5DM60

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
224
structure length
224
Chain Sequence
KRYRALEGKVDRNKQYSIDEAAALVKELATAKFDETVEVHFRLGIDPRKSDQNVRGTVALPHGTGRSVRVAVITKGENVQAAEAAGADVVGSDELIERIAGGFMDFDAVVATPDMMAQIGQKLARLLGPRGLLPNPKSGTVGADVAGMVRGLKAGRIEFRNDKTGVVHAPIGKASFESGNLSANYQALISALEGAKPGTAKGVFLRSAYLTTTMGPSIPLALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 5dm6001
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dm6002
4DFCB 5DM70 1ZHOA 3QOYA 4QG3A 2HW8A 4REOA 1DWUA 4QVIA 3UMYA 5DM60 3TG8A 1AD2A 3FPNA 4F9TA 4QGBA 3ZQJA 3U56A 1U63A 1I2AA 4LQ4A 3U4MA 1CJSA 1MZPA
chains in the Genus database with same CATH superfamily
2VEOA 1NNUA 1OROA 2VNAA 3ESXA 2QD3A 2WA2A 1E2DA 5H70A 1EG7A 1ULAA 2H06A 3TM5A 2ZPTX 2HCRA 4OBBA 1TUIA 2F8MA 2BMDA 2QTHA 1IY8A 2D54A 1DFIA 4TTQA 5DIFA 3DVRX 1MIHA 1WZUA 1P9WA 3DEIA 2P9EA 3T38A 1SKQA 3H8WA 4RCVA 3U1TA 3UAZA 3FAKA 2JL1A 1E1QA 5E4FA 4CEHB 1JXMA 2ZUUA 3Q11A 1ZK4A 1BKYA 3HKBA 5EXPA 421PA 4PSUA 2PWAA 3SQXA 4RK1A 2ZR8A 4EWLA 2IOFK 2VJDA 1WG8A 2IH5A 4JJEA 4NENA 3L2OB 5C8VA 5EVCA 4NBWA 4J94A 4P93A 1RE1A 4AC9A 5K3SA 2JJYA 1DDGA 3QI7A 2EW1A 4LFCB 3AVXA 5ILOA 1WUJS 4D4MA 1E8NA 1JPUA 1TJ5A 2QX7A 3E22B 2PKEA 1Q0RA 4Y6RA 1DTSA 4HAWA 4YS6A 1QDLB 1H8HA 3QEMA 5I9MA 1H9BA 1YR7A 4ACBA 5LXTA 5FFNA 2XH8A 4DY6A 2NPFA 5KBYA 5CITA 4O2LA 1ZPDA 2I3BA 4GMGA 3R7SA 4RTSA 2GAFA 4JUFA 2AFHA 4EX6A 5HVNA 5JW6A 4I81A 4WOCA 4XLTA 2E9SA 2NVOA 1B00A 3T9AA 2EF0A 5A5VA 2GCGA 1RXOC 1V11A 2YFKA 1BG6A 3EF3A 4MYHA 1JZSA 4P6VF 4XW2A 5EP4A 4YUVA 2BWJA 3SBXA 4ZOBA 1T1RA 3ONNA 4BJHB 1X74A 1QFSA 2IXAA 3EMVA 3EVBA 2DR3A 5HJ2A 4E94A 5AVVA 4ZTUB 5H59A 1P3Y1 1BEUB 2JGEA 1HYGA 1QP0A 3RVOA 1DC8A 3CVWA 1QZUA 1G6Q1 2GM4A 2RGAA 3ZY3A 3DWEX 4Y2UA 2ZP1A 5A05A 1CX9B 1R0BA 1DKQA 1UZAA 3I76A 4JP2A 4OX9B 1RXSA 2DCMA 2WJ3A 1B16A 4HHHS 1F2TA 2CYAA 2GUGA 2ZEJA 3B5JA 1O9BA 2BFBB 3KPJA 1JR3A 3KT8A 3LT5A 3N0VA 1DOZA 1J2TA 4MLDA 4RVOA 5ETJA 3V3TA 4LQ4A 1FQJA 1ZGGA 3U09A 2ZK7A 4DBZA 2VNHA 4M55A 1VRWA 2BEWA 4FHEA 4ZOLF 5FF9A 2ORYA 5ADVA 3HRKA 1DRWA 2O1EA 3QF4A 4CNBA 4ZVSA 3IBSA 1J5XA 4YRTA 2EDAA 2IHKA 3LX6A 3QX8A 5KAMA 4I4IA 2HADA 3JQ9C 4QXAA 1X19A 4DRXB 4B8ZA 5H16A 1RCOC 4HDMA 1XZQA 2AW5A 1KU0A 3IVXA 3KR2A 4M9CA 3CVJA 3NJ4A 1GOTA 3AY0A 4B2LA 2BHLA 2C92A 4ZI2A 4G23A 4Z6KA 3OESA 4Z9BA 1AS0A 2HEGA 1QK4A 4XYLA 1XRNA 4G4JA 4HGOA 1HFJA 5HBRA 2JI8A 3RHTA 4UBJA 5CDHA 3M34A 1YDGA 3UXYA 2GDZA 2GXQA 5HCNA 4PG7A 2OXTA 3ND7A 1AN0A 1CY4A 4A03A 4YYZA 1VJ0A 4YRGA 1RI3A 1HSOA 1WZEA 3VNSA 1QNFA 1I3LA 1U3WA 3HU3A 4QICA 4AB1A 4EMTA 4R2HA 2VNJA 3FSJX 5DPMA 4JUAA 4LPSA 3WQQA 4ENSA 3HGQA 4PSVA 3TDKA 3P1JA 4RTPA 3R3VA 3VM6A 3ITDA 2HRBA 4HGPA 4B8WA 4QU9A 4BQSA 4HNTA 5ICCA 1UOQA 1VKHA 1BO6A 1G2PA 3H3JA 1NMZA 4GOXA 1DIHA 4C14A 2X7JA 3KOOA 4PHFA 5D87A 2K2QB 4R54A 3D6VA 4IGAA 3H5TA 2X7XA 1F6DA 5J40A 1LX7A 1SCUB 1Y4SA 3GH1A 4XEUA 1XP5A 1FTNA 1VKJA 2XOKA 1JN0A 4IHJA 4RTJA 3PCTA 4RU1A 3KYIB 2B8JA 2QGFA 5GONA 4O6VA 4P7BA 3NV9A 4QBGB 4QQKA 1GNLA 2HQRA 3WDSA 1MGPA 3DKKA 4B17A 5C3UA 5L4SA 3KETA 4HQFA 1SXJE 2OD7A 5AMXA 5EIAA 2Y9PB 1LSSA 2J32A 3G68A 4UMDA 2R60A 5BQ5A 2XUAA 4X90A 4ZHQB 2P1DA 2BTOA 4JUIA 1ZOIA 3PR2B 1Z5PA 1T2FA 1PFYA 1V6AA 2FVXA 2HA6A 1S8OA 1J2RA 1D6JA 2XAUA 3OEED 4OB8A 16PKA 2AXNA 4DLWA 1LTKA 4V1CA 3I4FA 3QOFA 4BAGA 3A31A 3A11A 1USVA 4FOTA 3BSSA 5KOIA 1GPJA 1UC8A 1YMQA 2ZYWX 4RFSB 3BKWA 4N5NA 5EE9A 3D3JA 2Y67A 1C9KA 1X77A 4RA6A 3SKVA 4ZCIA 1GTRA 1D0IA 3ZCPA 2DRIA 4YAOA 4NJMB 5CRIA 1GXSA 1FFCA 1NW4A 1JJBA 1ESEA 5BO5A 3LU1A 5EOVA 1P7PA 3FYTA 3DDOA 3F6RA 1JYEA 2FSSA 2DKOA 2OGTA 3RS5A 3THSA 3B70A 5H02A 1NLFA 5JSHA 3KAQA 4KAXA 4RF3A 2W2KB 9LDTA 1YZYA 2LVBA 1U5CA 2RK6A 5FHRA 1NX9A 4PYMA 1ZH2A 4IZOA 1G5FA 5FPKA 3BPSA 5F9MA 3B8HA 4XRRA 1RYMA 4EI8A 3D6NB 3AM4A 4OATA 4V3BA 4BVHA 3O93A 4EGQA 1AXRA 2WHPA 4ZWNA 3JZFA 5FD8A 3DZFA 4KITB 4NU6A 4Q3EA 3E5HA 4IV5A 1E1DA 1P5JA 4MS3A 1XMSA 3RAPR 4XVUA 3KT0A 2ZW9A 2R5FA 2X22A 3CSDA 1BXGA 4ZQHA 1NJ6A 1BWRA 4FDUA 4J3FA 1M67A 4MWTA 4O1HA 1TM4E 2CNWD 4UBOA 4MARA 3E9CA 3QOXA 4GUDA 3DMGA 4EW3A 4F2GA 1YDMA 3GFRA 1F2UA 3EBLA 3IJ5A 3RH0A 3PC3A 1SXJB 4L22A 5GIOE 5AUPB 3LLMA 1K1EA 1GRRA 4EABA 1L8XA 1KZ7B 4PFQA 3PDIB 4EUEA 1KNXA 5HYVA 4Y6SA 4DCGA 4EJ2A 1SVWA 3THYA 3FIUA 3K9QO 4BCCA 3BJMA 1GLVA 2LXNA 3OQ1A 2W8BB 1UMKA 3AETA 2CJFA 4NIMA 1C14A 1OWNA 2GJ9A 5BV0A 2C42A 2MIIA 5SZHB 3KL2A 2OZLA 5CNKA 3FZNA 3VR5H 3HK2A 1UPFA 3FTCA 5HIMA 4DV6B 4LF9B 4MS4A 1YR9A 3IJRA 2ST1A 1V7QA 3D0RA 3QYJA 3HFSA 4Q3AA 4FR2A 2EC5A 1ISFA 1F17A 1KZYC 3PEFA 1XMJA 3Q3CA 4AS3A 3ELWA 1QK5A 3BMCB 1XWIA 1QS0B 1WPXA 2AN3A 3AHCA 3BRQA 2EFCB 4FNGA 5TT0A 1OJLA 3WYDA 2YYSA 3IMEA 2IIBA 1BFKA 4ROTA 2Z9DA 1M2VB 4N8EA 1Q7GA 4AXXA 2WYWA 3U4GA 3ZXWB 2WSSD 4XWGA 5LYJF 5U4XA 2AOTA 2FQ1A 5FAXA 3CEJA 3G2OA 2R86A 1VJDA 3NBZC 3VDXA 5HJ5A 4OXXA 1OIVA 3GLGE 1T6NA 1YB5A 2NXCA 2X19A 3GFQA 3BMQA 4MITA 4Q3CA 4UVIA 2XZOA 4GVPA 1X7XB 1QPBA 3GBVA 1KO4A 1EKXA 4R3WA 1DLIA 1SY7A 2ZTLA 4HATA 5DGIA 3UC5A 1Y1PA 3D1LA 4D3XA 4OF4A 4DT1B 4MAAA 3RSOA 1OFUX 2YXBA 3HR7A 1A8QA 1DXHA 3AERA 5FPHA 4DIDA 3GVXA 4PN7A 1RJDA 1U94A 4NZNA 1KORA 3K4PA 4WBXC 2QLNA 1TA4A 4DUPA 4GICA 2GILA 3RT7A 3V6MA 5EMJA 1Q7RA 1T5HX 2JBAB 2ZWMA 4JX8A 5BPHA 3NTRA 4R1MA 4KR7A 3SF0A 5ELLA 1BIFA 1QVVA 3SDZA 1WWKA 1BRTA 1K89A 3HCCA 2A78A 4JZYA 3RNLA 4KXQA 1XEXB 3ZU6A 1E2QA 2F7SA 1L4FA 2H2AA 2QXYA 4A92A 3G6KA 1C2TA 1EX6A 1DU4A 1UZNA 2B94A 5AO9A 1IWOA 1E1NA 4MMZB 4IBOA 1P6XA 1T0PA 2VF7A 3GMSA 3D2BA 5HA5A 4M8KA 4B44A 4CQMD 4EKYA 2GJ8A 3PUWA 1NI3A 4NEGA 1OXUA 2DQKA 3L5KA 3EXHB 3NTOA 4JOQA 4LTDA 3WSWA 4IFTA 2OYCA 3ROKA 5KSOA 1C3OB 2F3UA 1V5FA 1E18A 2IPXA 4KKVA 1TAQA 4BV2A 3LC0A 1LDBA 1QZTA 4G8BA 3TCXB 4NJEA 3U26A 1JHVA 4IJ5A 1UMBB 1YNOA 1WSWA 2ODQA 3ECSA 4QEKA 4R1PA 1L4LA 3E4DA 3EPRA 3PVZA 3NIGB 1N5LA 4O4HF 4E2WA 1S3IA 1O4VA 5KYUA 1PQWA 2J3JA 3F90A 4IDFA 1D5WA 1M7BA 4JJ6A 2FHZA 2Q0HA 3DJYA 3OUUA 4JLUA 1JA1A 3B53X 4F2WA 2ZJ0A 5JCJD 1MRNA 1PZEA 3IPXA 4JS0A 2X4IA 4AKHA 3TRFA 2NLOA 4Q7KA 2IYYA 3QMPA 3BSYA 5G4LA 2AZXA 4IO1A 2ZE6A 4WHMA 3H7AA 3X0DA 4LFBB 4B4UA 2A7QA 3SFTA 1DHTA 4RCYA 5IZ4A 3MS4A 4RZHA 1RAHA 4XOUA 1NVFA 3KTAA 3MUEA 1N33B 1HE8B 1NWHA 1PWHA 4RUKA 4J3JA 3GLGB 4R8VA 1KDVA 2Z2ZA 2RG1A 2RIRA 3RTCA 3ZE8A 1QOQB 5AOAA 5LBIA 1DWOA 1JG7A 4GT1A 5CB6A 1ZESA 4K6FA 3A06A 4P82A 3D6JA 1ZIXA 4HZIA 1ODJA 4LKOA 5IYZA 3N9IA 1H2EA 3E1KA 3H3XA 2XGGA 3NJRA 5E2AA 1FJXA 1BX3A 3AHDA 4FD2A 1HZJA 2AA3A 4RS3A 1D2AA 2NZXA 3DTTA 4QEDA 4KSCA 1WE2A 1ECPA 1Z7GA 2AR9A 2Z1DA 5DI9A 2ZB4A 5F2KA 5FOUA 3U7JA 3VHXA 4ZI3A 5E38A 5GOTA 1C1YA 2K7ZA 3TVTA 3LCMA 4QXPA 3TW8B 3FOAA 4EF4A 4K26A 1AJEA 3ICCA 2Q99A 1D8TA 1NBME 2RHWA 4FZ5A 2C2HA 3UWKA 5KNDA 5SYNA 5IM4A 3G89A 4NOMA 4BWGA 1KZ9A 5C8XA 4WZBA 5JQGF 5KYTA 3QW2A 2Z30A 1GPH1 2X9LA 2Q7OE 1W2GA 1ZP6A 5A0VA 1ACLA 4X54A 3UYKA 4ETIA 1M6HA 3PIRA 2OK8A 2FSFA 1JLRA 1LZLA 3IS3A 3WJ2A 1I6LA 1VCNA 1YA8A 3MBKA 5GINE 5KSYA 3WJ1A 1Y8CA 1AGPA 1YZUA 1TQ4A 2P75A 2OFOA 4MJ7A 1HWYA 3OQ6A 3PLRA 2C4VA 1RC1A 4IRMA 3TEFA 1OT3A 2PD6A 4UFOA 1QVZA 3GDWA 3HXKA 4QXRA 2IU4A 4ZOLB 1E2JA 3CLTD 1BEEA 1FYFA 3DTVD 3EYAA 3K8QA 2JGLA 2P0AA 5FPQA 3NYWA 2NZYA 5JD3A 4YRFA 3ZHBA 5KVCA 5DYIA 2X41A 1EVKA 3PWZA 1XCJA 3ND5A 4HS4A 3UJ3X 2XLBA 3PGLA 1FXSA 1D4OA 1BXRA 3LKBA 4MV9A 5CVCA 4QEZA 4ZN6A 5KTMA 1RRKA 3DZDA 4DCNA 3RFTA 2PAAA 3T1TA 3ZW9A 3NNNA 1NWCA 2GEFA 4PLVA 4AJ4A 3B9QA 3HGTA 4B82A 5C8YA 1UXOA 4HJRA 3WLHA 1M1ZA 5K03A 1CF4A 5CVEA 3SYNA 2JHGA 1A2OA 2B8EA 3STYA 1K88A 3H1EA 1JWLA 4GLOA 1HE2A 2CB9A 4Y2GA 3ASUA 3P0JA 2XA1A 2RHHA 3UCXA 1RXEA 4CMJA 2X0IA 3F8TA 1C50A 3VH1A 3NTVA 4JYPA 4N3AA 2KW5A 4X71A 4CF3A 4OM7A 1U5AA 3E8MA 4MV6A 1FVOA 1L5ZA 1K3TA 2HZBA 3G13A 3OPNA 3CEAA 1OGYA 2PMFA 1A50B 1VLZA 2QJOA 4C2BA 1BGWA 2WZBA 3AZOA 1U28A 5KTYA 4AQ7A 3K5HA 3F1LA 1Y3IA 1RWXA 1WZIA 1WLSA 2GNAA 4L3WA 5LU8A 3N2LA 1HLGA 2P68A 4F9GA 3DONA 2ZRBA 4UE2A 2ACWA 4JSRA 4MIOA 3OE5A 4BKMA 1JLLB 2O3JA 3BDAA 2F9LA 2IPLA 3WLSA 1KQNA 5LQUA 2WJHA 1V8FA 2F43A 3MMZA 1EWRA 3A4YA 3OEHD 4ILEA 1G8MA 3A3NA 1RS0A 2QNBA 2P4SA 2J5RA 2RGUA 4JK3A 3D1VA 3RDPA 4ABYA 4MUGA 2FMUA 4DEXA 3IP7A 3V1MA 4A2CA 4G24A 1D09A 4RJTA 2QV7A 3HCDA 2NU6B 4MZXA 4YMWA 3VV3A 4FM9A 3GLHE 3UCFA 1JLMA 3LDAA 1BYUA 2P4QA 4Q1FA 4QLOA 4YQEA 2GBLA 3GT3A 1YFZA 3U3RA 5IP5A 3UAWA 5AUOB 1LX6A 3QXJA 3VPFA 1ZN7A 4LYJA 1V4VA 2X4DA 3THXB 1EVJA 1E6EA 1DPGA 1NXOA 1QOPB 1YV9A 3AZPA 1QRRA 3H11B 3KNZA 5L3SB 3BXFA 3EIOA 3EQZA 1YR1A 3BFPA 3G2NA 3LFUA 4FMBB 1ZQ9A 3I83A 3SSAA 4BBPA 4E70A 2HA3A 4IJWA 3VNUA 4CF7A 3LX5A 4DQXA 1EM8B 5AK0A 3VX4A 1L1FA 4DLSA 4N7RA 3T7AA 2IYPA 3HRIA 3VC3A 2ZYRA 4LZNA 4RVHA 1I7QB 5DM70 2QV0A 2VQEB 2VO1A 2PMKA 1L5MA 2YS6A 3HZOA 4E03A 3GF4A 3LBFA 2CDNA 1Q7TA 4MUIA 5ELMA 3RASA 2JHAA 3DL4A 5CXQA 3E48A 1JFSA 1W2HA 3D3WA 2NGRA 1IK6A 4PAGA 3D3KA 1QDEA 3RUPA 3JARB 2JIZA 4R71A 4M7WA 3WWCA 3DB1A 3CKMA 5ILQA 3CH6A 2GHTA 4HYYA 3DOOA 1ECGA 3QEKA 2PGDA 5EKTA 3PICA 4P2GA 4EHNA 1XCGB 1XAIA 2QDXA 2VHCA 2AN1A 2GASA 2IYLD 2ZS9A 5EWLA 5IMBA 1N7GA 3ZWPA 4RJ2A 5EJ8A 5MFPA 5EGSA 1QCDA 3MRXA 3T1QA 4RGVA 5CX1B 4R3UC 3H99A 3STVA 2EKPA 3BYZA 2P69A 4MVJM 5KMGA 4W6QA 4S04A 3MT0A 4PAOA 4L15A 4JI3B 4CIBA 2GTIA 2VQFB 2CSXA 3FLAA 4JA2A 4RVCA 4RZQA 4B47A 4BDSA 2I6SA 5HQJA 4YROA 1NFRA 1ZS9A 4YJ2A 1QR2A 5HIAA 4P36A 3TOVA 3W3AH 4F4UA 2XMPA 3HCPA 4KTVE 4IJVA 4BQOA 3NUGA 2PMWB 3FWNA 5H83A 4MCIA 4YT2A 3F6BX 1K3FA 2POQX 5AOBA 3OQHA 3TRHA 1Z68A 4Z9FA 1KKUA 3PE3A 1SQGA 1QZXA 1F20A 1NM5C 4REQB 5D7BA 4BZZA 1ZXBA 3W4JA 5HW0A 2YR0A 4RHYA 2YIJA 2Y1XA 1AOXA 1SH7A 2M6KA 2KLHA 3T5AA 3GLHB 1JIIA 3COPA 3V8QA 1Y33E 4F5DA 3SLGA 4KZPA 4WDQA 2PRIA 1A95A 1Q3HA 5L4LA 4LJKA 4AIIA 1F3LA 3EUFA 3W04A 2VJYA 1QOZA 2PKQP 1GTMA 3FNRA 3QELA 3WWPA 4E5YA 1MX5A 2ZUSA 1CUBA 3VGPA 3NIWA 4NWIA 2WVHA 2NUAA 2E4UA 3B1FA 2ZT6A 3R3WA 1VL2A 1LV8A 2DLDA 3HKCA 4OAQA 5B5SA 1SR8A 3RJ5A 5HF5A 5J4VA 3L49A 1FA9A 2WWHA 3C5VA 1NQVA 1DTEA 2V6BA 1MGOA 2E4VA 3G9UA 4BGEA 4GPIB 2W43A 3NUZA 4LOAA 1TTPB 5HKBA 5LYJB 4HN2A 4LF6B 1JLKA 4X9XA 3TR0A 1WP4A 4FC6A 1EFKA 4KBFA 3BFXA 1I2MA 4GBED 2OWDA 5ALGA 4KJXA 4CKCA 2FRVA 3EODA 2CLIB 2CUTA 3BA1A 4GX5A 1B3RA 1NVWQ 4BNLA 2CDBA 2NN3C 5I7UA 1XQ9A 2PZJA 4UHFA 1EP2B 1UJMA 4JVLA 1EQAA 4K9KA 4EUFA 2Z43A 3QEBZ 1HM5A 1KYWA 3BQNB 4KWTA 5BRNA 3ND8A 1PE0A 3P2OA 1KQGA 3F2VA 4Q4JA 2P1ZA 2OA0A 2IDKA 1PAUA 3T7SA 1CUUA 1QG4A 2D0IA 2R68A 1FJHA 4XIGS 5F51A 4LY0A 1X42A 2XTMA 4C0LA 3R3HA 1CY0A 1YBFA 1EFVB 2W6OA 3CF6R 3AT1A 2CE7A 2NO6A 3DDSA 5G41A 3HCNA 3GLSA 3AI1A 4C06A 2QZPA 5CU7A 1N8KA 1C3JA 5LWHA 1Z56C 1QONA 2YZGA 2AL7A 3P4UA 3PKIA 4LTMA 5A3QA 2XKKA 1ZJ5A 4QNRA 3NXKA 4HPXB 2PSDA 3BWMA 1SPBS 1XXHB 3Q7RA 4J6EA 4NBRA 2AMVA 2PT5A 2DG2A 5IDVA 1BCRA 1I4LD 1LLFA 2LNDA 2QVZX 3B6IA 2G6BA 4H08A 2C5LA 4DSNA 1P9OA 1YQDA 2EQBA 2IEIA 1W1UA 3NEYA 4NVRA 3KJEA 1CRWG 2I7VA 1EHYA 2TECE 1OKKA 2RB5A 2SKEA 2YWFA 3I64A 4O4HB 3NTUA 4UBLA 1CUHA 4E32A 2OEPA 4S1NA 5I45A 5JD6A 1AKUA 1SUSA 2QORA 2NZ2A 3QKUA 4RXMA 3LRXA 4GR4A 4ZMBA 2D1FA 1IIBA 1NJ2A 1E64A 1PVVA 1XAJA 1ZIPA 4JASB 4TTPA 1KO8A 1XG5A 5C4MA 3EZFA 4NESA 5DCLA 1JTFA 3V1YA 3I5XA 1HLPA 1PYGA 4BTVA 4PCAA 1P1IA 2H51A 3EAGA 2H52A 3EQ6A 3ES9A 2DUNA 4M9SA 2AX3A 1EP9A 1QSGA 3TSYA 4BFZA 5LN1A 3HM2A 2UZIR 4DIBA 3IBYA 2XSZD 221PA 4ASUA 1HKUA 1KETA 1BE1A 1X6VA 3GJTA 3C8HA 3QLVC 3SY8A 1OXBB 3T5PA 1ZGHA 3PQ3A 1V48A 4JWTA 1SKUA 1T10A 2P8SA 4PGGA 4WLEA 4RK5A 3SM9A 4HNSA 2G70A 1Z4IA 2C4UA 2H9YA 3GIDA 1KJZA 1N75A 3RCBA 4M83A 4NHEA 4DLRA 2J5XA 2ZM6B 3L7KA 4X44A 4AJEA 1VL5A 2FPUA 2HGSA 1NY6A 3H97A 5I48A 1CB0A 4PM4A 5GGXA 4Z51A 4FW9A 2RGNA 4P3PA 4O08A 1CJSA 3GFGA 3KJNA 1KDZA 2ZUCA 3V34A 4HG2A 1GZ3A 1Z0FA 4BLSA 5DO9A 2Z8YM 4DNQA 2VQSA 1H4VB 1WPRA 2WTAA 3E35A 3AF6A 5KIAA 2XAAA 4KRFA 3PQDA 3NM5A 3BREA 4LDQA 8ADHA 2NP6A 1U0HC 1FFXA 2WY2D 5CLGA 4IKEA 4EY5A 1G8FA 1GSIA 5JQGB 1YC2A 3U17A 5D6NA 1N0VC 1CR2A 5CVVA 2GPSA 2O3UA 2NUTA 3TBFA 3ZJYA 5ARCA 5LJLA 3TXYA 4YJKA 4A27A 3PEWA 2O5RA 2JI6A 2B4RO 3OCCA 2JLVA 1E2EA 4F60A 1W0KD 1DL5A 4B85A 4D3YA 3TOSA 2QTCA 4WLOA 3S44A 2VYND 2JD1A 1GK8I 5ER6A 2AXEA 2D5BA 3FMVA 1KFJB 1XRMA 1MJFA 2JASA 3MJEA 3WLLA 1AVTA 5HS4A 3AM3A 5DU2A 2WKPA 3EXEB 2XTAA 3LRTA 1P62B 3V7UA 1E2HA 5H4HA 5I7SA 1N5JA 4UBNA 5GM2A 1L7RA 4CLOB 2QTVA 4QRIA 4BX9A 1U4OA 2ZIXB 3E23A 4URVR 3WLQA 3FCOA 4F6RA 3N2GB 1QLWA 3CLTC 3SXJA 2O7SA 2EZ8A 3ITKA 4ODIA 4UHBA 3DXYA 5AM5A 2QY6A 1Q19A 3NTQA 1MAHA 1QPGA 1S4QA 4CE6A 3RK0A 4X1OA 5FBKA 4GGMX 5KYWA 1I2AA 3AUXA 3GFOA 4JP8A 2QW1A 2X8JB 4TN5A 3VR2D 2QQEA 4FYYA 3ZV7A 1E3WB 1JHRA 2XF8A 1P3DA 2XMQA 3BXPA 1S8NA 3JCZA 4PYIA 4A26A 4L3OA 5AVXA 2VDRB 1H1LB 3ON5A 3P8ZA 2IXDA 4U9IS 4M1OA 1IAQA 1DJQA 1RVDA 3FNHA 3H0CA 3R6WA 4OB7A 5AYVA 2YIVX 2GK4A 3BORA 3MJCA 2WILA 3DLAA 2G7ZA 4YRZA 3FJYA 5M34A 2W7TA 1G9SA 2YVLA 1MOQA 1TVMA 2H31A 2I34A 4L78A 1XKLA 2ZANA 1JAXA 5BT9A 3VR6D 4CKZA 2HF8A 4OQEA 1RC8A 4QBKA 1QH9A 2DHDA 3KYCB 2JFYA 3P4XA 4BZXA 1U4SA 3B6EA 5AXCA 5C7IO 1B73A 1KJQA 3ESDA 4US1R 1VIYA 5B36A 3MMXA 1AS3A 3E5NA 3U4AA 1Z4OA 4ZGGA 4O0LA 3B51X 4OH1A 4CM1A 3HU5A 4YJDA 3W5CA 3ZX5A 4DADA 3SJAA 2VCHA 3QNUA 4BVJA 1T4BA 5JH7A 3A6PC 2JVKA 4Y6LA 3UMGA 4AYTA 1Y9DA 3GFTA 1NNI1 1JU4A 4CL2A 2WAYA 3MWLA 4DOMA 4XARA 4OKSA 5A4JA 3L18A 5TB5A 1Z12A 2PTHA 4UAUA 4MJ3A 1ZZEA 4YMHA 1H65A 2MSCB 3IALA 4Q1VA 3V5NA 4C3OB 2UV8A 3ZWVA 1F06A 5FBVB 4W9NA 3TLBA 4X6UA 1K0UA 3KVNA 2VI5A 4LKRA 5IDYA 4JI8B 1CV2A 3K0CC 2V97A 4CRWB 1E89A 3DBHB 5PNTA 3CWQA 3P9ZA 1KSGA 3QLEA 1EK6A 1R3DA 4ZZ2A 2Y99A 5A9TA 5SZJA 1Z4MA 2W70A 4E30A 1NTRA 2BUAA 5TQ0A 3U0VA 1ILEA 4ZVLA 2PJRA 2NQ8A 1C0PA 1S2MA 4QM7A 1MB9A 1MA0A 5B1DA 4D9BA 1BKDR 5ALXA 3H19A 4KU4A 4UNQA 2JGJA 2KHZA 5J9FA 3AUTA 4HNHA 4MVXA 3VTZA 4BFVA 1XZFA 1PP4A 4EUNA 4B3MB 4RIIA 3ZGNA 3F78A 3I73A 3ZWBA 1B1AA 3GNTA 4I5DA 1ZEMA 5JJCA 3TTTA 1IPEA 5E6UB 1DJPA 2HMTA 2Y27A 4DARA 3D4BA 5CUQA 1ESNA 1R7RA 3K8OE 4RX1A 3KVRA 1KMIY 1XTUA 2WWFA 2ZSIA 3AWIA 3VNQA 5JD5A 2R7MA 1E79A 1B7GO 1ZD3A 4RABA 1I24A 1UMCB 4IDAA 1V1JA 4H6XA 2B4YA 4QTXA 3VR4H 1KFCB 4N18A 2HT6A 1HDOA 4QJIA 4YX9A 2XX3A 3L8GA 5DXFA 1AMOA 3V2IA 3BEOA 5K0FA 3TKAA 2WIFA 1JEYA 4TQUS 3HDTA 1ORIA 4OHFA 2C5SA 5LYYA 3BICA 4QVKA 1NDHA 1LI4A 3I9MA 1QF9A 1UAAA 1DRKA 1K7FB 3GLKA 5HF6A 1FDVA 3PZBA 3UAGA 1JP7A 3AR9A 1UBLS 3Q9LA 4MV3A 4QTUB 3EDQA 2AEMA 3FTNA 4R40A 5BOVA 3KPWA 2ECFA 1Y8ZA 1EFAA 3RJZA 2P6MA 2WFAA 4ZHSA 1GPKA 4R1TA 5DRTA 3WB2A 5CDFE 2VDVE 4W7HA 3S5JA 2W2LA 4BLQA 3ED5A 1THGA 4HVTA 3TLYA 8ABPA 4YJHB 4GSLA 4I1UA 3BF7A 4MW2A 3G0IA 3O8CA 1DAPA 1ZM9A 3GA5A 3VOAA 1TMOA 1HMYA 3OPYI 4DYVA 3FVRA 3KQWA 3N5CA 5AM2A 5KHAA 1ZMOA 1LI5A 2WW8A 1GR0A 1G6KA 3ET5A 4BTLA 1JEDA 3O38A 4LE2A 1UZUA 1JV2B 1DAIA 5EINA 4HKTA 5JCZA 2VXBA 3SJBA 4B3SB 3NEAA 3AXSA 2XYHA 3IQHX 4M1MA 5HFAA 5CIYA 3M5DA 3QKIA 1LTQA 2ZZKA 3EYWA 3DTNA 4QBIA 1KZ1A 4GQAA 1GITA 1C4WA 4FQ7A 1P4JA 1QIDA 4ZQIA 1MTZA 2VPWA 4TMKA 3G6WA 3RS9A 3AL0C 4QVGA 2G5TA 3VHQA 3RAFC 2JBHA 4FTWA 2O07A 3NTLA 3K32A 4L9WA 4V0NA 4P4LA 3DW1X 4JLPA 2XF2A 5BN5B 4O4IA 2OCDA 3WK8A 1X94A 4CMGA 2B1RA 1RWPA 2QAGA 4MVWA 3U3MA 5EHNA 3AESB 3GK3A 3ZZ1A 4BU0A 3C7DB 1XEWX 1HDZA 1VGQA 2LDBA 3MTAA 1B15A 1XA0A 3RU3A 4B9EA 4E31A 3W90A 2G40A 1LPNA 4LZPA 4A0RA 3NDIA 3RRBA 4ES6A 1OPRA 2G9RA 2ZRMA 3K9GA 2X4LA 1TTQB 4LWPA 4DIFA 2K5UA 2I76A 2YFHA 3HI4A 2J9GA 1II8B 3PNYA 4KUHA 1I4EB 4P4SB 1ACMA 2IW1A 1JMKC 3JVIA 3W0LB 3Q0TA 3LBAA 4AU1A 4Y0NA 4BTEA 3GC6A 5J4KA 1L3IA 1JQBA 1QWSA 4A8JA 4XQEA 2ZSUA 1CUFA 1G8JA 1NP3A 2BGMA 3L0DA 4MB2A 2HJSA 4WK2B 3VKWA 4U2EA 5KINB 4RCZA 4M0DA 2JIMA 4E51A 4PBRA 4GPAA 4KOEC 5FOTA 2JFNA 3EZYA 3KLPX 1CE8A 3L6EA 3ILSA 3T95A 4I4CA 4QUGA 3GMIA 5F3WB 3AF1A 1D3AA 4OHRA 1EK5A 3AFNA 1SXHA 3U7FB 2Z04A 1YQTA 3QMMA 3RVKA 3F6YA 2JG3A 1SG9A 3DXXA 2XYPA 3MAAC 1T9DA 2WD9A 4NFYA 3MYYA 1W36C 1L5RA 2EJUA 1NLZA 2W6CX 1KBZA 2OECA 3HPRA 1P74A 1CR1A 2VDHI 4OO3A 2ZUWA 4GNKA 4QPJC 3FFBA 3VISA 4C7OB 4NCXA 4OYHA 3SZMA 1FDSA 1E7RA 4QTYA 7GPBA 4JP5A 4Z7NB 3ZK7A 2I6GA 1IXRC 4BPBA 3QEJA 1P4AA 1D4AA 2ZBUA 3H05A 1SBCA 4I46A 5GQSA 3SBOA 2FZGA 4AVYA 1HXHA 3IP3A 2H4HA 2X5JO 3D59A 4HLDA 2JPDA 3ITNA 4ROSA 4AAYA 3L9XA 4ECAA 1F8FA 2V5UA 1FTWA 3I8OA 5LZ5A 5D3QA 1U8UA 1AMNA 2Y6UA 4NYIQ 4YAJA 5JPCA 3FNQA 4F4HA 2ATCA 2WSYB 2O0LA 1GQQA 3A8TA 3PHGA 2PYDA 3DE1X 4D7AA 3HB5X 5HKAA 5JAIA 1N2HA 4PZEA 3WKAA 2YUIA 4WZAE 3DFKA 2BHRA 2WBLC 2Q7DA 1B6GA 3A4IA 3WDKA 4UNRA 1YOVB 2FUG6 3HB1A 4TROA 3CLKA 4BNGA 3DC7A 4JLJA 4CIAA 1EAYA 3QUSA 3JYPA 3S3TA 4Q00A 5CURA 1U3FA 1L5SA 2QZ9A 4BZQA 1FMTA 3EXG1 1EFRA 5GJWC 1S8AA 3L7CA 4XKJA 4Y9RA 5AHOA 1VCOA 2XT6A 4XTRA 5DNYB 3WQBA 2XCTB 1X7ZA 2J1LA 4QL3A 4GVXA 1UXJA 4Q03A 4ZARA 2PWPA 1XVAA 4G9GA 2H4ZA 4B71A 2IYFA 2YW9A 3OJCA 5AK3A 3ZYZA 2IUUA 1RKUA 3GBSA 5C81A 3MVEA 2FSIA 3TKLA 1A82A 4HHEA 4Q02A 4CTMA 4DR5B 3AYZB 1KP2A 1E4VA 1U8YA 4FUTA 5FLEX 2NX2A 3VYUB 3RIMA 4F4DA 4G86A 4O1MA 1HQCA 4ER7A 1IOWA 5T4EA 5LL6P 2GWRA 1ZZGA 1C80A 4LRQA 3WL3A 2C78A 4B5KA 3RC1A 2QUBA 2FUKA 3GT0A 3L6UA 2PZLA 1NXVA 3FWYA 4RH1A 1I9CA 2ZI6A 4A6PA 4D0GA 2HMWA 1UM9A 1GUBA 2QN2A 2DM6A 2ILVA 3LPMA 2A14A 4O63O 1UR5A 5HKOA 3RVQA 5SZKB 5AVYA 3OKPA 2NAPA 1X7WB 4P7FA 3A4MA 5THQA 2PGJA 5CG2A 3K9LA 1FFHA 2HOQA 4DTIA 5KNCA 2J30A 1JHUA 3TIXB 2VT3A 5L4NA 1IRXA 1U0TA 3K6SB 3WA7A 3MTDA 5DK4A 3AZQA 3FMGA 5DYTA 4OUKX 4L6IA 4L5JA 5TVKA 5BN4A 1YUNA 1RFLA 1FP2A 1YACA 2C88A 1A9OA 3FOBA 3FVQA 2AZDA 1WABA 4JGGA 1UPMC 1PZGA 2P0EA 2W6JD 3DE4X 2ZJBA 3T4UA 3UPDA 3D31A 3VJLA 3C1UA 3EUWA 2H4FA 3GGPA 2ANBA 1IN8A 5JSKA 3F6PA 4JCCA 3RYTC 1J9EA 1PQYA 4MUMA 1OILA 2FJUA 2B1GA 3C45A 3MCTA 3O26A 3UN1A 3QUQA 4ZTBA 2XNHA 4XJTA 1CEQA 4ARAA 2I87A 4BJ3A 1ZICA 3F1KA 4C5BA 4EYSA 4BFCA 4F7WA 3G9XA 2LUOA 2EATA 5TRTA 4EA9A 1J99A 1JLSA 1JNYA 1S96A 2CJPA 5TQ2A 5B1EA 1AUPA 1TYDE 2JIDA 5E3IA 4DR3B 1IBLB 1Z26A 3FN4A 2HLDD 1KVSA 2ZYIA 4RPCA 3ROQA 4D9JA 2VJNA 2A0WA 4K3UA 1N6OA 2ATIA 4Q19A 1SK8A 1M2EA 3N8DA 1KFBB 3ESRA 1JAYA 5IG2A 2GA9A 1WSAA 2JA2A 1CUGA 1WDTA 4H7IA 4JJKA 3S4YA 3VRHA 1MPTA 5CAEA 5ALIA 4D43A 1K9VF 2WV7A 1F7VA 1BDBA 1KDYA 4Y0AA 3FB1A 5HGXA 5JJLA 3P2EA 2DBVO 5TPWB 2XVXA 1VHLA 1FCJA 2OP0A 2J0UA 2REOA 4MW5A 3X3HA 2GTHA 4AO7A 5KYXB 4UEWA 4C07A 1W46A 1UKCA 3QXXA 2VAXA 3QVWA 3H9EO 1G9XA 1PGOA 3CUUA 3QE4A 3K9WA 1N1GA 1SWVA 3NIDB 3SIXA 5GADl 3MQFA 3OZ7A 3AF0A 4BGIA 1EVYA 3RIYA 4D9KA 3EFBA 1MH9A 3KCQA 1BYIA 3P4YA 4Q3LA 3LP8A 5L40A 1GU0A 4FFMA 4JBIA 4FGLA 1Z4NA 4JV5B 1JQ5A 1GYPA 2YNMD 5L7WA 3W5UA 3KELA 1HDXA 3AYXB 4QASA 4URZR 1QO7A 1RFGE 5JISA 2WG2A 4QDOA 1EJ6A 3TQRA 3M6WA 3HL0A 4OKNA 1UC9A 3G5MA 5H5JA 4KQMA 3MJRA 2I3AA 1SELA 1XHEA 5HZMA 2ZI7A 5EMLA 1WIWA 4DDWA 1JT9A 4ZQFA 4MQLA 4MR9A 1IZ0A 2C97A 2ZXFA 3QFRA 4K6GA 2NXJA 2RHJA 1E77A 2ZBVA 1P0IA 1BMTA 1YQ9A 4LVOA 5B3LA 3IPLA 3NORA 3SHVA 4BVLA 3LLCA 7AT1A 4ZCQA 1G66A 3FTFA 1DC5A 1JX6A 2A57A 2PSSA 3PC8A 1MV8A 5CHEA 1P77A 4LOLA 1SUIA 4MYSA 4QTTB 4Y30A 1NW9B 2YIDA 3QWBA 1ZCAA 1K5DA 3Q8WA 2PBFA 4F85A 2UXDB 1H6AA 1TT5A 4WUVA 3DZ8A 2X6RA 1XZNA 1E3SA 1WBBA 2EFJA 3OFSA 3TE6A 2PRYA 4E6PA 4KPYA 2DUMA 4JP1A 3LBHA 1XCLA 4YCDA 1TLFA 1H23A 3RYHA 4CN8A 4KYVA 3DMHA 3HO6A 2JLCA 1Z15A 2OYRA 4DJAA 1NE2A 1J39A 1VZ2A 3CF2A 1JKFA 3EIFA 5EKDA 4GS5A 5P8WA 3RD5A 2OXEA 3K9NA 2Y0CA 1PHPA 3PNVA 4MVJF 5ECDA 4UMFA 2AQIA 2ZGVA 4JH0A 3OZTA 1PJLA 1TQDA 5HDQA 1T34A 4H18A 5AM3A 2WP0A 2CL5A 4QO7A 3DDHA 5KZMB 3T8YA 4B79A 3ZNQA 4EFDA 2WG1A 3MOIA 3EC2A 1N7JA 2CBGA 2QUIA 3DO6A 3RRNA 2BBSA 1FUUA 3T7DA 4FXPA 2QR2A 3I9KA 3DW3X 2VCYA 3GB9A 4E3ZA 1U2ZA 3HCFA 5KJ6A 4BUJA 2KBEA 5KVAA 2EYUA 4YNBA 5I9TA 1GTG1 2XBMA 2G9NA 1GPNA 1NVVQ 1JIVA 1SVDM 3S40A 5HOEA 2R1TA 3UMRA 3CRZA 4WASA 3M1AA 4G4SP 3KIPA 3I9V1 2YUTA 5L95A 3F6EX 3ZD6A 5EP3A 5A5EA 1CHNA 1FP4B 2JCBA 3QHAA 3DAYA 1DUSA 5ESXA 4GX2A 4XWWA 4H1HA 2PMDA 4D25A 3BZBA 2HBZA 1PFQA 3SR3A 2Z4RA 2YY5A 4J9UE 4KLRA 2HQSA 2B9VA 4FSHA 3DBRB 3TO5A 3LZCA 1MC4A 4GXRA 4RDXA 1SOVA 1UDWA 5C1BA 3HYLA 1V71A 1T4MA 1RJ9A 4BASA 1HRKA 3CNHA 4EPWA 4BC0A 4K6KA 4TXNA 2IZZA 3D64A 2PZBA 4GPD1 3I2YX 1VB5A 5K0JA 1NBIA 1DZIA 1EH5A 2IZ5A 4U7TB 5J2UF 4TMYA 5DF1A 1WVIA 3BWCA 4BBJA 1A8IA 2J0EA 3MGGA 4H7HA 1AA9A 1ZVMA 4F6CA 1U8FO 1TUGA 3U13A 1AXGA 1NSYA 2PSEA 1TF7A 4XB1A 3W2FA 5A5GA 5HF8A 2GLXA 4B43A 2VA9A 2XMDA 4J4TA 3U62A 1PI3A 3EDRA 3R7WB 1NRJB 3PQEA 2XMBA 1R0WA 2BONA 1HPLA 3Q98A 1LA2A 1NW3A 1EM6A 3UOWA 1Q1GA 1II0A 1N9GA 1WHTB 3G2JA 3L93A 1XHLA 4AYXA 4BY9E 1E60A 2O8BA 2GCPA 2ZJ4A 5F77A 3C7CB 1HQDA 2DGDA 2CNDA 2H1IA 2ZTUA 2CV2A 2FV8A 4XJVA 1L7BA 1J4AA 1QHFA 1SC4A 2VXOA 2JFQA 2FX5A 4WZZA 1U6KA 4PO8A 1G59A 1J21A 1E2IA 1AKNA 2FWIA 4U7PB 4PLFA 1PUXA 5JU6A 1QUEA 4YASA 3LY5A 5B6PA 2Q3CA 2BFPA 4HVAA 1E58A 4CLHA 4OMUA 1QQ6A 4ZU3A 1A2KC 2GK7A 3F6SA 3PR3A 5H3LA 3X2FA 2EBUA 1KK2A 1J0AA 2XKJE 4I2NA 4B6FA 4JXKA 3FPJA 3WXMA 4MGHA 5CLQA 4IKPA 1KHHA 5K2MA 4YRDA 2LIVA 5L3QB 1H0HA 4YFYA 4OQ4A 1NZDA 3DKVA 4HL6A 3TB4A 4AZVA 2KWIA 1X8XA 1A9TA 3ANYB 2FUCA 3CNNA 1R9NA 3RSGA 4ZZIA 1HDRA 1T9CA 1FNNA 2D0OB 4HRYA 1YTLA 1HDGO 4MA4A 4KR3A 3Q0IA 1DOHA 5CYGA 2GN0A 1QLHA 3DYBA 3QBVA 2YRXA 4S0XA 5EAIA 5F73A 2AG0A 3RVSA 2X9VA 4O2BF 2PA0A 1P2DA 2WR8A 3NRCA 3QVJA 4GEKA 2A5FA 5AICA 4XR4A 3ONEA 3BBPA 4CEIB 4NBVA 1G5QA 1AHNA 1P18A 3ZWQA 2EWWA 2R5NA 1V16A 2W6IA 1XVUA 3MGCA 5HE9A 3VR4D 2IX9A 3ZXXA 3HXQA 4C3VA 3LH5A 1W7AA 2PD3A 1WB6A 4QFCA 4TKUA 2B8TA 2HCBA 4PAMA 3ZHRA 4GMXA 2XDAA 3ZHUA 5IU6A 3TXAA 1PJRA 2FPMA 3C39A 5HQTA 4RTMA 4RD6A 2Z95A 2FP3A 4Q9KA 1OU4A 2C9YA 4KW7A 4DXDA 4BNMA 3KHUA 3WRYA 4TVOA 3SPXA 1IIRA 6ADHA 3UT5A 4X1KA 4D41A 1OH8A 2HCJB 2R2GA 4CG1A 2ZDQA 4A6DA 5IN4A 1U3UA 3HWRA 4W99A 4AIRA 3CW2A 1NRXA 4BRSA 2Y92A 4YRKA 3C3XA 2FR8C 2EIHA 4KWEA 3T0GA 4AECA 1G4AE 4LMPA 2LCIA 2PFKA 5FUXA 2AT1A 1PZHA 1C7IA 1RM0A 1GQFA 5TLSA 5BY2A 2JEOA 3M5WA 2OORA 4LNUA 3FDFA 5DCYA 3CO0S 1WZ2A 2YDYA 3QKRA 2INGX 1AKTA 1PX2A 2YHBA 3CLSD 3GEEA 3HLTA 5HKKA 4HV4A 2X40A 4QYSA 2MYTA 5AVOA 1N77A 1Y5LA 4C4OA 3BT7A 2JJQA 4JDUA 4F1JA 1PR0A 3CHYA 4XSVA 3NHUA 5BP7A 1QQAA 1Y42X 3E3OA 5JXIA 3UMFA 2XJ9A 3W7AA 3CO5A 3FMOB 3H1GA 3A58B 4LJAA 2VDWA 2LW7A 1PT6A 3LCVB 4KVZA 3KQUA 1T6YA 3STXA 1XA3A 1UPTA 3FPEA 2ZOSA 5A7HA 2B8NA 4KXFB 4O2AA 1R9MA 1QAMA 2HQBA 3F5FA 3PFGA 1IEWA 3JD4A 2DHEA 2QIPA 2Q50A 4NY1A 4O4LA 4DCJA 1U28C 3KZXA 3OZIA 4W5TA 4IIYA 3OE4A 2GEVA 4KVGA 3HY4A 1KI4A 1PWZA 1DBIA 2ZZMA 3DWIA 1I1QB 2IDJA 1C7EA 2PRKA 3HJUA 3O4GA 4IDPA 3AEUB 2YVQA 4P5PA 4AW9A 5AKYA 1DAEA 3A2KA 4HK4A 1ZD9A 2X5NA 3SOPA 1N2XA 3EIXA 3OTOB 1Z39A 1X7YA 3SDBA 4LIPD 1G0NA 3SSMA 5LIPA 1KI9A 2WM2A 3EG5A 5KC8A 3BL6A 2HU2A 4J1SA 2PLWA 1XHFA 3KR1A 3QVUA 3F7TA 3R8CA 3N8NA 1FMLA 1ZR4A 4CJXA 3QFSA 4WGGA 1TZCA 4JVSB 4K6CA 2A9JA 3B13B 1T2VA 3QKTA 4NAVA 5EJFA 3UWOA 3X2EA 1MLDA 1XUOA 1EVQA 1C7RA 3UY4A 3VR5A 1E2NA 3DCIA 2O3RA 3A1EA 3D7KA 4LHYA 3DHNA 3H5VA 3LAWA 4GKAA 3IBFA 4S3MA 4MVJE 2OVBA 5EQTA 1P1RA 1XDZA 2R66A 1AHIA 4HUJA 1L8AA 2FF5A 4RENA 3RT9A 3ZNPA 1NONA 4BKUA 4A8HA 5EMHA 3BIWA 3FNBA 4DUYB 1FUIA 4TMVA 4KXMA 2YYAA 2O4UX 5CR9A 4GXQA 2SCUB 2DHQA 4L3VA 4XQ9A 1US8A 2GM5A 3F8SA 3RYCA 1QVWA 2CSUA 3GFFA 3A7DA 4AKGA 4RMGA 1RBLI 2UYCA 1QRDA 1BNCA 2BC9A 3H8SA 1E1RA 5IZCA 1TFRA 1DQPA 2PKWA 4QNNA 3G0CA 1GFWA 1GG8A 4RWEA 4LQDA 1TD9A 1WMFA 1HLDA 2NV2B 4U9UA 4LV5B 1GUYA 1M76A 5DKFA 5JAHA 4KB5A 1WBJB 2VH1A 3TLGB 2LIPA 4ADSG 4E15A 3EZ7A 4U7DA 4GNRA 2OGSA 4C2UA 3V8VA 3CU5A 1XZJA 2JI7A 3HGMA 2YNMC 5EJ2A 3TVDA 3FA2A 2GX6A 5LMCA 3LL4A 4DHWA 5B37A 3ICWA 3FYUA 4BNFA 1U0RA 3AEZA 3R41A 1VSVA 1W25A 4RANA 4DABA 1ZGBA 4BNKA 5JAQA 4CT4B 2IPAB 5AKHA 2C98A 2P3LA 2OBLA 2MYPA 3O2SB 4OLJA 5K6AA 3GZNB 3C6XA 4LRUA 2P6RA 1YASA 4JU8A 4EDHA 4MIEA 3L1VA 5AUQA 3EZNA 3MINB 2VDPB 5IW8A 1RAAA 1GSOA 5IVHA 1DO8A 1NULA 2EGHA 1NKTA 3NEJA 1OLSA 1T1SA 4WWHA 1NAHA 2P2YA 1VBKA 3AUUA 1VE1A 2BISA 3FUWA 1Q6ZA 5LC1A 3MJHA 2R4UA 4MQBA 3TF5A 1IBKB 3F7NA 3AW8A 4YR9A 5CK4A 5J5CA 1O87A 1M2GA 4TMTA 3M9WA 3PNBA 4Z0HO 2A1TS 2QRVA 2EW2A 1OTHA 2IY7A 5CM2Z 5D00A 5E9WA 2N9UA 3RJ9A 3T9FA 3F5MA 4LRSB 4NCBA 1JEQB 2P7IA 3IERA 3HB9A 2C1XA 2H59A 2V7TA 4FCTA 3WSTA 2B1QA 3RSHA 1DPFA 2ZAGA 2WYIA 2FPGB 5FOXA 1XTKA 4F2HA 1SCBA 2VRCA 4BO0A 2R8PA 4HN9A 1ZJZA 5DX8A 1U5BA 2ZCJA 2EARA 2F59A 3KEFA 1O1YA 3EMBA 3FHOA 1Z47A 4I55F 3RJTA 4DIUA 2EZTA 1GNTA 1U7ZA 2WM9B 2YMMA 1QTNA 4XJSA 5FNVF 3RSSA 2IP1A 5L6LB 5I5EA 3GLFA 1E98A 2W6QA 1M6WA 5DHTA 4PNPA 1XKQA 3GJ7A 1SUWA 5F7OA 3UAXA 5C5IA 5BPFA 1Y98A 3AUJB 5AWFC 5MHTA 2Y76A 4NONA 3TQQA 3VZDA 4WL0A 1W73A 2O2ZA 1E0KA 2NZJA 1ZRNA 5SY4A 1WMBA 3CIOA 3ENKA 1M66A 1SU7A 3WTCA 3VAAA 4I50A 4LDPA 3WICA 4YONB 4CMHA 1NLMA 2JEYA 3PDUA 3LXRA 2NSLA 2JLAA 4LBVA 1BN6A 4TRJA 4UQPA 1SCKA 1YMVA 3WHLA 4YYEA 1QP4A 4LI0A 5KTKA 2HNBA 3K9HA 1SUEA 5AJHA 1KOFA 2EU8A 3PQCA 2IF0A 3CEHA 1X1QA 2RH9B 2YQZA 4CI0B 3DAPA 4J1QA 1CY1A 4RESA 4LE0A 1UBGA 3UW1A 3HA3A 2QTGA 4F96A 1CJUC 1NXTA 1W4CA 2MYNA 1P1KA 2PZKA 4KGVA 2ASEA 1N0IA 2E6UX 3QF7A 1NJSA 2JIOA 2Y1KA 3RU7A 3M82A 3F5QA 3LZ6A 2AF3C 2AXPA 2VAMA 4YRBA 5ITWA 3VDRA 2RFLA 2JLBA 2QM7A 1W1IA 2YFQA 3GT7A 3OX4A 4BO8A 3AHJA 3SKYA 3WY9A 4QYIB 2B2CA 1VL8A 2C7BA 2BYTA 3CN9A 1OLUA 4RD2A 2XQKA 3A6FA 2RONA 2ZATA 4LCBA 1NC1A 2W58A 1E6KA 2ZULA 4MRPA 3OTIA 4ZAVA 2ZPUA 2PS3A 1VE3A 3GJ5A 3TNLA 4DMHA 1KBOA 2UXCB 2CW5A 2VJQA 5T67A 1ZNWA 4NFSA 5FWDA 4MV7A 4RGBA 4KPUB 2IUTA 3NHRA 4QAJA 2W0SA 3RG2A 3NATA 1Z5NA 1WB5A 1P4RA 1XROA 2H17A 4MSUA 3TJRA 3LVQE 5JHGB 1HDCA 1ODCA 1RKBA 1IL0A 3KQQA 2YTZA 3IXMA 1ZI9A 2H0AA 4GQIA 4QJ3A 4WBNF 3WAGA 4NU8X 5KTRA 1KEPA 1GPBA 2EW8A 3BULA 5G40A 4G5HA 1JWAB 1T2UA 4F3KA 1E59A 1IE3A 1AA1C 4NJOA 2JGDA 4CCYB 1GG2A 1G291 1GLGA 4M46A 2JD2A 4YRIA 1CF9A 3QPUA 3WE7A 1FFDA 4DFDA 4GI5A 2J4DA 1SQ6A 3UJHA 3UTCA 5A0FA 4OTZA 2C3YA 5K2OA 4YH1A 1NG1A 2O8EA 1RQNA 1R4MA 1ZW6A 3Q5DA 4J0JA 4Q9JA 4AZ0B 1Z3IX 3MAGA 1NVBA 3FOWA 4O2BB 1PQPA 1C7ZA 3LX4A 3BIXA 4GFDA 2AUMA 1NXXA 2MSEB 3DKPA 3WK4A 4BMSA 4D3DA 1A5ZA 1QGZA 5J4LA 3QW4B 1AX9A 3MUNA 4C01A 3T35A 1R8SA 1TJNA 1QH8B 3VR3A 2OHIA 4F8JA 1XR3A 2BFCB 2RCNA 4MV0A 5A9SA 4HT3B 1QO9A 5M5BA 1OY1A 2RKBA 3LPNA 5IFLA 1A4RA 1THTA 1YB1A 1F1JA 1P8JA 1XMPA 3C1OA 3DM9B 3OT5A 3PX2A 5EZYA 3SZ3A 3FOCA 1FSPA 3EG9B 3OMLA 1YQQA 3L1KA 4MWGA 1O95D 2E6KA 1ZHHA 2E49A 3IHKA 4MLZA 4MUJA 1OX4B 3S2IA 3VPBA 1P7WA 2GXAA 4R6XA 4CMCA 1KZHA 2J9RA 1Z6GA 1DBPA 3EXIB 3CLRC 2W0MA 4NBTA 1FJ2A 4F04A 3PXXA 4NECA 3RKSA 5T6MA 1SCNE 1QCZA 2VJCA 4XD7D 3BF8A 5F1KA 4HMQA 2JLXA 4JI7B 1GPMA 1L4KA 2X8LA 5IEBA 4D80A 1X1BA 3ASVA 2Q6IA 1QV7A 3WIOA 5K45A 2JLRA 2XQGA 3DOIA 3M4NA 2FJPA 3HB7A 1CZLA 4XM1A 4ZO9A 4I4NA 4N0PA 2C4KA 4OHCA 4HH4A 1J70A 1FFAA 3D3NA 1IJKA 4DLAA 3IAEA 5EJ4A 3F9IA 1XMOB 3EVAA 2YFYA 1REQA 2F6RA 2FB9A 3NTXA 4F0JA 3ECCA 2O0KA 5IJAA 1K8XB 2QG9A 4W1SA 4CMAA 1QC5A 4YPVA 1CK4A 3GWZA 3HRHA 2BFNA 3F7MA 1E9FA 3PL1A 4HGYA 4QT4A 4AO6A 1MZVA 4GRIA 5CCEA 2A5JA 2IVZA 3IUNA 3H42B 2QUZA 4E5VA 4AP6A 1C8VB 2Z3WA 2CUKA 3K71B 5KDLA 1M34A 3CPJB 1PEKE 3LQFA 4UEQA 1PEYA 2KJQA 3YASA 4RA9A 2BM8A 4L8YA 9ABPA 1Z8NA 1RQXA 1FXUA 4ZEMA 5CA0F 2HO5A 4F6LA 1NDQA 4M0KA 4ETMA 1E20A 4C2TA 2G5PA 1KBQA 3OFVA 2ZIGA 5AW4A 3G5AA 3QK7A 3G2HA 3EXG2 4RKEA 4V0LA 1EWQA 9MHTA 3BWXA 5T7BA 2G08A 5FOWA 4F3RA 4ON9A 4R31A 2BGNA 3LOUA 3W8RA 1TL7C 4EKEA 3TW4A 4IMIB 4Z86A 3W05A 5ESWA 4JI2B 3AVWA 1R4AA 2PA3A 4L8GA 5UKDA 3RAGA 2DR2A 3E7WA 1TU3A 3W3AA 5EIBD 1CZUA 3B78A 4HO1X 4YI5A 2VR1A 4RTKA 1UJ6A 2P3OA 3UMJA 4PW0A 5CDUA 2C82A 4LY6A 4YEDA 4E08A 1M54A 2YBEA 3H65A 4KWCA 3AY7A 2A3NA 1E94E 2ODBA 4R7ZA 5BT8A 1JAZA 1T13A 3AK4A 1SFRA 5E7IA 5BWOA 4COKA 3EHEA 4LWZA 2GCNA 3NBKA 2CFRA 2Q5OA 4KQ9A 5F4BA 4ZGBA 1RKVA 3PE4A 1FVHA 5BOSA 4TT8A 2RIPA 4IYRA 1LSUA 1YIOA 1LS6A 3AI7A 1S2DA 2PUEA 3ODGA 1AZTA 4BN4A 1GPWB 1VIDA 5A7GA 1PLKA 3W7BA 1W87A 2GZ1A 2IKQA 2VLIA 1ZCBA 3X1KA 5AVWA 2PS1A 1BDMA 3U19A 3E8SA 4HOYA 4ER0A 4AD8A 4IW3B 2IBTA 1M2HA 3L7YA 3SE7A 1G20A 3A6KA 3UHFA 3V32A 2BCGY 4LSWA 4ZCRA 5EJMA 2R0QC 1BSVA 1J23A 1M9NA 2HLPA 3WDLA 4BZWA 4QJBA 5ALNA 2C00A 4EVQA 4R9VA 3MB5A 5JRZA 5JXHA 4PSCA 3P9NA 4K7JA 4XCVA 4D1YA 5A62A 2H7CA 3ROMA 1YL7A 2VIIA 3DE6X 4XDYA 2QLMA 3C7KA 5F76A 5I8WA 3OZEA 3WBJA 2ERXA 3T4EA 5KEIA 2PX0A 1P81A 1W30A 3D6AA 3NG1A 4AMVA 1KPIA 3H8JA 2D5LA 4CQMB 3SK0A 4TTIA 3WGMA 3R77A 1U8EA 5KO2A 4FEAA 5TQJA 3S27A 4PONA 2WIKA 2IS6A 4YACA 2HRQA 1ZXXA 3MJ4A 4KE6A 1FQWA 2RHDA 3GPLA 3OQIB 3RKRA 2XRMA 2IYVA 4N5HX 3DWGA 1J5EB 3AFMA 1H2YA 4TMXA 2FG7C 1JW9B 3AUKA 2ZITA 4PPYA 1L7OA 1QV9A 1CIVA 1HDIA 5G0TA 3O92A 2W8ZA 4TUYA 1MR3F 4WOJA 3W5JA 3U7GA 3MYRA 2OB2A 2XDQB 1HTTA 3VKGA 1NMEA 5TVGA 1NNSA 3ZGXA 4R0VA 4ESHA 1Q1BA 3EF0A 1SU8A 2QD4A 4CU5A 3AEKA 1AKRA 1OA1A 1ZUNB 3ADOA 2ZJ3A 3R5XA 3B9BA 1OR8A 2ZTSA 1BROA 2WWXA 3CZAA 3QM1A 4X20A 3S70A 4DL9A 5B7QA 1KDOA 3HCBA 4DJ5X 3WLMA 1J25A 3EUAA 4LMRA 4QFDA 1K6IA 3S8EA 2ECQA 1PJCA 2C3MA 2IUFA 3AR3A 4II3A 1TLTA 4ZAGA 3AP3A 4WEQA 1TXGA 1XNRB 5BNWA 3L07A 2DCUA 3LMKA 1Q5PA 2CLFB 2EZ4A 3JQ8A 5ADHA 3I1FA 3L6DA 1M33A 2C20A 1JFRA 2PHZA 1Z36A 1DT3A 2ZJ5A 4JN6B 4K9OA 4X6YA 5C37A 5LXTF 4RJKA 5EMKA 2N47A 3U4CA 2IS1A 2VUSA 1C0IA 1H1TA 1T4CA 4IINA 3S1AB 1YJXA 4EJ0A 4M7OA 1EIWA 1IBCA 4JBGA 4UJ5A 5J5AA 1IJEA 5KREA 1B43A 4G25A 3QY9A 1LF0A 4Q4AB 1H5QA 1YR8A 1KY2A 1E3IA 1R8JA 3ZWXA 2B20A 3TSWA 4I55B 5I9NA 4M99A 3SHFA 3EPHA 4KPGA 3C41J 3EVEA 4TZTA 4Y7DA 1TKAA 1YULA 5FNVB 5T3UA 4F38A 2M6RA 1CZRA 2DF8A 4IFEA 2FK7A 2V6FA 4RPGA 1DIGA 1Z3CA 2LCQA 2OQVA 3TLZA 4OV6B 3U6KA 2OESA 1HKHA 4BP3A 4UTRA 5E6SA 2ZTHA 3NM6B 1J09A 4AL4A 2X6TA 2EAUA 2XCUA 3AJRA 2VJKA 4JFRA 5B4TA 1AM4D 1I6MA 1SHLA 3D8SA 5A4MS 1OWLA 3AKZA 2W2XA 3AF2A 3OJEA 3VNVA 5EWJA 3ELBA 2I2FA 3TD9A 3KHKA 4M6WB 4HLNA 3BMNB 3OPVA 1TKCA 3PWKA 2UZ4A 3DNFA 2VSYA 4FFDA 3Q5GA 4NBUA 3O03A 1BE0A 1UBEA 2ZJ7A 2Z6VA 5A02A 2QA5A 1AQ6A 3KQPA 5AJWA 4JEHA 1MABB 3ABSB 3GJ6A 4KQ1A 3VO9A 3ZKWA 1XRQA 3U80A 1VYHA 3TAUA 4FMCF 3BXOA 4HLUA 3JWIA 4Y2TA 4EY7A 3UWSA 4CEJA 3STUA 2REBA 3IDZA 1D2HA 4URYR 2EERA 2B36A 3AJAA 5BNIA 4WK4B 2IYAA 5BNZA 4R2IA 5JC8A 3IVGA 2P62A 3DT6A 4A8JC 4GI3A 5KX5A 3JQ7A 1NP6A 3LE8A 1KOGA 5KOJA 2ACKA 1C1DA 1BH6A 1E0SA 3W5DA 2ZS8A 2PPLA 5FO1A 1D9XA 3ILHA 4M3NA 3K8ZA 3NCHA 3M7IA 4PGFA 2BMWA 1RWNA 5LKAA 1FX0B 1X2BA 3IC5A 4EGCB 1O6GA 2VYVA 4E5SA 3FPKA 3FF4A 4LN1A 5AW8A 4Z4QA 1KZGB 1E6MA 3K0AB 3TEJA 5EZQA 1A7JA 5AP9A 2IH2A 5LZ9A 2C8VA 5BSTA 1NMQA 4EK9A 4N76A 4RBNA 1TAUA 3HYRA 3F2IA 4HSGA 5EY5B 2PKQO 3B52X 3LGAA 5J63A 2NYUA 2CMDA 3P9IA 3UG7A 5B3KA 4IHJF 2C8KA 1RYYA 4NNPA 3CNOA 3KR9A 1WUHS 1PGJA 2VPYA 4MIKA 3HZZA 1DXQA 2XNCA 1KHTA 1JDNA 3L4BC 4NG4A 1I33A 1PDVA 5JJKA 1JHMA 1RXCA 3WZMA 4EY6A 3C7AA 5FI1B 4DREA 4CQJA 3KQLA 1JVSA 4DR2B 1JG4A 4K6OA 3HDQA 1XZBA 3ZOZA 4GLBA 4PLHA 4F93B 5AJZA 2BW0A 3CE9A 3AINA 2XB8A 1A96A 1S5PA 2VEDA 2I4RA 2HQOA 3EMKA 1H2WA 2PX2A 3ONDA 5SYMA 3O5AA 3WJ7A 2L42A 3INRA 1RCTE 3VI3B 1ECBA 3OIVA 2IYXA 2Y68A 5HM8A 1XTQA 5DSZA 4PC7A 1W2WB 3H0EA 1FP7A 1OWPA 2ZYVX 1THZA 2IXFA 2VK4A 1QIEA 2I5PO 5FUBA 3HDYA 3ESBA 2DFKB 1A69A 1W4AA 4JEMA 1DV1A 5DFAA 4CF5A 1W5FA 5JARA 4JC0A 3TQOA 1GRVA 3T7RA 1OXTA 3IAHA 1JFFB 3A9RA 2C8JA 2PEZA 5HMMA 2PUAA 1S1MA 2F64A 4UHKA 4IH4A 4IVQA 1BW9A 3CUVA 5JS6A 1UAYA 4LV8B 2P79A 4XCXA 1ZJYA 2IHYA 1N1EA 2IXGA 4FCVA 5CT9A 2CXQA 4MDFA 2B5WA 4PZPA 3HP1A 5LQDA 2FXVA 2FDRA 5DGXA 1XYGA 1EJ2A 1UL1X 3L6OO 5ENVA 2RAUA 3LK7A 1TQ8A 1N5IA 2TMKA 3MMSA 4Q3NA 1ZNYA 4LZWA 4Q0MA 4LA4A 3ZV4A 3A4NA 3D0QA 1V37A 4MKXA 1CEYA 2OTCA 4DMCA 2IBSA 5KSWB 1WQ4A 1UF9A 3LKDA 1O95C 1OLOA 5AM0A 1K97A 3BHNA 4TLDA 5I7RA 1U0BB 1ZDMA 3NDRA 1CQZA 1V96A 4UDXX 2XE8A 2Q27A 1NJ5A 2DWUA 3LSTA 3FOZA 2PUCA 2DLCX 1FDOA 2YZKA 4UTNA 3KSZO 2P9HA 5F9FA 2P2DA 3PA6A 4BMXA 1N2CB 4QAQA 5IJ0B 4Q12A 2ZR9A 5JADA 1FU7A 3KUUA 3DP7A 3IXLA 4IEIA 5A0TA 4IH9A 4JJ4A 2JB9A 5ED4A 3BD8A 2ZPAA 3GYGA 4JB3A 2Y1LA 1DI0A 8OHMA 1GA1A 1L0BA 3KLBA 2VH2A 4MQEA 3JPWA 2EXXA 2NU8B 1KDTA 3HS3A 5HBGA 4V2UA 5C80A 4LWOA 4XYGA 5CA0B 3CIFA 1DEXA 4J90A 2O9JA 5DBHX 5EP1A 3U7EB 2JFBA 3AG5A 4GI2A 1GZ6A 1PGPA 4PZDA 3F4LA 3SLKA 4D45A 5B7GA 3MTBA 4B3FX 3G9QA 3RSFA 3PCRB 1AZSC 5CBPB 3VPXA 3ZDXB 1OOEA 5AJYA 4LF4B 2LP4Y 1QH0A 1X70A 4PXYA 4I1RA 2QUAA 2DY1A 1AMUA 3KQHA 1K7YA 4WFKA 4OLBA 2C5BA 2ZB2A 4OJTA 4UUOA 4B74A 2XIQA 4DC9A 2JCSA 1BXKA 1GHTA 2WFMA 3BFKA 4FP9A 1ZHOA 4FXOA 3TMAA 1V1RA 2HQ1A 5HQ3A 2V3VA 1BHSA 1S9HA 3IQXA 1A8HA 4WFIA 3U4DA 3VO1A 4Q24A 5EJ5A 4Q01A 2XCIA 3QZUA 1HFEL 4MZDA 1T26A 5DM1A 1R16A 4FLEA 4FR0A 1CUZA 3SP1A 2MINA 3UK6A 5JPIA 4URUR 2C7VA 2Q3EA 4IDHA 4B40A 4YMVA 1F12A 1LRLA 4J91A 2I9PA 3SNKA 1YBMA 2VP0A 3WHKA 2L17A 5B30A 2ENWA 4B6GA 1T8TA 1ZI6A 1KKMA 4GYJA 3JRWA 3NALA 3MWEA 3VU9A 1JG6A 4U9HS 3CVXA 2JLYA 2CK3D 4D4LA 3BTVA 3LY9A 3WGLA 4EBFA 3DV2A 3DD5A 2Z56A 4GGPA 2IHUA 3SWWA 1O54A 3IIIA 2GJ4A 4DC1A 4DNFA 4KQEA 3M8KA 1IVYA 2HWWA 3AX6A 3ZH2A 4AKIA 2GSDA 3EH1A 3EW7A 4UQLA 1VHQA 2Y71A 4LI3X 3UMYA 3B1WA 5FA6A 3WGTA 1RZ3A 4E07A 5BWNA 3CM0A 4D26A 4F06A 3PFHA 4ND1A 1JE0A 3QWAA 1Z8FA 1EFTA 3LGSA 1TMKA 4U3JA 4XPIA 3EB9A 2J9YB 3SIPA 1HORA 3TK1A 2QTNA 4TN1A 3SC2B 5IX8A 2AKEA 2X2FA 3BJZA 4GZLA 4W8GA 1EU1A 2HJVA 1YRWA 3E9DA 3GUVA 1Y1TA 3KEQA 2QROA 1JDJA 4OXKA 3OD1A 2IEZA 3GLIE 1PX0A 1JR3E 4K86A 2DKFA 3NC0C 3ZQ6A 3EVTA 4R41A 4R8MA 4CG3A 1SXJD 3OI7A 4P4NA 5BSUA 5I5GA 4EHAA 4KIJA 4YMGA 1HTBA 5TEVA 4G0VA 3AJ8A 1I14A 1N2GA 2C84A 5BMVA 2ZIEA 3G2QA 2C2WA 3MGKA 2HXSA 4QOFA 1IPHA 2GO7A 1YR6A 2YJ3A 3BL8A 5DX0A 1JVBA 1W36B 4ETWA 1OBHA 3HKBB 1W9MA 1MU0A 4E1BA 2PGXA 4N49A 3OM8A 3V8MA 1T8WA 3GU3A 1JZTA 2VHWA 3BXZA 4ANFA 4WE3A 3PC8C 4NENB 1Q91A 1FUKA 1KY4A 3D8NA 4DEYA 1COWA 2KQUA 1EGQA 3EPKA 1WQ3A 1U0EA 3OE7D 3U1VA 5KPJA 1GZ7A 3V4LA 4NMWA 5EFZA 1CPYA 3CCFA 1Q1ZA 2HK6A 3KG2A 4FWIB 3PRHA 2I6UA 3KQVA 2CUZA 4EGFA 2P2CA 3PUHA 1MRSA 4L0MA 5J2TA 2PUBA 3PXEA 3RT1A 3TB6A 4LGVA 3QEMB 4CFSA 1VLVA 3N2KA 3TTYA 5LXTB 4L9AA 4DJTA 4UXHA 1VRCA 2C77A 1J22A 2AFHB 4N6GA 3E7FA 1X3SA 4W7SA 1AQJA 2D2FA 2CXPA 5EWMA 3V2UA 1TZBA 1M8PA 3LPAA 4ER3A 4AURA 3EH2A 3K70D 3AVYA 4J3NA 2GN8A 4H1VA 4UUPA 5DM4A 1ZM2A 2NUPA 3HA5A 2YN0A 2XMCA 4GKVA 5LCXA 3KUKA 4ZFNA 2ISCA 4MJLA 3TUJC 1UOOA 4FFPA 2O50A 4FE7A 2Q1YA 4GWKA 5F2EA 3W2TA 1N1DA 3WLAA 4MRMA 1IYZA 3RLFA 3R7BA 4EECA 2FK8A 4OQZA 3SICE 8AT1A 5EXTA 3PT5A 3O3MB 2V03A 4G5YA 2ORIA 2TMGA 4JBYA 4X1YA 1F2TB 2X86A 2XJ4A 2G0AA 3E5RA 4UU8A 4V0ME 3QSGA 1F6BA 2HRCA 4FFNA 4RETA 1TRHA 4IO0A 3B1VA 2WOJA 5YASA 2BEWB 1FRFS 1T1EA 1EEHA 2XOXA 2RAVA 4G0YA 3OH8A 1VJ1A 2A9OA 2HUNA 3BD9A 3K0HA 1K7SN 3QF4B 4RNCA 1EIZA 5G0SA 1CP2A 3IIKA 4CIVA 2YWHA 4F11A 5FL7A 2QQ0A 3GWGA 5DTRA 5FADA 1NR5A 5G0WA 2DP4E 4XWKA 3ZHZA 1E7QA 3CX3A 3HUTA 2Q4TA 5JS8A 2ATVA 3A3PA 4OA5A 3SMQA 4B6OA 4FMCB 1I7LA 3DVLA 4NOJA 3PT9A 4ME6A 4ZAWA 2Z9CA 1AGYA 3QYPA 3EBOA 4MEBA 3QPBA 3QI2A 1YJBA 1W4ZA 4WAUA 1NJFA 3TH5A 4Z1MD 1UINA 1V3QE 2HBYA 2CC2A 4RTRA 4TVSA 3RRMA 1A9SA 1SJ9A 1CQXA 1RJGA 2PLAA 2YC2C 3BJEA 3PK0A 1WV0A 4NQRA 2F8LA 3UZUA 3ZXSA 4BO3A 1Z4KA 3VJMA 4B84A 1D8AA 3GEGA 2HC9A 1HRDA 3HTXA 3JYOA 1I2BA 3OLYA 3TSCA 3KJZA 3P9CA 4ALJA 3TX2A 1CQJA 3GUHA 2X0RA 3D8BA 4XR9A 3RUFA 4X62B 1ONSA 3KTFA 3MILA 5LZ4A 1FXWA 3AH8A 2VHXA 1RYFA 4EO9A 4MW7A 2FHSA 3M9LA 4EI2A 5H82A 5DM60 1YHNA 4DCCA 3CG4A 3EZ2A 2ZUVA 2WJJA 3N1UA 1U7DA 3B9RA 4IHJB 4TOIA 4RS4A 5ULLA 3LT1A 2AEFA 2IC5A 4HF7A 3Q3IA 4MUEA 1MV5A 1DTWA 3HSYA 3VPDA 4DLPA 2HNAA 1C0KA 4MUFA 4PHTA 1QBKC 4P3KA 1TMYA 4DDHA 3N53A 1VSUA 3FTQA 5FI3A 1O4WA 1PGQA 1V45E 1ZRMA 3NP9A 1IHDA 2JDID 2AJTA 2BCEA 2W98A 1KA9H 4KODA 4IGEA 2BM1A 3K72B 3CUKA 4V1CB 3L01A 5DLPA 2QPAA 2ZJAA 1C4KA 3DE2X 5ES4B 2CXSA 4CKEA 1CRPA 1L4HA 4AWAA 4L8FA 2IK8A 4QM6A 5KWIA 1ILWA 1K6MA 2SBTA 1LDMA 3UT0A 4CKXA 2WJ6A 4JODA 4NMLA 4Y2RA 1S1CA 4QGBA 1A04A 2FEPA 3NKLA 4YAKA 4HGNA 1GXSB 3UFXA 1EDZA 3I6IA 1E3JA 3EOAI 4LW8A 5DNAA 3M6XA 2G82A 2H1CA 2JKVA 2BMEA 3PITA 1K2VN 1WMAA 3H17A 4ZO4A 5ALHA 3C16C 3HXLA 2EGUA 4UHDA 4ZC8A 3U7HB 1QTRA 4WCVA 1HL3A 3LWDA 4JLDA 4UUMA 5A4DA 3NR2A 2RH4A 1WSDA 1OW3B 4OXRA 2NNWB 1LVUA 3TOZA 3IBGA 4YGYA 4YMTA 3K0SA 2HW8A 4HXEB 4XUCA 5J5VA 1ZMBA 1Z33A 4NFLA 5BW6B 2GKOA 5DNDA 2GKGA 1L7XA 4BIIA 1PW5A 1EZ4A 2VRNA 4DLNA 1SIUA 2WHPB 1YZHA 3DMDA 1OHHA 3Q2KA 3KT6A 4EELA 4A91A 5JJBA 4LGYA 4DRYA 4K2HA 4MS3B 4COOA 5KI6A 1KZ6A 1T0HB 4DQVA 2IIVA 2Z6AA 3PFKA 3OLXA 1Q7BA 4JKOA 3SBEA 4OQYA 2OORC 1E3TA 4R68A 5B58T 5EHZA 3AILA 4BWYA 3NHMA 4JQCA 2EJBA 1FYWA 4G1FA 3JQCA 2JAQA 1Q0PA 3USZA 3MJDA 4YJ2F 3OIUA 2FPXA 2OXFA 4JUCA 3RIGA 2I4LA 3DOJA 3C15C 1XZLA 4X8LA 1N5RA 1GPDG 4B80A 4BNVA 1SCIA 1XT6A 1AS2A 3IAM1 3K1AA 4QO8A 1Y34E 1JFTA 2AJCA 4NAUA 1NZFA 4Y6QA 3QTLA 3IMFA 4GR5A 1KJ9A 4U2DA 4W63A 2QM8A 3TTSA 4EFNA 3THYB 1IOLA 1W47A 2ADFA 2C2GA 3O73A 3GNQA 4L5YA 2ZJFA 2VTEA 1Y7TA 5JNTA 1PNTA 3AETB 2IEDA 3IKLA 2P3SA 1JKJA 1O3YA 4AY5A 4I0WB 1SC9A 2AMJA 2P9FA 2P27A 2OZLB 2WUFA 3EVGA 2ZIAA 1XYYA 2JAPA 3G8YA 3GNLA 1TF5A 3OCUA 3K92A 3Q9SA 4LBZA 5JMPA 3BSFA 4MS4B 5FH9A 2Q0SA 1JR2A 2RJ3A 3JRNA 3GEBA 2BT4A 1AKWA 5JMWA 1SKYB 2QSUA 3ZDAA 1TO2E 1NPTO 4DQDA 1Q1EA 3QVOA 3RM3A 1YK0A 4QA9A 4NZ9A 2WMDA 3AEQA 3ZG6A 4TRMA 4B3IA 4DE5A 5BWLA 3SQWA 3GLVA 4NDNE 4QG3A 1EWYA 3K1YA 5L6MB 4QGGA 1I5EA 1Q20A 2L69A 2P9BA 2PX5A 1MG5A 1Z4JA 1SPXA 1K27A 2AH5A 1E2LA 2AOTB 1FBTA 4J0KA 3H9JA 5JCPA 3KKZA 5IT5A 1Y5MA 2QU8A 4B4DA 3D6MA 4IXWA 1A9PA 3BMQB 1EGHA 2BEVA 2WUGA 2XITA 4JBHA 3RU9A 1W0JA 1F7UA 3RC9A 2GR9A 2DPLA 2I6QA 4YV7A 1EFDN 3KDSE 3OT4A 3U9LA 5H8WA 1E2UA 4G3XA 3T9BA 1UWKA 4LXHA 2PRZA 1VI2A 2CVQA 2YIMA 2DETA 3SIRA 3H1PA 4C76A 5DHPA 1LWNA 2JW5A 2YN4A 4Q93A 5LZ7A 2W4IA 1XVIA 2AN9A 3EGIA 5H9WA 1N34B 4E21A 1PK7A 1RM5A 3BK1A 4RKQA 2XUGA 2Q46A 3SIWA 1SZJG 1TZJA 4JLBA 4D9HA 4UPEA 3IKVA 3TM4A 1VE6A 2ECKA 2FN7A 1YRBA 1NVEA 3A25A 3OECA 4Y6PA 1CVIA 4MHOA 5G53C 3PUJA 3ZBUA 5DBIA 2NTNA 1RRMA 1YHYA 1EAMA 1SUFA 1AZLA 1TGVA 2DWQA 3IVAA 5FLKA 5IC6A 3R7FA 3L79A 2B4TO 2XUJA 2VOEA 3WAJA 3IT0A 1FMFA 4EKGA 4EMSA 3OOWA 2H1FA 1SQ0A 2XD9A 2IF2A 3O4RA 1P2FA 3CW8X 1H85A 4NJEB 4MI6A 4WKCA 5LP1A 1OASA 4KDFA 1KSFX 1RI2A 1XDWA 1ICEA 3PFWO 1TEXA 4QQRA 1B42A 2J31A 1IFXA 1AKQA 5FRDA 3SKXA 3N70A 3PR1A 1G2OA 2V4ZA 5KYUB 5B1IA 2V69I 3PPIA 1CXZA 2HPVA 4L74A 3GHHA 3DPIA 4MRNA 1ZVKA 4C29A 4J16A 4QGSA 5H0IA 3FYUC 2YHAA 3FCYA 1XTRA 3PGJA 3Q72A 1CZOA 4ZO8A 1F4LA 5J43A 1S3GA 4LOHA 1O5TA 5BQPA 1WXWA 3HKDA 4ZANA 1OFIA 4KE9A 1A0OA 5JH7F 4Q1BA 4AKSA 3ENNA 5CFRA 1H94A 3WGHA 1W6UA 2V63I 1XRRA 1IR21 1AB5A 3CLHA 3KTAB 3RC7A 4QDUA 1MG0A 3KJIA 3W2GA 4LCEA 2ZWVA 2A9KA 1KL7A 1T91A 1W5BA 2XY4A 3WLJA 2ZM5A 2FP4A 1O94A 4RMHA 1VSTA 5TPZD 1Y3AA 2NZVG 3U7RA 4JYZA 2BMJA 3IV7A 1AXEA 4C05A 5EJ7A 5IYZB 1W5EA 2G9QA 2V8BA 3R6TA 3E3MA 3C2QA 1QCYA 1ZBDA 5KNBD 5CA1A 1OGJA 1RMYA 3UJBA 2PKCA 2P11A 4ZJYA 1UBJS 2WJ4A 2C0PA 1VDZA 3BFVA 3L06A 2NU7B 3QJ5A 2I7TA 2VWHA 3VHRA 3VHXB 3ZWOA 1Z35A 3DLTA 5IABA 4AY2A 2DQSA 3CNBA 1NN5A 1TK2A 3B2NA 4LJ6A 2AC2A 3W34A 2P5TB 3COWA 4HDQB 3FFTA 2WHRA 3IAM6 4R8RA 2XVZA 5A3RA 1A9XA 3GJZA 2FW8A 3V1NA 3PVCA 4PIPA 2FF7A 4JQYA 4WZBB 2XWBF 3JPYA 5HKLA 5JSZA 5EJ6A 4I1PA 3IE1A 4RIEA 2Y77A 2PXHA 1PFWA 4GHWA 4HGQA 5JXJA 4YUWA 4D9EA 2BLLA 4YRSA 1ABFA 1Y7LA 3M6FA 4P92A 4Q37A 3K70C 5KYYB 1J1UA 2H8KA 1Y8QA 2B2XA 3FGPA 2BKVA 3AKCA 4CIXA 3ABOB 2DULA 2COUA 3ZW7A 1SBYA 4UOQA 4GX0A 2EJTA 2JFGA 4DA0A 1N3BA 3ELDA 3D3EA 2WINI 3T99A 4A23A 2VN8A 4WY2A 2ZWPA 2J59A 3NAQA 2BKLA 2YRFA 1CUSA 4FKMA 3VYVA 4CVNA 2H2DA 2Z09A 1XFAA 3FYSA 3IDSA 5I7FA 3FWHA 3WISA 3EFOB 5E0OA 5AHWA 2FZEA 2QT1A 3GUUA 1G3QA 2QQFA 5GV7A 4ZYTA 3FDZA 3RV4A 1B0ZA 2DUWA 1YGYA 1WY7A 1BXRB 2RB4A 2QX8A 1TUEA 3GGOA 1M0TA 3I1IA 4U4AA 1HR0B 5G0VA 2MTBA 3CH7A 4DC0A 3EXHC 4CKBA 4IS2A 3PDHA 1Z2OX 4EUHA 5C8YB 2UYYA 4JBLA 3BVPA 4L57A 1Q84A 3HZRA 2HXGA 2YWDA 3IDAA 1D1PA 4FBGA 1N3IA 1RWWA 1BS9A 1E92A 1U0JA 1MFZA 2XWSA 3GJ3A 4EJMA 3UGKA 1LRKA 1C0LA 3ACCA 4RF4A 2XUFA 5TMDA 4UBKA 4IIVA 2C9MA 4IAOA 2DFLA 3S99A 1JQ3A 1OE0A 2V65A 2YJ6A 1GN8A 4DBLC 3G17A 5C53B 2VDQB 2AFIE 3ZHXA 2C1ZA 3UQYS 4E5PA 2PGNA 4I8XA 2GVZC 5F2OA 2ZRJA 2X2OA 5I9BA 1N57A 1SC1A 3FHJA 3ONWA 5IAJA 4KSBA 2B37A 3AV3A 3OZRA 5I7VA 5JOQA 1Z06A 1D1QA 1P19A 1TYAE 2V1UA 2OHJA 4R84A 4HC4A 2XT9A 1W88A 3B6JA 3IGFA 1QE5A 5JSFA 4TV8F 2AUTA 3OU6A 3DMRA 4TX1A 3MRTA 1WKVA 4IILA 5F52A 1BX1A 1ESCA 2CFIA 3Q12A 4QC2A 1IVNA 3D2CA 2AX4A 2E1RA 3KU4A 1N3LA 2HIMA 4HZGA 4BQNA 1CQIA 1R10A 3QVSA 2F43B 4XDHA 1IAVA 1M1YE 1X1EA 2PT9A 2UZAA 1A71A 3FPSA 4CKYA 1N78A 3DDWA 2YHSA 4N4AA 3WWOA 4AF6A 3I04A 3HP4A 1QORA 3O8QA 4H60A 3I9LA 1Z6PA 3DR3A 3A1CA 4LS3A 1Y89A 3FNIA 1Z0ZA 2QE7A 2PN1A 3QX3A 4IIUA 1I32A 3GCWA 4RHCA 4F1KA 1HE4A 2PCJA 4PLYA 1CHDA 5HZKA 3K0FA 2PUTA 1GGFA 2YRWA 3L6RA 4BMPB 2FSVA 4ESEA 1I3KA 1IC6A 4RJJA 4LQCA 3SR0A 1FFEA 3K2EA 6GPBA 1XLTC 2QX6A 1D2EA 4OJKA 1G17A 2JAWA 3B89A 1AF7A 2WYOA 4XCQA 1ECJA 3ZE9A 4J03A 1V5WA 1KYTA 3LRPA 4FX5A 3KOUA 4OP3A 1W85A 1CCWA 1WXEA 3I34X 4PG8A 1WW3A 1B6RA 1QYCA 3HPQA 1XC7A 2P0YA 3H2ZA 5CJPA 3VDQA 2VPXA 4JBNA 1OAOA 3D3WB 3D6TB 2JGNA 2PX3A 4YRRA 1OYVA 4HAXA 1RTKA 2HJHA 2OHGA 3WIEA 5TMPA 1TC1A 2ILTA 3SZGA 3HXMA 3EDCA 4PS0A 3PE6A 2L82A 4FR5A 5F5LA 5E3JA 1O97D 5EWLB 3G0GA 3RVPA 3G0DA 4C7JA 5HG0A 1XZCA 3DMTA 3LS2A 4MB6A 1MX9A 3A10A 4YRPA 1VPWA 5FLXA 1R6XA 3GUYA 1LK0A 2EFYA 4KDCA 2OMEA 4NZZA 3OM9A 3GFPA 4M1ZA 4JYBA 1ZGJA 3QFTA 5KMGB