 3LPCA 4U6QA 3UGTA 2VTBA 4Z4EA 4JDPA 1EX7A 2PUAA 2YJ4A 5EHXA 3NRBA 2QYSA 1UM8A 4FDTA 3BWYA 3M6FA 1WSBA 5A3JA 1WAMA 1E4EB 1G2IA 3QH4A 3QPCA 1ORDA 5B7PA 1RLCS 3HEAA 3L02A 2YQ5A 1PK8A 1KVTA 3OURA 1T9HA 3A58B 3IAS1 4QYWA 4BB6A 5LKAA 1T5TA 3TQQA 3RC8A 1ODJA 4EY8A 3GUHA 1U0SY 5DP1A 4BZPA 4ZICA 5JD6A 3L2OB 3F9IA 1DLIA 1OLXA 8LDHA 1ML4A 3ZX5A 2O2SA 1OXSC 2XNJA 4MOWA 4C0QC 9GPBA 1BXKA 4NENA 4DR3B 3FB4A 2GJ9A 1ZM2A 3C3BA 3R5TA 3FKSD 2XBLA 4OMFG 4Q24A 3WLJA 4DV6B 2X1LA 2CLEB 5G0WA 2QZSA 3UHAA 1FZTA 4PSCA 4YAOA 4TQGA 4L08A 4V0QA 5KOJB 4KCGA 2QA5A 1UW9C 1JQDA 5IANA 1GCOA 2XDWA 4ZVPA 3S40A 2VDLB 1L4MA 3AONB 4EFLA 3L1JA 1GARA 3ZLJA 3AEKA 4NY1A 2CLIB 2JW5A 4HWKA 4UARA 4YAUA 4OHUA 2A0YA 4S1OA 4R9SA 4E11A 2IS6A 1KI3A 1CJBA 3DXZA 2WYHA 1U5BB 3CG4A 2JIRA 3BXFA 3CNEA 4F21A 2GHIA 2O2CA 3AKDA 5LIRA 1IK6A 1LPMA 1RRFA 2ID4A 1DOHA 3AVTA 5L3RA 3OQIB 5DP2A 4I3HA 2P9GA 3UQYS 2Z5LA 2IUSA 2NTVA 1Z2DA 4C4RA 3R3UA 2IV3A 4J0FA 1GNTA 1AKQA 1SXJA 1WXIA 2V7QD 4H0FA 3CE9A 1QPGA 2A35A 4L57A 2OQRA 3G1WA 2F1JA 4MCHA 1WDKA 2P9JA 1UJCA 3QJYA 2P41A 2HA4A 1N2CA 1W5BA 3CKYA 3EQ9A 3E7WA 4PZZA 4TMVA 4FFOA 3T3NA 2YYZA 3MCTA 3SQOA 5F9HA 1EFKA 2Q5LA 3M34A 2W5UA 2HF2A 2IH4A 1XF1A 3D7KA 4HEA6 2OWDA 2H0RA 3KUDA 4MS1A 1NVUQ 2GZ3A 3WA7A 4BLTA 3CWCA 1UMCA 2XAAA 3V00A 3TINA 1UBOS 1L2TA 3BHMA 3RKSA 4XR9A 4JJEA 1DTEA 1VHJA 4KO3S 5DK4A 521PA 5IDVA 4UATA 3ZNQA 3V5NA 1I0IA 2NO0A 3PPWA 1N32B 1GU7A 4NPAA 4NZOA 3QKSA 4X60A 2D1YA 3ZPXA 5HKBA 1H1LB 2HBQA 3THYB 2W6JA 1M76A 3VUEA 2JLAA 5I7HA 3GLFB 1GOTA 1TZKA 3GLHA 3KXIA 1X7YB 3OQ1A 3LDFA 4RQUA 5HFAA 1UJ6A 1M6VA 2QMUA 3O26A 3QBJA 1GZUA 3TG8A 9ATCA 1ZISA 4OL9A 3WQBA 2JAXA 2FWPA 2ZUDA 3DBIA 3KQQA 2FOXA 2Y66A 4V1CI 5LNK6 2BM1A 2N0SA 4DG9A 5LJLA 3V1KA 3COVA 2HJGA 3I32A 1M1YB 1V4BA 3AERA 5CVJA 3PHIA 3RFUA 2EG9A 4GL2A 5CJPA 3WNCA 5EE5B 2WWXA 5CDFE 5HIJA 4AJPA 5BT8A 1GILA 4ZEMA 2O52A 1DBVO 1C3VA 2H8KA 3IYLW 3N86A 1KORA 1RXCA 3FCCA 4B4WA 3UTDA 4F0MB 1J0BA 2ISSD 3ND6A 4YJ2A 5CDTA 1FFCA 1I32A 4ZA2A 1YQXA 4NH4A 1YCGA 1LPPA 1NQWA 3AY7A 2XWSA 3P0FA 3QBTA 1MC8A 3NX4A 5L6MB 2R6CA 2FMFA 3LNTA 5EESA 3DMFA 1JU9A 2PO7A 4ZAGA 5SZJA 2DFXI 3WSWA 4FFVA 3ROTA 4CIYA 3QIAA 2P9FA 3DKVA 1RRKA 4M0LA 4WLNA 4EHHA 1N0VC 1EK5A 2P30A 4LRQA 4Z51A 5AW9A 4A03A 2HB6A 4ND3A 3LKBA 3FSGD 2FEKA 1EHIA 2X58A 3PTZA 3D8SA 3GH3A 1IN5A 3SZGA 1E1QA 4XOIA 1M6EX 1GU1A 1SIWA 1WY5A 3JQGB 1EWYA 3JV7A 3Q11A 1YHYA 1BE6A 1LX6A 4E2YA 4MVJH 4QTXA 3UT6A 2XYQA 2MTBA 3CX3A 3EZYA 5H59A 3TZCA 1USUA 2Q4OA 3NAMA 4KLCA 1S5PA 2F17A 4J9VA 5CM8B 4XWKA 3IAAA 1D4FA 2OCBA 1JWAB 1E9CA 1JDBC 1PL0A 3EIEA 2HJ9A 4GDMA 1G5QA 2A0FA 2QXTA 4GVXA 4J1SA 2VDQB 2YW9A 3PQ5A 2PX6A 4OFZA 5BWBA 5ALSA 1OWNA 2HI0A 3LY8A 4L3OA 4W99A 2CV2A 1X1BA 4W8OA 1JKFA 4ZCQA 1V8DA 4LNUA 2COUA 5AJHA 3TTWA 3HYCA 4GXNA 4F4HA 1AQUA 2A7QA 2JC3A 5LQKA 1UXKA 5F9FA 4HN9A 1SVNA 1LVGA 4YLGA 2XMZA 5K8IA 1QQTA 1R3DA 7REQA 1GFIA 4LWQA 2PT5A 1S7CA 4B87A 1QIMA 1J2JA 2XD9A 3I4FA 3I39X 2PLNA 4G26A 4QSHA 4YFVA 5F52A 2OV6A 4DMCA 3H1TA 4PLZA 1L9KA 3KZOA 4CMGA 1JR3E 1SKYB 1A2QA 1XZLA 5B36A 1P2TA 2FR0A 4KWEA 1XT6A 3CKMA 5EHNA 2QQFA 4L0QA 3ICPA 3RK1A 2PRSA 3OU2A 3A4YA 4G56A 4M36A 5IU6A 4NRDA 4X1IA 4QL3A 5TVKA 5LPNA 1NBAA 2DFDA 2XNKA 1G2PA 2CNBA 2HWKA 5A7HA 4JOCA 4JP8A 3MJRA 2WIFA 3PUWA 3ZBQA 4BNKA 4JR0A 3B9PA 4TTIA 2IHJA 3PC2A 2FPMA 4MV0A 5ISMA 2DC1A 2FX2A 3JPYA 4WERA 1X7HA 3L7CA 3SJUA 2V0CA 1LF5A 4BTEA 4PGGA 3UYLA 1QGDA 2A9VA 4GH5A 1XNQB 3HY4A 5BR4A 4RY2A 1TCVA 4TV8A 4PZ9A 1MKYA 2OXIA 3CLSC 4RKYA 5AVYA 1SUFA 4OQMA 3Q3IA 4LISA 2ZBPA 1INLA 4M1OA 1EAYA 4W5QA 2Y1GA 5DHRA 3S1AA 4R4JA 4F56A 2TMDA 2FRVA 4L5BA 1P39A 3MYRA 1D2CA 1KR2A 1JIKA 2FUG6 2JHAA 3MTIA 4H1HA 3K0FB 4UPDA 3UK2A 4IHJB 3TZBA 4BBJA 2JAOA 4LJ8A 1E9BA 2OB1A 2IIPA 2G9ZA 3K6KA 2H0AA 3RWBA 2JLYA 3T7TA 3TK1A 3NOVA 4M1SA 3EX7C 2QN7A 2YL2A 1KI9A 2J09A 3GLGB 2M6LA 1XRQA 5I9TA 1CSEE 1IM5A 2IZ0A 3HXMA 4ZFNA 1ULSA 2JA2A 2QPTA 4X7BA 1HLPA 2WD8A 3H0CA 1Q2UA 1WB5A 1KMMA 1GPLA 1IDOA 4PSDA 3W8DA 4D0RA 4Z2AA 1FFWA 1YGPA 2QG4A 3R9XA 2CWWA 4Q93A 2FP4B 4GHWA 4IZIA 1D6SA 4DIBA 4J91A 2NADA 3D6MA 2X5KO 2VPWA 4MRMB 3KO8A 1T8TA 1IWAB 1CW2B 1HKHA 2GBLC 3HHEA 3K96A 3I05A 1G19A 4XM0A 4BPRA 4NBSA 2QRUA 2OUIA 1KARA 1PJCA 4BKRA 4AIIA 5JSKA 4Z7QB 1BWQA 4XLTA 3Q6IA 4GX2A 2OD7A 3WDMA 4GKBA 5C1IA 4LSZA 3TVYA 4KV7A 4P7JA 1UMBA 4HDSB 1NXWA 2FPIB 4PRZA 1V8PA 3GUYA 3FSRA 3NLLA 4MUEA 4XI9A 3V97A 2Q4TA 4ZOLF 2PUDA 4H59A 3KG2A 2G1JA 3WX0A 3FJ1A 1QHNA 5IP5A 3CRZA 1TRKA 2BFCB 4OHXA 2A5GA 5B4UA 1NN0A 1UCFA 1P5JA 1TKAA 3G89A 3I23A 3OD1A 2EQ5A 3I1FA 3P27A 4RWEA 3S0JA 2HFJA 4WFIA 4NNPA 5MN4A 4DR5B 1AHPA 1IB6A 4IJUA 3ZCUA 3SWWA 5H8WA 1UFQA 3W05A 1A69A 3BAZA 3K92A 3VYTB 2RHHA 3SSAA 3G2NA 2ZCVA 1TXGA 2XWBF 4RO0A 1A7UA 3LDGA 5EINA 4DDHA 2I4TA 3FWZA 4EYSA 5JMPA 1XPOA 3NTXA 3EH1A 3BRCA 3C8UA 3LVFO 4DV3B 3HO1A 3DT8A 3OLXA 2J6BA 4ZI7F 1H6AA 3AKZA 1JPJA 2W9XA 3G2LA 1Z68A 2ZRNA 1R15A 4HSGA 2QAGB 2GA9A 4Q7LA 4I6JA 5A71A 2DHEA 2H3HA 3THXB 2CFSA 3UWKA 1KZ9A 4D3ZA 2B7BA 1G20E 3MCZA 4WZBE 1J25A 2Y92A 2AE1A 2ECQA 5K8TA 1CJKC 1T24A 2J8ZA 1XZEA 5F5LA 4KN5A 1VYVA 4G81A 4URUR 4BL5A 3RLIA 2JBHA 4NU0A 3T3GA 3BCRA 3I4LA 5CVUA 3AW8A 1YDGA 3ZJTA 2D5LA 1HT3A 1HMYA 4RLHA 3C5EA 2ZRAA 3VPHA 3NKFA 1AMUA 2ZTHA 4P2BA 4IW3B 2ENWA 2E4UA 3DVQX 3D7NA 3FVRA 2BD0A 3QW2A 4ESVA 1FLDA 1XPUA 1ZMBA 3WHIA 4PZDA 5EYPB 1GPKA 4AWBA 2VIIA 4AQDA 1QZUA 1DRKA 1QB7A 3D8RA 5K0EA 5T4BA 2OHXA 2AOUB 4Z49A 2BH2A 4F86A 1PR4A 2OBNA 2TMKA 1NHGA 3NONA 1CUSA 4YXWD 5LOVA 1E1YA 1J8FA 3HXLA 1BCSB 4N01A 2UYOA 4HNHA 1PP4A 1T2CA 2Q2QA 4YMWA 4D57A 5BV1A 3EGDA 3KLOA 3ZGXA 3RH0A 3ZE9A 3OZ7A 3JATB 3I9OA 4WBNF 1A97A 5K4AA 5DGCA 3UHPA 3B1ZA 4AULA 5JYCA 3V8VA 4PXSA 1JA1A 2GPNA 3E7DA 4V0RA 5IVKA 1DEXA 3L0PA 4ZT2A 2VSFA 4DV5B 4WT7A 1SU8A 1R4MB 1PV1A 4MV9A 5BSMA 2P8JA 4MPRA 3SFZA 1SKMA 3KAPA 3KJZA 2H1OA 1O54A 1IQPA 1G9SA 4NS1A 2PJRA 1MC1A 3TXYA 2WF9A 2X9QA 5DBEX 1NQVA 2D1SA 3E5NA 3GRZA 3IB3A 1AS2A 4X8LA 3PUVA 4EPVA 5CIQA 3IOEA 3STUA 3QPVA 4ZIRA 3A3KA 3FYTA 3CVOA 1LLDA 2R7KA 4IIJB 4UUAA 4EKIA 3EQZA 3KK0A 1AA6A 4QJ4A 1BJTA 5DSTA 1A4RA 1ZDMA 2CF5A 5BSTA 3NATA 1KVUA 1P2DA 3IP1A 3SHQA 4YWHA 5KX5A 1KY4A 1NNUA 2CB9A 2REXB 4FJ0A 4G8DA 4JODA 4QXPA 3OFKA 5DNCA 3HVRA 4DDWA 2C0QA 1FNCA 2XCQA 2HU7A 2QN8A 3T3PB 1JA0A 1LTHR 1ZGHA 5CLLA 4YRNA 1WLSA 2LTAA 3C14C 2OGTA 2AOWA 5A5GA 1P4RA 3IT3A 5BSGA 5JSZA 1UPFA 1BN7A 1IPHA 1I30A 2CEAA 4Y2SA 3ZVRA 3P96A 3PQ2A 2PUTA 4KIUA 4ZP1A 3H9QA 4RTLA 3IIEA 2EW8A 4BO5A 3EAQA 4CKWA 8RUCI 2ACKA 3OLYA 2HMUA 2OB2A 3L4BA 4DJTA 4PLHA 1YR9A 1I3LA 1JKIA 3OIYA 3L1UA 4GPTA 3L0BA 3BB1A 4H6PA 4ZAFA 1EVKA 3DBHB 3OQNA 4TYWA 1XWWA 2CXSA 3UK6A 2XMBA 3I1JA 4FU0A 4RZUA 2NXCA 5EJFA 2QVLA 4DTCA 5K9ZA 1MX3A 2H7VA 4KTTE 1RXOC 1USKA 4L6AA 2V68I 3PWTA 5F2NA 5I7FA 5JEDA 1PF7E 3PWZA 5HNKA 4I81A 5C7IO 2VKTA 2V6IA 1ZJZA 2XGMA 3LQ2A 4DEVA 3I8XA 3FDZA 1MIHA 1QUFA 2GK7A 1ESMA 4LQCA 4QREA 1E2HA 3THOA 2BH9A 2R00C 3LHSA 4QNMA 1R7RA 4D9EA 4HJRA 5C8YA 2TECE 4BO0A 2HC9A 1XDBA 5C18A 3OY2A 1C0EA 1U7TA 2JGRA 5BPFA 1W2WB 3EZXA 4OP3A 4OQEA 3LFUA 1V16B 4WNAA 3RF6A 4B4UA 3UUFA 1ENOA 1UH5A 4I5EA 3FSEA 3NASA 2JHFA 3BMOA 3M83A 3OM9A 1CVRA 3JWHA 3WGQA 3FWNA 4D2IA 4C0HA 1TNDA 3CE6A 1PEAA 1ECBA 2ZW9A 5LL6P 4AQ7A 5DLYA 1F0KA 4PHFA 5D7BA 1LQTA 1M3SA 2ZJ4A 3Q3VA 4OM7A 3RHZA 3NG1A 1CTQA 3P2IA 2X4GA 3L0DA 1I6MA 3I2IA 3BFKA 4YXWA 4B8ZA 2OCPA 2EJCA 3KELA 2EX0A 2DF8A 3Q9NA 4M83A 2G77B 4EO4A 3RV4A 3ZNOA 3B52X 4R1UA 5B4VA 5KNCD 5IDQA 2QTCA 2PAAA 1OBFO 1GCUA 1JHDA 3D5QA 1OU4A 1X14A 3PPXA 4HKTA 5KTSA 1OWOA 4WKPA 3F5DA 2R44A 3IMFA 4HDMB 4MJXA 1PQPA 3OVMA 4HYQA 3PEUA 4ASUA 1E92A 1GYPA 1W2HA 4MJ7A 1ECFA 3QXJA 5KU1A 3R8CA 4O3MA 4CKCB 1C1XA 1C30B 1OX6A 3V2GA 2WZDA 4NQZA 4QDTA 3MTJA 4GZMA 3SE0A 2OHOA 3X1JA 4CKBB 4J7AA 4L5IA 3HRKA 4PZPA 1DO0A 4W63A 3UOGA 4HDNB 5JIBA 3E15A 3D0QA 4MVCA 4F1WA 4CCYA 1VA4A 4QPJC 2I1WA 2DERA 1EIZA 4L78A 4EB0A 2V6GA 4PU0A 1OI4A 4UU7A 3IP6A 3FETA 4FGKA 1DPGA 1MTOA 4HMOA 4XCXA 4O2BF 4C1NA 2GCOA 3E9ZA 3K0BA 4FN5A 4I9HA 3H1BA 1M2EA 3MJCA 4JV5B 2B34A 4L4ZA 1Z8NA 1PJZA 2WPDD 3IHWA 3L18A 4EF5A 3JALB 1EWKA 2W2OA 4BNZA 3PITA 3BPSA 5CVTA 3WTCA 4GICA 4YALA 3AHCA 5EXSA 2ZPTX 4JYAB 1AQJA 1RT9A 2B61A 2V6MA 2XGOA 4FOPA 4JUAA 4M0UA 5H3CA 4AX8A 4F1KA 3O8BA 4RV4A 3WAGA 4K40A 4UEJA 4TMKA 3ZHYA 1X74A 2Q6VA 3B38A 1KJNA 1MDBA 3FPAA 3KZCA 3PF8A 3AETB 4IJVA 5EJIA 4X6XA 2YH2A 3V4SA 2WIKA 1N36B 2FPXA 4HQ0A 3GJTA 3VV3A 3X1XA 3O8OB 1XJ0A 3NHPA 1AXEA 1MIOA 4JJAA 4KPGA 5JS6A 2GBIA 1QTIA 2N46A 1E8DA 2VK4A 4L8GA 1E5VA 4BB5A 5KYWB 2WIJA 4LF4B 3GCWA 2VWQA 4FFLA 2FNAA 4B3BA 1KETA 1UZLA 3M0EA 4MPDA 4K81B 4FZ5A 1D2GA 4X7RA 5FUMA 4EDFA 3Q2IA 3I04A 4LWOA 2XLBA 3V8NA 2I2CA 3JQBC 4LFCB 3TQTA 3X43A 1YJXA 4HVTA 3BOSA 2H0QA 2WF8A 1E6LA 2AYZA 2B4YA 3MCVA 2OD2A 2ZIGA 2WIAA 1QFXA 3ZK7A 2FG7C 4W82A 3U37A 4MVYA 2FPLA 4ARUA 3O1LA 1LPOA 2JIZD 1L7XA 3V3KA 4ZAXA 3HLKA 4IO1A 4W7IA 5E2AA 4I1OA 1G2QA 2XRMA 4YRSA 4MV4A 3FHJA 3GBVA 1BMTA 3AFIA 2GZHA 1O0BA 1BKSB 1P0MA 2UUOA 3UZUA 4B6GA 1C80A 5I8WA 2H16A 1BU8A 2HZBA 1U4OA 2JIDA 1F2TA 3OWHA 1V1RA 5LZ5A 2PLWA 4C6HA 1PCXA 1JG2A 1OVGA 2K5UA 2R7MA 3C1AA 4JROA 3TYXA 3DCYA 1UXOA 1FRZA 4Q9AA 3RVMA 4H35A 2VUUA 3N70A 2GLXA 4N76A 1AUQA 3DC2A 4NKRA 4A16A 4HUJA 3MJVA 1F14A 4LHZA 1GA1A 2R5NA 3GCDA 3FPBA 5KMGA 4ARBA 1WRBA 5KTRA 1F17A 4RJKA 2IUEA 3FROA 3HCFA 3K5WA 4RD4A 1CKEA 3SEFA 1ZW6A 3SPXA 4BKQA 5LXTF 2GCIA 4KBYA 4F38A 2R8RA 4LGVA 3I4CA 1E9FA 4UFNA 1MFZA 4UTXA 1MJGM 2BAGA 3ZK9A 5M5BA 4JI0B 1GG9A 3WGZA 2SICE 3F6SA 4PG5A 4AYXA 3QXGA 2HHCA 1BRTA 4DWVA 4U9UA 1P8AA 3KTAA 3HBNA 4Q48A 4WECA 5DHQA 3RCBA 1TZCA 1EFLA 5EIHA 6REQB 3JYLA 4ZMBA 4FNGA 5DW0A 3V46A 2QMEA 1WCXA 3PNLA 1WO8A 1P31A 1UC4B 2E3JA 5CFLA 2OTCA 1FXUA 4PSUA 1GM5A 1JT2A 2VXBA 1FS6A 5FJIA 4H3HB 4C0BA 2FW9A 2Z57A 2HF9A 3ZS8A 1ZQ1A 4LRTB 4MUGA 1D0IA 1QRTA 4MGIR 3U2QA 4J90A 2ZWVA 3CB4A 2Q6KA 1H0HA 1QSGA 2XMGA 3MBOA 2OV1A 5LP6A 3ONEA 4I5DA 3RS9A 4PWZA 2XNDD 3W2TA 4GPD1 4MS4A 1NDHA 3OZUA 1WSAA 1ZK1A 3DMNA 1ODTC 2DLDA 4L51A 3T3DA 4YWJA 2ADFA 3TQOA 3CRMA 2GAAA 2P90A 4ZOCA 4BO8A 4KOEC 1RQRA 1WZCA 2IBMA 1ANKA 5D86A 5E6RB 1RTTA 1CZRA 2FSVA 4KXFB 3GV0A 3HKCA 3HVIA 3I3SR 2B0CA 3OTHA 3P2KA 3QWFA 4L72A 4ER3A 3CVUA 2VDMB 2EGUA 4PLTA 3I0ZA 3QVOA 2P11A 3CONA 3P20A 4MW6A 1S6YA 1KEZA 2DUWA 2IE0A 3H84A 4I1RA 2AW3A 2HPVA 2A3RA 2HK9A 3R5HA 3RBAA 4B75A 2WKQA 5A03A 5A9RA 4D9GA 5I7VA 3NR2A 4KVZA 1E9EA 2FSHA 4QXAA 4S1PA 5AH0A 1LI7A 4PCUA 6PFKA 3DOOA 4Q34A 1I94B 1KYWA 4L8WB 1VHLA 5JZVA 4DDUA 4EUFA 2VPYA 1Z6AA 2QRZA 4YP7A 1DAIA 2DBVO 4F0HB 4XTCS 3CVWA 1NSTA 4TVBA 2O1XA 2J9YB 4ILEA 4PS0A 3ZHBA 2WUGA 1KRXA 2OLJA 1NVVQ 4G8CA 4N6NA 4JX9A 3K9NA 4M1QA 1T5BA 4OB8A 4CDNA 4KN6A 2A92A 2XQVA 2NTYC 4AMUA 1UDWA 3CBQA 4ZQEA 5F7JA 1RW4A 2R48A 3GEGA 3II6X 4J3NA 2VRWA 1NE7A 4JEIA 3ZI7A 1LU9A 2AC2A 2OZVA 2HMVA 3B1KA 4C4TA 4CQJA 2X22A 4R1NA 1ORTA 5HR5A 5JH7B 4AKIA 1PE0A 1DG1G 2Q0QA 3TLZA 1S2DA 4AZVA 4EKNB 1CR2A 1H2HA 2DXIA 4IRMA 4TYQA 2IDMA 2HRZA 3COSA 2GBPA 1MEJA 5DISB 4QGHA 3I72A 3WLIA 3X2SA 4ZGGA 1GG8A 1OAOA 1EBUA 3GJQA 4FW9A 1TL7C 3N5CA 1K7XB 5E3JA 3TLAA 5BPHA 5J4VA 2AR7A 1Z4NA 4AUKA 2RJOA 2O2IA 4L4RA 4TLMB 5CVDA 1I7QB 4CEIA 2ZB4A 2QLBA 3OJFA 3I9JA 3DD5A 4WV3A 4YUVA 1U7ZA 1NP7A 3DYVA 2ECOA 4LXHA 3AB7A 3PRYA 3Q9LA 2ZP1A 1WDDS 3BULA 2IW1A 1RWBA 4MMXB 1V1JA 5EIWA 1WUIS 3RIXA 4PF1A 4M1MA 1JDBB 3H13A 4DSZA 2X9GA 5AIAA 1A5ZA 1OFIA 3UOAB 1DWPA 1CY6A 1XNGA 2OXTA 3J7AC 3V4FA 5CA1F 1YASA 3PUZA 3QPDA 5J43A 1ZH4A 2W8ZA 4RQBA 4EF6A 2X8LA 1HZZC 4HR7A 3PF9A 4HRYA 2Q07A 4FK8A 5BMVB 2FZWA 1ZRHA 2E1PA 5BW4A 1EE1A 3KKEA 2O57A 2PWAA 1DAGA 1Y48E 1SK8A 1E7QA 2X2PA 1YKSA 1Y3HA 4NBRA 1BU5A 5F5NA 1J21A 1U0RA 1I14A 1L4BA 2AG0A 4JU8A 5CIWA 2W2QA 3PX7A 4G5YA 2B25A 3WZLA 5AIBA 1KP3A 4YNBA 2YC4C 1FC0A 2IZZA 3TLMA 5KCZA 3LDAA 4E1BA 4ERXA 4PGMA 4QVGA 2DX7A 4ZALA 1E2KA 4R0NA 1CG6A 2VUSA 3CB2A 3L0SA 3LA6A 2A5LA 4MKFA 4DRXB 1J90A 5J47A 3T41A 2ZYGA 4X5OA 1GKLA 2JGFA 1TYAE 1SD5A 2OM2A 1FS5A 1K98A 3CF4G 3EARA 2WF6A 3PA8A 1G2OA 4QGBA 3Q3JB 4JY7A 5IVDA 1ATZA 1LNQA 4C6TB 3C7CB 5IAKA 1U3DA 3MJTA 5L3VA 1O57A 1N2IA 1NA5A 2PZJA 1Z8DA 1N25A 2RB5A 4LHSA 4QU8A 5TF0A 4ZKDA 1XNJA 5BW8A 2YVKA 3MLAA 5ER9A 4KDRA 1Y1QA 3GMDA 3SKYA 3K70C 3SQWA 4KN8A 4XDYA 4C7MA 4YR9A 1AKWA 1NZDA 5AESA 1B0ZA 2PJUA 1WW8A 1XZMA 2WSLA 3DT9A 2NYAA 1DT5A 3D6NB 4LNHA 4W8HA 5K5EA 2HQBA 2R7AA 3LWDA 5EIFA 5LVAA 4F60A 3ZE6A 3CEHA 1ZOOA 2C77A 5CUQA 3N59A 4EKGA 4DR4B 2IBTA 1CHDA 3AR9A 3PQFA 1VL2A 3PNQA 1NJ5A 4CG1A 4WZAE 2F90A 1CZKA 1P29A 5EE0A 1JHQA 2X19A 3JQFC 5K0NA 1BDJA 2A84A 4X3OA 3HJCA 5BYBA 5TVGA 1KDYA 5AVQA 2CJPA 1XU7A 2D1TA 3H42B 2KQUA 4O5AA 1YBAA 4MXDA 1FFXA 1D4AA 2CLOB 5G0VA 4EGFA 1E1LA 5HX7A 1R8SA 4ZYXA 5B7QA 2DQSA 4KXMA 1FBTA 2BZSA 3VO1A 4OSPA 2IUTA 1Q1BA 1W44A 1VIMA 2OSVA 3AGQA 3LK6A 4UMDA 3LUGA 4FE3A 1IPFA 3LBYA 1NF8A 3ZYZA 4IXMA 4QYIA 2WM2A 5IARA 3RREA 3RVRA 5C8DA 4PLCA 4D4GA 1Y42X 4FYMA 4WXMA 4U2DA 3T0FA 3DO6A 5KVAA 1GAJA 4Q9NA 5DNYB 4OHPA 1R5BA 2LDBA 4IHAA 1AD2A 4FYPA 2VZEA 4BQIA 3QUAA 2WYIA 5BR1A 5M04A 1N33B 3ENVA 1KEKA 4FJ1A 4X1YA 1CZLA 2YV2A 3B6KA 3I6MA 3IE2A 4P22A 3F4KA 1IWBB 3ZY4A 4KH0A 4BFZA 2W93A 2QB5A 3QLTA 2LE0A 4IFTA 4JB8A 4J9UE 2W6IA 3N58A 3HB7A 4JEMA 1F1JA 1MB3A 3G7SA 3ANLA 3THWA 1ML3A 1Z4OA 3FBTA 1KSJA 4C4AA 5J5AA 3U61B 4ZODA 4MQUA 5T6BA 3TIVA 4BO4A 3DL7A 2IYFA 1ZA2A 2VWHA 2WFAA 4BNTA 3H4TA 5HJ2A 3G0BA 4GVPA 2FPGA 3CX8A 3HB1A 4J2HA 1E58A 3W8EA 2KMLA 1YU9A 2C99A 2HTFA 2YWBA 4PY2A 1PRYA 3NRCA 4GL4A 1YS1X 4RFSA 4EA6A 1GT91 3AUYA 7GPBA 1EK6A 2NO6A 1ATIA 1CE8A 2PV7A 3EUWA 3M6IA 3OF2A 3WHKA 1RMYA 2BHLA 2C4HA 4BQSA 1PVOA 1OXXK 4G8JA 1VHWA 2EZ8A 1FVHA 3REOA 1L6RA 2V59A 5F64A 2EF0A 1KXZA 4NP6A 1FXWA 5CT6A 1OY1A 2QRNA 4OGKA 3W4KA 5TRTA 2IYTA 5ALLA 1LPSA 4F4FA 4XVRA 4FI3F 2GN1A 2C0CA 2JJQA 3FZQA 4R8MA 1GNRA 1X7ZB 5I7WA 5FOTA 4PE5B 5AVSA 4P0PB 1TD9A 1HNNA 4HQFA 2ZBUA 1A50B 1LK0A 2P6PA 3FXAA 4O4IB 4E3WA 2MR5A 2Z95A 2AXEA 3DO5A 1XLVA 3GH1A 1SG0A 1V5EA 2P2NA 4R3NA 5IYZB 1QP0A 4Z53A 1NFFA 4KR3A 1PYOA 5EFOA 3H5IA 2G07A 4WEOA 2XKAA 1NDQA 4TKUB 1PW5A 5J2TA 1XQYA 1P6QA 1YVPA 1NNSA 1TJYA 4ND4A 4LI0A 3ED1A 4BIIA 4P33A 1KEWA 2XA9A 4Q3AA 3O91A 4UMEA 4YDHB 3CLRC 1L3IA 5I7EA 1N1EA 1NXTA 3F1KA 5IAAA 2ZJOA 3TQFA 3X1WA 1QGUA 2QTBA 2DH5A 4K8OA 4ZYZA 4ZAYA 1MV8A 1P61B 2Q9BA 2VDNB 4NZZA 3CCCA 5C31A 3TFWA 4QBTA 4P5PA 1TUGA 5JMTA 2XB2A 1T1SA 3ZCTA 1DQNA 4MVJE 2XMDA 3K0KA 5J59A 3PXXA 4IINA 2X4IA 3OPMA 1G5PA 4LYGA 1M74A 1TT5B 3PIRA 2OFPA 1SNYA 1KC3A 1FMLA 1VHQA 2YY7A 3IPRA 4LA4A 4FGZA 5IRCD 1BYUA 1XFDA 3GJ7A 4OXKA 3BK1A 1Q84A 3W7AA 1WVMA 4FFBB 1L7AA 3F9CA 5EXEA 4B3GA 4AN4A 1P0CA 4RM2A 4CF6A 3WB1A 1EXMA 1F48A 2FSVC 2GD1O 3LUDA 2Z4RA 4UAVA 5LUAA 4D4JA 1B2LA 1BTOA 4GM1A 1LLUA 5LUBA 2XKJE 4G0PA 5AW5A 1HG1A 3RG8A 1UJBA 1SAYA 1GPAA 3AIOA 4EFDA 3WGYA 3PGLA 4ALKA 4EP1A 2BGWA 4PGAA 4WPGA 1EFVB 2QRGA 3HP7A 1JEQA 4H0CA 4CCSA 5F21A 2F00A 4HTFA 2Z5FA 3BGDA 4M37A 3V4LA 2YFKA 3D3NA 3QLVA 2VDWB 2A8YA 3Q88A 1L3CA 4IZ6A 2XCLA 3GJXC 5I6DA 1Q0HA 4R0MA 1DJPA 4HV4A 1I0LA 4R8KA 4BRSA 3DEIA 5L3ZA 2DUNA 3M6UA 2GZ2A 5TMDA 4UTVA 2IP1A 4OB7A 4UZSA 4ZREA 2Q46A 4FMPA 5PNTA 4ZO9A 2HLHA 4FYHA 3ZH2A 4KE6A 1UPTA 3VAZA 3GPIA 2B3TA 1JHMA 2IP2A 1OMOA 1T6XA 2DQKA 1TVMA 4MQEB 4R1MA 2P9HA 4B84A 3B3AA 4D42A 4O4LF 5FPKA 3QLJA 3VJRA 1CLEA 3ADOA 1T29A 1KL7A 4IMJB 4RH0A 2TSYB 2ZATA 4DXHA 4N7JA 3G79A 4KNVA 3M3HA 3FWYA 4U0JA 1IDN1 3RC3A 2H8GA 4GSLA 3JAKA 5ECWA 3VMMA 1FJXA 1P5ZB 3NGMA 4RD0A 3V7YA 4NZMA 1E2MA 2XUQA 4DEXA 2ODBA 2DPHA 1BVRA 1UBUS 2ES4A 1MO2A 2Y1LA 1OAOC 3QXXA 1YUBA 2J87A 5AK4A 3U6KA 1QU2A 2ZJYA 3H7AA 4WSOA 3IPXA 1LC3A 1UAGA 1FA9A 3G6KA 1UBSB 3OU7A 4PRKA 1L3BA 4CLOB 5F5XA 2AKAB 5HKAA 3G88A 1RCXC 1GL7A 1OVMA 1UFRA 3LRTA 4P6VF 1QIJA 4Q1EA 1YC2A 5HDBB 4DKJA 3HCCA 5JXJA 3E7XA 3K31A 1KI6A 3V1YA 1RD4A 4M7OA 1YR7A 2CJYA 2C04A 4MEAA 1K1EA 4ZZIA 1JG7A 4IFIA 3GT7A 1L8LA 2I5PO 4GPBA 1OZAA 1PJQA 4MMYB 1BXRA 3KM0A 2QD4A 1GXSB 5DCWA 4OA5A 5E7QA 1P80A 4RPGA 2X0JA 2X0KA 4J0HA 4H7HA 1EP2B 3ODGA 2ODNA 1VJ1A 4DLLA 3GLKA 3CIOA 3KEGA 3BS4A 1HO3A 3EZFA 1EVYA 2WJHA 4QDZA 1TQ2A 1C4KA 3A9CA 1H2WA 4XR4A 3N6XA 3BRWD 3OX2A 1FUUA 1OF1A 2V7TA 4LTDA 2IEYA 3ZTWA 4C76A 2OAQ1 1P1BA 3GLIE 1ZUIA 2JLBA 3AILA 4S2EA 1XA4A 4EAAA 5FBHA 3W4IA 4X94A 4AP5A 3MTAA 4FNOA 4H4EA 3RU7A 3TBHA 3KHKA 1C1YA 2GO7A 2K7FA 4L50A 1D5WA 2YXLA 5C7YA 4PCVA 1ADYA 4NYJQ 2XRZA 3K4PA 1GD1O 1VCIA 1JJ7A 1CDEA 4RJIA 4X1IB 3GFVA 4JGBA 4BRWA 1UMDA 1LDGA 5FHQA 1NNEA 1UXHA 1USIA 3MAGA 3N3BC 5U1PA 4LMBA 5BO5A 5GM1A 3W9SA 1Q77A 1UBKS 1DWQA 4N7RA 3SI7A 1CC1S 5HYVA 3U4QA 1NASA 3NCTA 2AMYA 3WISA 5HJ5A 3P2YA 1D0SA 4HAZA 3RYCA 1E59A 4GEKA 3WK6A 5AUNB 3BHNA 1ONBA 5KWJA 4Q7MB 3TI7A 4Q03A 2PFKA 5IWAB 1W5SA 3PZBA 1S01A 2Z2JA 3N8NA 3SLRA 4TV8B 3ZV6A 2CMFA 1YS4A 3VXKA 2GESA 3M89A 5F1KA 3NTLA 3RUBS 5L6LB 2O1EA 1YULA 4WDQA 1TCCA 4MGYR 3SGLA 4YAGA 3JYHA 4PSVA 4QFDA 2ID7A 4D8XA 2GKSA 1QYXA 3ZWXA 4QWMA 5D8DA 4N5DA 4ESEA 1W35A 2C4VA 2Q0HA 2VDVE 3DO8A 4M7WA 2ZSUA 2C7PA 3RI3A 3HK2A 4MLPA 2W8BA 1AUXA 4C14A 1F60A 3KHUA 3MBIA 1SQGA 3AI7A 3MOSA 2NM0A 4YROA 1T8YA 2CLFB 3IT2A 3K9GA 3AQIA 3PFHA 4WFQA 1TO2E 2R1TB 4JVOA 1ZGCA 2ZJ2A 1N4DA 3NKLA 5HUQA 1S8AA 2QOEA 2WDPA 2JIPA 1CQIA 5HBRA 1HL3A 4H4DA 3BDVA 4CN9A 2CEKA 4EYQA 1V47A 4KYIB 5E4FA 1M0TA 1YK1A 1BE8A 3GLUA 4NBUA 2FWAA 1FXSA 1XALA 3EGWA 1A88A 1M2HA 4L3VA 4PYQA 4AS1A 4BP1A 1RJFA 1Z7EA 4BFSA 3HJGA 2WLTA 1C41A 3K8ZA 4EW1A 4K6HA 4IEEA 4Q4CA 3H8WA 5A4KA 3RSOA 4C7BA 4QPDA 2VUIB 1U0GA 2DZDA 5LA6A 1FP7A 2VCEA 2CDBA 2Q7XA 3ZTTA 2YJGA 3EXEB 4B6QA 3WAJA 2L17A 3CZ5A 1P19A 1MLDA 1UMBB 4HNAA 3I9LA 5KTOA 1JIQA 4KQHA 4Z1MA 1PZFA 2EZ9A 2UUPA 3ZVLA 4F12A 2PBLA 2P3SA 2H54A 3B89A 5FEMA 4HQ6A 2E6KA 4YCDA 3CF6R 1QCZA 1ZI8A 2NZXA 4GX1A 1VSUA 3TDKA 3KZKA 1YBFA 1VLHA 5ALMA 3QUSA 2JBAB 1GZSA 2QTFA 1Q91A 1FJGB 1U0NA 2WYWA 2RK3A 3NTVA 3NTUA 1SVUA 2FGKA 4L6CA 3B1VA 4NQRA 5AKLA 1QQBA 3CLSD 4JZKA 4P38A 3IFSA 4AO8A 3UFXB 2PGAA 1KP2A 4IDAA 2RAVA 2YY5A 3G6WA 1Y1LA 2G1AA 3G0IA 4XGKA 5CM2Z 1V9CA 4BJHB 1H5QA 2Q4EA 3MVEA 5HDQA 4EYOA 1PHRA 2IRWA 4PN3A 4IOMA 5DYWA 1U90A 1ZOLA 4NOKA 3M4XA 4OFXA 4AF6A 4CF4A 4UVIA 5GIOE 4AWXA 1SZCA 5FR2A 4KRYA 2WINI 4DJ5X 5C32A 1TU0A 4UDYX 3RQIA 1W36D 1CEEA 3LYUA 3U3OA 3WSVA 3IUQA 4WNIA 3IVXA 2FRXA 1AGPA 2ODPA 4UXHA 1RVDA 1DXYA 2C4NA 3LBAA 4ENPA 3EPKA 1OAAA 1ISJA 2D62A 5DHPA 1SEVA 3CUVA 2D13A 3BD6A 2E4VA 4RHUA 4XZ3A 1U7DA 1KAGA 3QLUC 2YOGA 3VR4A 5GONB 3TLXA 4D8WA 4OLBA