3U4MA

Crystal structure of ribosomal protein tthl1 in complex with 80nt 23s rna from thermus thermophilus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title High-resolution crystal structure of the isolated ribosomal L1 stalk.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna/rna binding protein
total genus 67
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3u4mA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u4mA02
1ZHOA 4QG3A 4REOA 1AD2A 3ZQJA 4QVIA 3UMYA 1U63A 4DFCB 3U56A 3FPNA 5DM60 1MZPA 4F9TA 1I2AA 3QOYA 3TG8A 1CJSA 5DM70 4LQ4A 2HW8A 3U4MA 1DWUA 4QGBA
chains in the Genus database with same CATH superfamily
3LUCA 3NWOA 1VIMA 1UBHS 2R5NA 1X13A 5DV9A 4MIKA 1PZHA 4RU1A 5SZJA 5KTOA 1U2QA 5DTIA 1TE2A 2HMUA 3PR3A 3RVRA 2FEXA 3KRTA 4DLWA 4E30A 4EYSA 5JO0A 4ZRMA 3INGA 5LZ7A 4UBKA 3SJBA 3JQ8A 3WNVA 4DUYB 1EFHA 3BMCA 1G6KA 1NF2A 4KXWA 2FX5A 2XE8A 1QHYA 2HWYA 4DOMA 1YD7A 1ZWLA 2XRFA 2QMEA 4FKZA 4ZO7A 5AVSA 3E5HA 2OEPA 3UN1A 5EWLB 4UUOA 3PYMA 2AT1A 1GUDA 3F74A 3SIXA 1WZEA 4B35A 2DKNA 1XRMA 3BEOA 3WK6A 3G23A 2IYYA 1XZHA 2I6SA 3KL2A 5SZHB 2F8MA 4AS1A 3DXXA 2ATCA 1MIHA 1B6GA 3GBVA 3E3NA 1U0SY 3V6LA 2ZRHA 3LLCA 2M1ZA 3VO9A 2Z5VA 4LV6A 2FCAA 3INNA 1WAMA 1KEEB 4B3HA 4X60A 1O97C 3SC6A 3WLNA 4NHOA 5LP6B 5IM4A 1UEXC 5J5CA 3EGWA 1PGNA 1RTTA 1KY3A 1QWSA 1UPTA 4CNQA 3HSSA 2P4HX 3EPLA 2F8TA 3CUVA 2H54A 3VHXA 1W76A 1DAOA 2Z2YA 5FPYA 4AIRA 3W6OA 3LY9A 4KMRA 1DP4A 2H16A 4CCWA 4FDMA 1N5KA 1OROA 4RPKA 4K9KA 1DBRA 5FYQA 5K2OA 4BQSA 1W5TA 1XLTA 3IUPA 2O1XA 4C7KA 1G6HA 4KN8A 5CMLA 4CLOA 4NLLA 2HK9A 3ZWVA 4PLZA 621PA 1KOGA 5AKHA 3OLQA 1EFDN 4RA6B 1Y8CA 5KDOA 3KOYA 4US0R 4MQEA 4ZI7F 3BWCA 5K99A 2V7GA 2I2DA 3GJTA 1PVOA 1YK0A 3CEHA 4LRXA 1BWPA 1GV1A 4GE3A 5C8XA 1KORA 2CXUA 3SKVA 4GEGA 2WUVA 4FDTA 1XMQB 1F2DA 4E46A 2GAFA 1LK7A 2ZRCA 3KSRA 5LMZA 5TPZA 4QFCA 1M2EA 1V6CA 1IN4A 4ZVTA 4Z4HA 1O0CA 2JIZD 2JGNA 5JSQA 4EZBA 1Q0HA 1T3HA 5KSZA 1M2OB 3DHYA 4DCCA 1L5HB 3VPAA 2XX3A 5AHWA 4JBHA 2HQOA 2VO1A 4WZZA 4BAGA 3M6XA 3NTQA 1QR2A 1O58A 4AZ3B 4BBZA 4WFKA 1FP1D 4AJNA 3IQIX 2INGX 3I6BA 5AJZA 4N40A 4I1SA 2ADMA 3P8ZA 3GH1A 2J0UB 3IULA 4UBIA 3W2TA 2GPTA 3PX3A 4BNGA 1MT0A 4M60A 1O3YA 2WFAA 3RYHA 1KVRA 3AERA 4FMCB 2JFGA 3CE9A 3K0HA 4F72A 2J08A 5TARA 1Q0UA 5NLLA 2G36A 3KQWA 4JP2A 4RHXA 4UDYX 4MW6A 2QIOA 2CVFA 3AHCA 3IAS6 3LDUA 5TQ2B 4AG6A 3KCQA 4GT1A 4GOMD 3S27A 4KO1S 3HJGA 2C4VA 2OCXA 1X1TA 3LQ2A 4HRYA 4N0EA 2D0DA 3R8XA 1MGPA 1V5WA 3WA7A 3JZIA 1PX0A 3DKPA 3LH5A 1UDRA 1P5RA 4FOPA 3ZCPA 4B4UA 4FEYA 3VHQA 3ZCXA 1FJGB 1T2VA 2VDQB 1G9XA 1OYVA 1V11A 1X9IA 2DJ5A 3FFTA 3GIDA 1E2HA 2VHUA 4GVXA 4KFTA 2O7NA 4MGKR 3PFNA 1SKAA 3ELBA 1VLVA 1L3BA 1Y9ZA 1I4WA 4NXNB 2PEYA 3OOEA 4YCJA 1EBUA 3ZV5A 4JVLA 5A7FA 3ZK8A 2A5YB 3WRXA 4DADA 5K3SA 4CF6A 1ZK4A 3WO0A 3IT1A 1Z4LA 2EOAA 4N8DA 3QWFA 3PYXA 2FY8A 2IHJA 5G3YA 4M1YA 2PUJA 4UHDA 4IFTA 2ZI6A 2V3VA 5AVXA 3ZWMA 4XR4A 2WKRA 2SCUB 1JFFA 4K0RA 2PWPA 3FGPA 3HYLA 3MT7A 3TLGA 1I7DA 1OF1A 1R3DA 1CZKA 1U7HA 1V1JA 5K0ZA 2CE2X 1QHHA 2VH1A 5KQLA 3ONVA 3DL0A 1XMXA 2O6LA 2WB2A 4DLAA 1MB2A 1TVEA 1V2HE 3OUUA 5LB4A 2LDBA 1QTIA 5KVSA 1TQHA 1JPVA 1KP2A 2OR3A 1QFYA 4YASA 3NFYA 4E0BA 2EF0A 1IY8A 1GPNA 3B6JA 3WLJA 6ABPA 2BZSA 1YR8A 3PHCA 1WTAA 2E4WA 1GKLA 3OT1B 3OOSA 1JG7A 1ESZA 2H52A 2OV6A 2QVYX 3EC1A 4HPWA 2O8VA 3IJRA 4KSBA 5REQB 4F2GA 2X0RA 1Q16A 3LW8A 3UA3A 1SFRA 1J8DA 2J4CA 5BXQC 3M6FA 3CLRD 1T6YA 2SICE 2DQ4A 4FLEA 1Y0BA 2C1XA 3E1GA 5F1OA 3X1MA 3RFTA 2NU7A 3OICA 1J23A 3HXTA 3ENZA 4GLOA 2G28A 1CNMA 4IGEA 1E3SA 1RHQA 9ATCA 4IY1A 1E9AA 1N2ZA 4FT2A 4WN9B 3BHJA 3SLKA 1Z15A 2ZRKA 3Q3IA 2R97A 2W93A 2G0NA 4FK8A 4K6FA 1TRKA 1BE1A 1TIBA 3OECA 3VV2A 2PWAA 2VI5A 1VECA 4G4SP 5HKLA 1CP2A 1V25A 3ZY4A 4URHA 3N87A 2JLXA 3STWA 1EZ1A 1Z5OA 3GLHB 1A2KC 1NAIA 1T3TA 3G6WA 4JNCA 4X63A 5IM5A 5IYZF 4D6XA 1XZAA 2DBZA 4GDFA 1YR2A 2ZTUA 1KXZA 3LL4A 1ABEA 1W6RA 1Y9JA 3STYA 4HMOA 1V9CA 2RARA 1U5BB 3JZMA 2V0NA 5CH8A 2NNWB 4ZAGA 3AP3A 3OF2A 1T6BY 1GQOA 3O3CA 4WCFB 4A5OA 4FSDA 3FOAA 4BTEA 1N6NA 4YRNA 3WLRA 1ZOIA 5B37A 3WQBA 1JIJA 1U0BB 1NBAA 1AUPA 4J29A 5AW2A 2B5OA 2A1TS 2P6PA 2P6NA 3FNQA 3FHOA 3NOQA 2V9CA 2DY0A 1ACJA 4JYMA 3VU9A 1ODTC 4URFA 4UM8B 4C0AC 3FLEA 3GL9A 3RUIA 1RRPA 3ZX5A 4PWZA 4JOQA 4F0HB 2RHBA 2CJWB 2Q6TA 2YNMD 1FBNA 1PQUA 2Q50A 3O73A 1TQDA 4UEQA 2R1VA 3WFJA 3LE8A 1ZI9A 2IYAA 4EHBA 4GPIB 1CIVA 2YHBA 1B0AA 1V1RA 2A9KA 4QU8A 4YAKA 3KLNA 2X9GA 5IH7A 3HJHA 3ICVA 5CB4A 3PJDA 2PKRA 4HQFA 4NX2A 2FOIA 4TRNA 2GN2A 2QY6A 1L5QA 5BW5A 1M1YB 3P94A 1WKCA 2W70A 1DC8A 2HH9A 2P4EA 3UG6A 3ZBQA 4DQKA 5F51A 2AG6A 2C77A 4FEGA 1C9YA 4I6EA 2COEA 4LKOA 1SJ9A 3Q7RA 5JG7A 3VYVA 2RHWA 2H07A 3G2NA 4MUIA 1W48A 1X2EA 1GU7A 1P5ZB 3L1UA 3L8EA 4X20B 4JI6B 2JFBA 1I94B 3HYCA 3DMTA 3OD1A 1Z82A 3B7PA 3KS9A 2XKAA 4GLLA 1UDXA 5EQTA 2WY2D 3A6JA 3BCRA 3W34A 2FPLA 2BD0A 2D4HA 3K9BA 3U7GA 4D45A 3H4MA 2XTAA 3PXUA 5BN3A 1DDOA 2WV9A 1BDMA 3JTMA 3QF4B 2HFKA 2UZ1B 4H0FA 3JASA 4Q7KA 3RUEA 4D9KA 4EMUA 4MO2A 4DCTA 3B85A 4RVDA 3BJEA 5G0VA 4BYGA 5DLQC 4BNJA 3WGVA 1OHHD 2FE4A 2ZSDA 3IODA 1UWLA 4KFCA 2JIRA 4KHPB 2II6A 4N12A 3GZJA 5I5GA 4CKEB 4HDSA 3DDNA 2I6TA 4J7UA 3BIWA 4PHGA 3G68A 3WYGA 1DWPA 4X7RA 4CEIA 2WJPA 3N3AC 1F3OA 1SA0B 2PS3A 3EFBA 4WBXC 3U7RA 2DLDA 2AV6A 3OWOA 3AIOA 4B83A 4EG5A 3F7NA 4Y1GA 1L9KA 2PLWA 3H16A 2H00A 4RENA 1GTL1 4NCAA 4NMWA 1G38A 1B23P 5D6NA 1X19A 4RZXA 2O59A 2WHPB 2Y1DA 4RIGA 3H9QA 2APJA 2HQBA 3DWGA 3R44A 4DLLA 1CE8B 4YUYA 4O4JB 4OH7A 5JVDF 1W5FA 3D4NA 4LYYA 3WMFA 3DV2A 4YMWA 3DBHA 1D4FA 2QX9A 3HYNA 3HHEA 4XVCA 3PV0A 1B3RA 1W88A 4UKDA 1XVIA 3IXLA 1ZA1A 1TKBA 5LYJB 2ZQ5A 1PJQA 3H3XA 4GX1A 1YQWA 2O5EA 2G17A 1UOEA 4PGAA 1FLAA 2X4LA 2QN2A 2YJNA 1GXSB 4UMEA 2YCBA 1UJMA 2B7BA 4JYZA 3BGWA 3DE6X 4MDEA 1I3CA 4MNTA 1JG4A 5C4MA 3WWEA 1RIIA 2YKGA 3U6BA 3N8HA 1YAHA 1O8CA 5A6SB 3RU9A 4PLVA 2MMGA 4G5GA 1BVHA 2ZXEA 3MG9A 4UTOA 2NSHA 1E3QA 4NAUA 2JGEA 5LJIA 3K35A 5CDUA 4E5KA 2PH7A 4HZIA 4U6QA 4ISBA 1NQAO 1KK1A 3LX8A 3BK1A 1RLDS 1HRDA 2RGDA 2VDJA 3JD2A 4FMBB 1U65A 4AZWA 2E7ZA 2QTCA 4L16A 4YRBA 2OFWA 3QPCA 1T6XA 4EO4A 3MYYA 3R4CA 1SXJE 5AVRA 3JQ8B 3BMCB 3WS7A 1QAOA 4IEFB 1QSGA 3IMKA 3V8EA 1DJOA 2FRDA 4F3RA 2P2LA 5JATA 3C24A 2I2BA 4IMRA 1FNMA 4UHKA 5TGTA 4N48A 4IPTA 2ZE5A 5LXTF 1MHTA 2WOOA 4PLCA 2PD4A 2WKQA 5BSGA 1JQAA 5JI2E 4I2NA 4L02A 3FXAA 3X1KA 5LOVA 3WYDA 4JDPA 4X41A 3DAGA 4PYQA 3IE2A 2IHKA 4KQ1A 4RVHA 2J9GA 3ICCA 2QGNA 2GZSA 3FSEA 3GMIA 5B1IA 3TJZA 4WBSA 1MW9X 2XV1A 4E6EA 2X4GA 2CMKA 3N6RA 1LCIA 1IH8A 5FH9A 5JRZA 4DLUA 3JSXA 4R1UA 2J67A 3B2QA 3N8DA 3UAXA 4HAYA 2M9MA 4ND8A 4G8BA 5FBQB 2X3FA 2O3JA 1KY4A 2OXRA 1F6WA 1SR8A 3S2EA 4FFNA 5JD3A 4HQ6A 4UBJA 2V97A 1TOAA 3ECAA 4WNCA 3HVHA 1RBOC 5EN4A 3VHXB 2R4UA 4HF7A 4TLDA 3RW9A 1AHHA 1U3VA 1D5WA 3JVUA 2IGTA 1EP3B 4MOWA 4MKVS 4E32A 4D25A 3FDIA 3K16A 4UUQA 3GD7A 4BV2A 4BO0A 3C5WP 5CGQB 1IJEA 3OLWA 1C1XA 1Z07A 4COOA 4CLOB 1XZNA 2XOXA 2XYQA 3QOFA 2MDTA 5D3ZA 1F8GA 3FPCA 3ILVA 1K92A 5KHLB 4XQ0A 4LS3A 3VC1A 1G291 4MQEB 3B8EA 1S2MA 1PZFA 4Q3OA 1Z34A 5J63A 1YUNA 4HB4A 1US8A 4RNDB 1KPGA 2WZBA 2IOFK 3SX4A 1KBOA 1CNFA 4WA8A 2Y68A 2D1YA 2Z2ZA 2M6SA 4A27A 4ZHQB 3H9GA 3N0WA 2QROA 3GQBA 5T67A 3SD7A 1J5XA 4XIFA 4UTVA 1U7TA 3CY6A 2BMEA 2FX2A 1YIDA 2KMLA 3ITEA 3OT4A 4HR7A 4N7RA 4PFKA 4V0NA 4EKNB 3V8PA 2IZ5A 5LR6A 3K6SA 3CX3A 4ERXA 1SG9A 2XXJA 1N2SA 1SCQA 3NTLA 3MQ2A 4HAXA 3FGZA 6CHYA 2AFIA 4D4GA 1P18A 4NXMB 3B48A 4G0QA 1M34B 1J25A 4ER7A 1WQ4A 3CURA 4QHYA 3PJRA 5GGXA 3GFOA 3GUYA 3OP4A 3TZKA 5J4LA 1A50B 1P2DA 4BWFB 2Q3HA 3MJTA 3SZLA 1I32A 4MRNA 5DLYA 4OX9Y 2ZI9A 4HRAA 3T5PA 1CUCA 4RX1A 5SY4A 3LVFO 4WESA 4ND2A 1RBYA 3LK7A 4GRIA 1K8QA 3K2BA 1ODSA 4KE7A 1N6IA 4QQNA 3BOSA 1GR1A 2I8AA 3EEYA 2O2YA 3GT0A 3OX2A 5I9BA 4PTLA 1KMCA 1BEUB 5A4MS 4MULA 2J07A 2XUFA 2FB9A 4RL6A 5CJPA 1U4NA 1S2LA 1NUPA 3JQFC 4ZA2A 3PR1A 3D6FA 1NT4A 3ZXYA 2NNLD 3ABSB 4ZANA 3ESDA 5A7GA 1ONOA 4MUGA 1M5TA 2W6ID 3DL4A 3WB9A 4B80A 1EHCA 5FLKA 2ZIAA 1AZWA 5I4KA 4MV3A 3H65A 4I1RA 5FJJA 3AU8A 3W7AA 5BYAA 5F3WB 2OM6A 4ZT2A 2TYSB 3ZIAA 1E4EA 1RYFA 3WNBA 421PA 2FW1A 2HU8A 3BH0A 1V4VA 3K1TA 3LIIA 4ZVSA 1XXHE 5TSDA 2Y99A 1DO8A 1P8AA 2PAFA 3ODPA 1P2TA 2XZDA 3BTOA 4G4SO 2QUBA 4M0CA 3RRXA 3FPSA 3SXPA 2GJ4A 4BKUA 2UYHA 3M6AA 1QHFA 4J3NA 1K6MA 5HCUA 1WB6A 4Q4DA 2H59A 3A8TA 3O7WA 1IHDA 4FUQA 5IDWA 3B70A 1W4RA 5E4FA 5ER6A 3GRPA 2QPLA 4JCOA 1EBFA 3DUWA 3T1VA 4B44A 2PL9A 5IX8A 1Q7EA 1LVUA 5EMMA 5TF4A 4Y67A 3Q8KA 2AC2A 3EGDA 2GGSA 4C3ZA 5JC1A 3DMRA 1PR2A 3FYSA 3TLGB 3FFBA 3ZK7A 1QLJA 3UATA 3A10A 4H7DA 4F11A 2WINI 3IELA 4F9EA 2RHDA 1QE0A 3M9XA 3NASA 3KWFA 4R2MA 3G85A 4UMFA 5I5EA 3MHPA 1PTJC 4QTYA 2QRVB 1QO7A 3OIDA 1L7MA 4RHCA 3H9JA 1OR8A 1HDEA 4ZOAA 3WGNA 1TO1E 1GM5A 2QYOA 3WOHA 2COKA 2ZBQA 5HK9A 5JEEA 3ZUPA 1HUQA 3RRFA 3JYNA 5T7BA 2F1KA 2A2ZA 3DW3X 4TWZA 1V9LA 2ZS9A 3MCAA 3F90A 1GFSA 4MW5A 3KAKA 5ESXA 3R7SA 1F17A 5KAPA 1OWNA 1E2LA 2R84A 1UC9A 3IPRA 1Q2UA 4YJ3F 1LPAB 2NU7B 3D6VA 5K1ZA 4DNOA 2N9UA 3DL7A 4KO3S 3T7IA 1H8EA 3KR9A 1JX6A 1XT6A 2D13A 4MQFB 1JMVA 2X3YA 2EFHB 4CL0A 1MNQA 2YJ3A 1BJRE 3L7NA 4IR7A 5P8WA 1IN1A 1ARZA 1F8YA 1MFZA 1HURA 3A6FA 4KX5A 5E3IA 5KDLA 3UWMA 1XJ5A 2K7FA 1M1ZA 4B7AA 4IUDS 4L2IA 3PFKA 2GJ9A 1NUQA 3GLIB 3D3WB 5CLQA 4ZAWA 3T5TA 5I7FA 2D7CA 3P20A 4D3FA 1NV9A 2V6IA 1W9MA 4W5NA 3K0EA 3AF0A 5TJ9A 3QFCA 2ZRMA 3N8GA 2MYPA 3OC6A 3P2OA 5HYVA 4F5DA 2YS7A 1ZCZA 4XDGA 1FY2A 1XLUA 2E4XA 2J7PA 3GQVA 3H2HA 4MPRA 1E7MA 3VV3A 4DLBA 2C5FA 2FG5A 2P9ZA 3GLUA 4BCCA 3LCVB 3NV9A 4OP2A 4R9NA 3V1YA 5J58A 3FPFA 4LJRA 1QK5A 5DBHX 4UNPA 3PHBE 3C3KA 4LOIA 5JSZA 1FS5A 3VU9B 3MD9A 4DCPA 2G9VA 5DGIA 3K4HA 2EX1A 2QU7A 4HD8A 4KRGA 1TCVA 2A6PA 2X0IA 1E9CA 2V4UA 3A9SA 5FFNA 1V9SA 1YS4A 2RGGA 2E5WA 5A9SA 2YWEA 1KJ8A 4C3UA 2LVBA 3KZ1E 1IR1S 1XDWA 1CETA 2IEIA 4W99A 3T61A 4C04A 2R1VB 2PRKA 2B1RA 2WIAA 4J7AA 4LTMA 1N6RA 5CA0A 1XIVA 4UDNA 4YREA 1V1RB 2A9JA 1KQFA 1EX1A 3KELA 5ARBA 5DB4A 4KH1A 4PPNA 3T8YA 1CQJA 2HCFA 2X19A 3DDWA 4NOJA 1S3SA 2XNHA 3GEMA 4QPNA 2HU7A 3RRZA 3VAZA 1G5PA 1IWAB 1P0CA 4ZOEA 4RY2A 1CR2A 1A8PA 3MUEA 3OZSA 2RCYA 4JLOA 2CVZA 4L9SA 4A0GA 3IPYA 5GZ3A 4K28A 2PKCA 5CLGA 4LYJA 3BPSA 1THGA 1Y89A 2ARKA 2DTEA 4TXLA 3VJMA 4RUBS 4KPUA 4JI8B 3LC7O 4UBNA 1IC6A 3PE6A 4D5GA 1TPZA 2A33A 4WA7A 1TTTA 4NCNA 4NBTA 2QT0A 3ROMA 4F5ZA 1C9EA 4J0KA 2IY7A 4WJKB 2H1SA 2HDOA 5C2JB 2VA9A 2ZTHA 4MJLA 1A8HA 1RCTE 2WHQA 3CCFA 2JI6A 5SZKB 2YOHA 4F60A 1YDHA 2Q62A 2FFJA 1GYRA 4E3ZA 5EIEA 4PYKA 4M37A 5ULLA 3KD3A 2B6HA 1XCOA 2GEBA 1Y1PA 5EE3A 3SYNA 2XEXA 3KUCA 1R8QA 3L1HA 4JS0A 1WXFA 3RT7A 5A71A 4YR7A 2XNDD 1TUGA 4YI3A 1M8FA 2GHIA 4UQLA 4V24A 4HDSB 3IILA 1M2NA 2CLFB 2ZAMA 3K0FB 1DELA 3EVAA 3GN2A 4X95A 4DV6B 3EN0A 3BGOS 5BW6B 3ZVKA 3IVMA 4B6PA 1PW5A 1RP7A 3PZBA 4I1OA 2OE2A 1BX3A 1R64A 3E7FA 3RIHA 3DEFA 3JQCA 4XWTA 3QU7A 4BO3A 2FFHA 4RTRA 2XUPA 1YUMA 3IIMA 1EE1A 4GVPA 4NV1A 4RMHA 3P2JA 3V4SA 3DBHB 3MLBA 4J0QA 5BN1A 2XODA 4PNZA 3I62A 2O4CA 4GOKA 4Q3DA 2P7HA 1M2JA 4EHNA 1L2TA 4B84A 1XDBA 4DQVA 5EMLA 4R0MA 1JKXA 3H2SA 3MPUA 1VKZA 2P67A 1Y42X 3H8JA 3TUIC 1FZTA 3T0GA 2QVGA 3A04A 4C29A 4CCAA 1X92A 1PHRA 2W2NA 3FB4A 5BR4A 3L49A 2H31A 2O2ZA 4RJLA 1A4XA 1XZJA 3KPUA 3P9CA 4GWGA 1JI0A 4GECA 1VDMA 3EOAI 5JAMA 1M6EX 5FRDA 1WOMA 5FOWA 2QM3A 3HUTA 4IDQA 3BH6A 3PXAA 4UFNA 5CD9A 2PX8A 1YF3A 4Q05A 3KEOA 5B53A 8LDHA 1CXZA 1CUGA 1T10A 3WXBA 1RQPA 3VNRA 1IB0A 1C7JA 1SVUA 5DM4A 1G2IA 3N70A 3NBXX 1BMDA 4MIOA 1P4HA 2NT3A 1D5CA 3FW1A 4PTZA 3U9TA 1Z25A 2Y1FA 3ZXIA 3D9QX 1Q6YA 4I36A 4NBSA 2Q6VA 3ZDDA 1JKIA 2YC4C 4QIHA 2LKCA 4ZI5A 1Z8FA 2XTNA 3KKPA 1DRUA 4P2BA 4YRKA 2P6UA 4INOA 5EE0A 4W5RA 3KQUA 2B0CA 1U7UA 4YN3A 4KH0A 4XFDA 1UEJA 3C3WA 4RKRA 5FHRA 4AMBA 5LQAA 1JIIA 2R86A 3PGJA 1QF9A 3I72A 3RVJA 3NBAA 3ITDA 4X66B 3PPYA 2IWHA 5LJLA 2V0CA 2Q9BA 3NIWA 2Q4OA 4LDPA 4GMGA 4O4IA 3DPIA 1QYWA 3ITNA 4FGSA 1QO9A 1K8XB 1VXOA 1NFFA 4GRAA 1CB7A 1VJGA 4FZVA 5EHGA 5FFMA 5PGMA 4MV5A 1HT1E 4R8SA 1BGWA 4ND8B 2YDYA 3MJDA 1APBA 3NDBB 4K6KA 4OEHA 3SU8A 2XRYA 4EITA 4ZYLA 3G49A 1Z5PA 3OO0A 1EK1A 1YO6A 4HXYA 4XRGA 2MSDB 2XUIA 4R05A 3TLAA 3AG5A 2RBKA 3HE3A 2X1LA 3OIVA 3Q9SA 4RIHA 1REQA 2NO9A 2VRCD 3EZGA 1I80A 4TYNA 1Y3CE 3MOGA 5TJHA 1KI1A 3AVVA 4KYVA 1E6CA 1U6IA 4RTSA 3E3OA 2DT5A 1RXOC 1C1XB 1I14A 4NRDA 5HF5A 4CKBB 4DEVA 5JCJD 3CINA 1I6WA 2GPYA 4IWYA 1YRLA 2ZRLA 1MXHA 1NBMD 2ZJ7A 4PSDA 5GJWC 1GTMA 1JQ5A 2NQ8A 4BN5A 4MWZA 4LZWA 1YS7A 3PTAA 3QEAZ 4QBTA 2D54A 3IV6A 3T12A 1JRLA 1QPGA 1US8B 2XT0A 2P5TB 3REOA 2HRZA 4A15A 3G9QA 4I55A 2QYTA 3TUJC 2IS2A 1JSCA 3W05A 4MAFA 3W5IA 1DEXA 3GEEA 5E4TA 3T15A 4U02A 2H92A 2R66A 4AF6A 4A5SA 2HO5A 3SVTA 2MINA 1CR4A 1DEOA 3KJHA 3M8KA 4OHRA 3GQBB 5GONA 5D5PA 4CG1A 4V0MA 1UXIA 2OZKA 2OWDA 3L5KA 1CX9B 4K5QA 4PEVA 1GUYA 1HPLA 1LBIA 2ZI7A 4IDHA 1ORIA 5BNZA 1JJIA 2D5IA 4DCJA 1H22A 4HKTA 1KJNA 2QRQA 2AFIB 1QTNA 3T6KA 2OCBA 1FFGA 2O3SA 5KNDA 1JAYA 2R8ZA 3LS2A 3USES 3PGMA 4JP1A 2JIBA 4M0PA 2ZVDA 3T7JA 3GV0A 3UAOA 3WIVA 1JWBB 1RSZA 2MTBA 1SBQA 3AEQA 1QKIA 2W9XA 2RGUA 4OLJA 2HFJA 2EJUA 1FSFA 4MARA 1U04A 4XSVA 1B2RA 1HLDA 1TCBA 1Q44A 2BVNA 2NQ2C 1YOBA 3OAAD 1MB9A 5EMHA 4BE4A 5B2EA 5A5FA 1NBWB 3N76A 3UC9A 2BM9A 3HB4X 1XN1A 4DRXB 1PJBA 3GPCA 3RQSA 3L6UA 1U11A 3MCTA 5DT2A 4YGXB 3I5UA 1ECCA 3QE2A 4X45A 1HRKA 2R1UA 1RCXC 3AUYA 4HUQA 1SQGA 1FRZA 3BGSA 3G7SA 1C0PA 3JQ7A 4QXQA 3NGXA 1SURA 1QH1A 1XCJA 3DZFA 1PQ4A 3G9ZA 3Q7QA 4UEKA 3CIFA 4D2IA 4R5MA 1ORDA 3QMWA 4F8YA 1OREA 1NNI1 2AOUA 2L18A 1NFRA 4WGFA 3FMVA 2XVAA 5DTRA 1FXUA 2PD6A 5C7OO 3W5CA 3PHIA 3CZQA 4J94A 1E4EB 5KC8A 5DMXA 2H0AA 1ZWKA 2WP0A 3FA2A 3MWYW 5I9IA 5ELXA 1N0HA 1Y8ZA 1AUSS 1S1MA 1K08A 1Y7PA 4RD3A 2FEAA 2GPAA 1ENZA 2BFPA 4PGGA 1E6WA 4L22A 1RKXA 4JI2B 3GMTA 3TAHA 2ODEA 3WA6A 5L6MB 2PG3A 1Q15A 1OIWA 5C8YA 4EFNA 2GDJA 1VCIA 3FHJA 1G6Q1 3MWDA 4AD8A 9LDBA 2WLSA 2DPLA 2O8BA 2EC5A 2PXXA 3MAAC 3DZDA 2O2CA 4PYLA 3QI7A 4ALJA 1QQ7A 2GPJA 4YAFA 5ILOA 2C3UA 4M1WA 4XPIA 2BHTA 3EGDB 5LD2B 2VN8A 2V67I 3OD5A 3BTSA 4F9FA 5C5IA 1E5LA 1T5HX 1GARA 2HXSA 3NEAA 3ZI4A 5BVGA 4J2TA 2R6DA 3I6MA 3EG9B 3OIWA 3SX0A 2NMVA 3E7XA 3JQFA 3BA6A 4BE7B 5D1HA 4L6AA 4AY6A 1X8XA 4KNYA 2Z08A 1PZNA 3KR0A 3PQ5A 4HLNA 4NS1A 3EW7A 4FGJA 1RE1A 4H1UA 1U8XX 4TKZA 3S3TA 2Y3IA 3TI7A 3FNFA 1U8AA 1TUBA 4P3YA 1TD1A 3CVOA 3PT9A 3BXGA 3HUFA 4LBZA 4Q7JB 2JLQA 5B1DA 4Z9XA 4B7UA 2IEYA 2YHIB 4YMTA 1R9GA 2BH2A 5BO5A 3CLTD 1U63A 5BXYA 3W4JA 5HZMA 2VTBB 4IH4A 5E8JA 3V1KA 3NANA 1CUDA 1KZ1A 2ROQA 5ESDA 4B75A 2G1PA 3L02A 4O1HA 2HSJA 1KY5A 2EZTA 4D4KA 1SKYB 9MHTA 1HX7A 2GM5A 4RW0A 1K27A 2UZAA 2B94A 3TRIA 3EQ8A 1QX3A 2PJUA 4Q3AA 1A1SA 3TZBA 4EL5A 1QLWA 2FDXA 5GJBA 1NR1A 2IYFA 4PNPA 4EF5A 4M9XA 1C8BA 3M82A 4YRTA 5DN6A 1QYDA 2C5SA 3TL2A 1NXTA 5EKTA 1QIHA 2YHUA 2F64A 1NLUA 3D3JA 5D6OA 4HCJA 3PITA 3UUFA 1VPEA 3Q3EA 4DN6A 1KI2A 2L69A 4MTCA 2XOKA 4UD6A 1IY9A 4BP9A 1THTA 3OUTA 3J7AC 3E22B 1A9OA 2VUSA 3NGLA 4RZUA 1SVIA 4TL8A 4KPYA 4R2JA 4BV8A 1JSRA 5H80A 2FMXA 2YN2A 4RCYA 4BYMA 3KQTA 5JZSA 1PTJA 4O2AF 4LOAA 1FFYA 4GPTA 2V5AA 1P73A 2G82A 4ZMBA 3AHEA 5A4FS 3OZTA 2YJGA 4S1PA 5DM70 1GKIA 4NTZA 5TS3A 3X3HA 4F45A 2JLYA 2XXAA 1QDLB 2YQ4A 1UJ5A 3A6KA 3AUXA 4E2YA 2TMGA 3E2IA 2VHXA 1NI3A 3LDGA 5L3VA 2GM9A 4XRRA 1G20E 1K4MA 2HJWA 4Q19A 4BX2A 1QUEA 4GM4A 2O0MA 1X7YB 1ZM9A 1DEAA 5A9SB 1KJIA 1J39A 1MH1A 4US1R 4CMIB 4KMMA 3C41J 1NJ1A 5JAHA 1YE8A 5IG2A 2IVFA 3DCYA 2WF6A 1QIGA 2C5BA 2FA9A 1RXYA 2HF8A 3JQAB 3L4BC 1QMGA 3WG9A 4A0HA 4OH1A 4ARBA 4TN1A 4ER0A 5CA0B 4KXYA 1SVDM 3H1TA 3Q8XB 4R1QA 1CQJB 3KUUA 4JUIA 4C6SA 3LQ1A 4FYJA 4P7FA 1U1EA 5EUQB 2AKAB 4LTDA 4QJ3A 3A37A 5E9JA 5B7NA 4RZQA 4NBUA 4UE3S 5TB5A 3ZU6A 1IU9A 1FP7A 1TYCA 4P92A 3FHTA 4BVJA 2PH3A 4MYHA 3QX9A 3NTOA 4Y1EA 3SJ7A 2GLUA 3W6PA 2PCLA 3M1AA 5CFMA 1UZUA 3WWZA 4BLOA 3QVVA 4IIUA 3GIWA 3MINA 5L3RA 1H85A 4B5KA 1L8XA 4M4SA 4B6FA 1Y1RA 3OY7A 3P5BA 1Q3HA 4QDXA 1FB5A 2PGXA 4JLSA 1FOEB 3G0OA 3S5UA 3WIDA 3G59A 4DJFC 4B3RB 2AR7A 4P81A 2YMQA 3OZVA 4MVWA 4FHDA 4HRVA 2I4OA 1QWOA 3TIIA 5TQ0B 1EFUA 1JUDA 2OORA 4CKZA 4B3TB 4X0EA 3V80A 5JO9A 3NATA 4W1QA 1OFGA 2H08A 4PZZA 2X13A 2QP9X 3BJRA 3REFA 1UL1X 4XA8A 3DBVO 5JH7A 1N2EA 4LRUA 1XTBA 5DTQA 5EEHA 4D3SA 4J1QA 2ASEA 3GDGA 3G9XA 3ORHA 1RLCS 4WLVA 3IL2A 1YTUA 2DPMA 1E89A 3PHHA 4IIGA 4WHMA 4XYBA 3WB2A 2F9FA 1Z0UA 2O05A 3R9WA 1JPNA 2YNMA 1J70A 2B8WA 3D8NA 2XADA 3D7NA 1CHDA 3I2GA 3ZCTA 4XVRA 4GL2A 1CW2B 4UTRA 3GGOA 3BSFA 1ZEMA 2GPSA 2WAXA 5E2BA 4ZVRA 4NMXB 3MYRA 5CU7A 3ZHCA 3LP8A 5DX0A 1FTSA 3GZTB 2W6JD 3KEMA 1WEKA 4DDKA 1U0JA 3GC6A 1H6DA 2AN3A 2V7XA 4EGSA 1ATZA 4RXMA 4PQGA 3DJYA 3GVHA 3QTLA 5EZSA 1F0KA 2UYOA 3FHLA 3CH4B 3RTCA 1Y5MA 2BLLA 1OI2A 3G2MA 2XCQA 4QFBA 3R7LA 4EDHA 3C4QA 3WICA 3FNRA 4DY4A 3PENA 2H18A 1NE2A 3AR5A 4JSTA 1MV5A 1KJYA 3T0FA 3V1MA 3B9BA 4IJWA 5IUJC 4D3XA 3U17A 2RKWA 3MJFA 4Z9FA 4OX9B 3OZRA 2JFNA 4HFNA 2OMEA 4XEHA 1J2YA 2QW0X 3C6XA 1VBKA 3EVBA 3FZEA 4LVNA 4UFOA 3VTKA 2ZR7A 4P0TA 1HMYA 2O8EA 3DNMA 4RY0A 3PGA1 4CN9A 3PX7A 2ACWA 5IDYA 3CNOA 5F3RA 3TINA 1D03A 1N4DA 3MLEA 1DCMA 2GMWA 1T3ZA 1S89A 2HWXA 1DRJA 4GLJA 3DR3A 4M0EA 5EJIA 3K0SA 1PFGA 4ERNA 5HF9A 3C98A 5D87A 4D3ZA 2ERCA 4XH9B 1BQ3A 2DFTA 3RUPA 2IIQA 3CZAA 1PJ8A 1WF6A 3SE7A 4YP1A 2BF4A 1CYEA 4ENWA 1H4VB 3T5AA 1L5SA 4P8RA 2QPTA 3LW7A 1HE4A 3BHMA 1IEWA 4G6ZA 1R6TA 1S8NA 3PS9A 1RJDA 2OYCA 2F90A 5DX8A 4RFVA 1HI9A 1MAAA 3RVPA 2XIQA 1XDGA 3EXG1 4OFXA 3V8VA 1SVOA 2PRIA 3CH7A 4ALKA 6AT1A 1W2WB 1IK6A 4UXIA 2F3SA 2G5PA 2IK8A 4BUZA 1KEZA 2O06A 3DHWC 3OIYA 4ZU3A 1I4TD 2Z4RA 3DH0A 3QX7A 3EIWA 2WG2A 5KTRA 2EATA 4OHPA 1N1DA 1C4WA 4ZT4A 1RI4A 2ZM6B 2QL9A 1F7UA 3CH6A 1XMJA 3N0VA 5D3KA 4DLRA 2X8LA 1X7DA 4ZAZA 2AWNA 1QP4A 4V0LA 4KIGA 2WVJA 3CUSA 2AN5A 2CYAA 4URZR 4F1KA 1WDLA 3HCOA 4LBWA 1O2DA 5AD1A 1XL1A 3ABOB 3GNTA 1BG6A 3P2MA 4R3UC 4UM7A 3KHTA 3M3HA 4X00A 1A5ZA 5TX7A 1T8UA 2X0JA 1P2GA 2EFYA 1USVA 2GTPA 2VUHB 3F8WA 3HKCA 1AOXA 3MGAA 1XG5A 3C8HA 3OCYA 3OF5A 4GC9A 4X44A 1JGTA 2NVBA 1TA9A 4RZSA 5HVNA 1GCGA 1QOPB 3O4RA 2R1TA 2RHMA 4KW7A 4QXRA 3WGYA 4ITVA 1YVEI 1S96A 4Y3UA 1ZJ6A 2PYDA 3NAMA 5HF6A 2CLOB 1XVTA 1QH8A 4OGFA 1R0SA 4KREA 5CM9C 3B1WA 2NYUA 3M4ZA 1K2WA 3DKIA 4LOHA 2OZPA 3EAFA 3RRYA 5ALXA 3EWIA 4XE5A 3T7KA 1L7DA 4HB2A 3WDKA 4TYYA 1O8BA 2EWMA 2WC1A 1AJEA 2CLSA 1YVUA 4FDVA 5GJVC 2XTMA 5GONB 1LBQA 2VHZA 4JR1A 5KBYA 1ZW1A 1EAYA 3LLMA 1WDTA 2CNLA 3QSGA 3WYEA 2Y0EA 4IBOA 5DNDA 3UT5A 4CWAA 4N0QA 2YOGA 3BXPA 2IXEA 1IBMB 2HM7A 2H2AA 4EKIA 2JGFA 1NJFA 4OXKA 1RAGA 1KVTA 1IZ9A 2BFFB 3OOWA 3ORFA 3PP8A 4O2BA 4ARVA 4C7JA 3HTXA 2PFGA 2YQZA 3EVEA 3L6DA 1W36B 1JDTA 1MO4A 2Q9AA 3KUXA 4LRQA 1MP0A 4OUDA 3FJYA 1Y6RA 2PUBA 4HAWA 1NXOA 3SPXA 3CNBA 1XU9A 1FTYA 3QGMA 1YGYA 2WFMA 3KAQA 3LXRA 4JB8A 4YMUA 2H29A 4JR0A 4MW7A 5LQUA 2FZGA 1CRLA 1GOTA 1K86A 2ZT7A 3I2KA 3P0EA 4Z4GA 5KTYA 4GFDA 3ZE0B 5CLFA 1HO3A 1ELOA 4JBNA 1V41E 3ROQA 4GPBA 4PLFA 1VLMA 2HAEA 3IMFA 3SYKA 3HO1A 3VSCA 1FMCA 2YV5A 4CVNA 4MTLA 3VR6A 1NRWA 5CDSA 3DTVB 1GSAA 3VNBA 3C3EA 1BRMA 1SCKA 4ZGGA 4G1UC 4G1EB 1GL7A 4LOLA 2FWIA 4HUQB 5C0OE 4JGGA 3VOBA 4AROA 1JYFA 1NMYA 1VG1A 4Q4JA 1QH1B 1Y9AA 3UJ9A 1FVFA 4EP1A 5L4NA 3RV3A 4DIDA 2BEUB 3CJRA 2AOUB 3CRZA 4M0FA 4BVFA 4ZOCA 2TMKA 4QOEA 2ZP1A 1VGRA 4Q7LA 4BUJA 1AKUA 4XM0A 2RAVA 2A30A 2Z9DA 3T4EA 5BSHA 4C08A 4X8OA 3K96A 4WVFA 1RT9A 5JYEA 4N4AA 3IPCA 2NADA 2VPQA 2W2XA 5G1OA 1MPTA 1E0AA 5AI5A 2D4AA 3P9ZA 4LPKA 5KSOA 5DLPA 1NBIA 1S9DA 3OPXA 1BXZA 2IKQA 1AT1A 3KU1A 2H4HA 4UUMA 1PUIA 5C8YB 3WNQA 5BSFA 1L5KA 3MWDB 1O9HA 3KJNA 1IAQA 2FZ5A 4AXXA 2YV2A 4NCIA 3VR2D 1FVOA 2ESRA 5AJUA 2YVLA 3V7NA 2PH5A 5FOTA 1RU3A 1SPXA 2A0XA 2AUMA 2D2VA 2YICA 4XPIB 1E92A 1HE8B 1O6CA 4KGVA 4MKZA 4S2EA 3FFWA 1N25A 5T6BA 3JYHA 4O63O 3GGCA 5DISB 5IASA 4TWBA 4F4DA 1AKTA 1JEEA 1MT3A 1N3IA 1VYHA 2ZBPA 1EM6A 1U8TA 3R3XA 4P58A 4N0MA 4BC1A 4S04A 3NT5A 1Y4UA 4DCUA 3LUGA 3DKVA 3OZDA 3PKIA 2IZZA 4YYZA 3D6JA 5JFOA 5DHUA 2HJHA 4Q0MA 1A04A 3VYUB 4QDTA 2D59A 3IOBA 1JHZA 2C4KA 1YC2A 2PX0A 1TUBB 4LRYA 3UW3A 1LF0A 5HP4A 5EZYF 4BO9A 1EFLA 2VS1A 3QTBA 1UQUA 1X8LA 3FMIA 1FSPA 4W7HA 3QLJA 3TZQA 4IRMA 1T3SA 2HLDD 5KEIA 1UM9A 3LTNC 1H4QA 4G5XA 4K3VA 1HFEL 5AKZA 2ZTLA 4O2LA 5CBKA 1NJ2A 2AZTA 2XEDA 2ZR0A 4M7OA 5EAIA 4MW2A 4DDWA 1T6NA 1CUJA 5KYWB 3AZOA 1WBJB 3VNQA 3GLIA 3Q0IA 3FDJA 1I2ZA 1BXRB 1DIRA 2JAHA 3QK7A 2C31A 3VMFA 5ALFA 2HA0A 1NP7A 4DLPA 2OILA 1CCWA 1FFHA 1JR3A 2VCEA 3IKVA 4OI4A 5HF8A 4D02A 1ODJA 3PUXA 4AX4A 4ZN6A 2EEPA 5KUTA 3HUEA 4CKCB 1XR3A 2Y1EA 4KQ6A 4P3OA 3ZK9A 3Q7TA 4K9LA 2V6FA 1L5LA 1GTZA 3OJFA 2ZIFA 2DLNA 4MB2A 2ES4A 4NVRA 5KOHB 1FFXB 2I2FA 5DOZA 3L6RA 3NS7A 2VDWA 3O74A 5ED4A 3TGWA 3TBHA 3ZXXA 5D7BA 1XMVA 3ZNQA 3IQXA 3COVA 2XXAB 4HAVA 4B45A 3HCDA 4LBYA 4WV3A 2BKLA 2QVXX 2Z2IA 4M6WA 4MP6A 4MRVA 3NIDB 4EQ6B 1AF4A 4MHSA 2FPSA 3RC9A 1YZHA 1ORHA 1PVVA 2PFSA 2VXYA 3HLYA 4E5PA 1DSSG 3VI4B 1W2GA 1AUXA 3KQOA 4HWGA 1BXNI 2ATVA 2CJPA 4BS9A 1PSZA 2FU5C 1Y82A 1J99A 4KN5A 2ZUCA 2W48A 2OXIA 3IBGA 3V4LA 4BO8A 1J22A 4BO6A 1M66A 3P2IA 4ED9A 1DL5A 2G07A 2OD7A 2Q3BA 3PNOA 1NXXA 1FNBA 2OGWA 3H84A 3PWKA 3S7TA 2HXYA 4KBFA 4LXHA 2YN4A 2AR9A 3U4DA 3L7AA 2LP4Y 1Y6ZA 3KSAC 2WYWA 3ERCA 2V3WA 4IHQA 1RXWA 4ZHSA 1RXIA 4FFMA 1QHSA 1VB5A 4EY7A 1K06A 4JL8A 1Q17A 1W36D 1A76A 1HFKA 1HOXA 3EUFA 1L7BA 1OFVA 1VBNA 2EXXA 2XUZA 1DQPA 3BB3A 4FHFA 5M5BA 1T1EA 5T8KC 4CDNA 3RVSA 5FF9A 1GCIA 1AHNA 1MJGM 5JTTA 2RB5A 4GPEA 3UAVA 2MYUA 1N1GA 3GRYA 2QRLA 1FUUA 3DE0X 2FSHA 4MAMA 5DTEA 3R3JA 2WV7A 1P9NA 1WHSA 1CY4A 1G1AA 1GPAA 1OWLA 1PR0A 1WPXA 2DYKA 3BORA 3DTVD 2P2CA 3JQQA 4LYEA 2XRZA 3I45A 4FE7A 1TYEB 1XTVA 5EL0A 3AVUA 4Y2SA 3EGVA 3ETJA 2QUIA 4PHTA 2Q5EA 4HSGA 2JGRA 4LVOA 5ERXA 4ZYTA 4ZT5A 5KX5A 4JI4B 2Z1MA 3PUZA 5C1DA 3CO0S 3C8ZA 2AG0A 3QH4A 3IOMA 2OAQ1 4XYGA 4H18A 1WHTA 2UUAB 3IP7A 2ZRDA 3IBYA 2VWHA 3L4BA 2VF4X 3LBYA 3SSNA 1TW2A 2EZ9A 5AVTA 1WMAA 1NW7A 2M2IA 3ECCA 1W73A 1Y4AE 3PXEA 5CITA 3SKXA 3F7TA 3WLEA 4D4HA 1LLCA 4S1OA 5KVVA 1H6BA 3ENNA 1T2AA 3O4FA 2DTXA 4IOKA 1TXGA 1G64A 2VT6A 2FPWA 1IULA 1FRQA 2VCHA 5GPBA 5I4CA 1P7VA 2CJFA 3ANSA 3CRW1 3TW4A 4PIMA 1LDYA 5IABA 3NWEA 3ZQ6A 1KH3A 4XJXA 3R8CA 1R8YA 3RVKA 4DL9A 5HGXA 4ZTUB 1PJ2A 1S3GA 3A25A 5DWDA 1XZMA 3WADA 1IEQA 4AQYB 4FT4A 3LKDA 3IERA 2FTKE 1S5PA 4ICIA 4D9EA 5FUQA 3ZHVA 4MGZR 3CUWA 2NVWA 1CJMA 1Z0DA 3OM8A 3VKFA 4BP8A 5B6PA 5BMOA 3IRVA 4EECA 2CD7A 3QE0A 3GLHE 3O9ZA 2JGIA 4YIKA 3A3PA 2QQFA 1V45E 3OJXA 4BWGA 2W2LA 1TLTA 4U0JA 1X70A 1RAAA 2O8EB 1Y1QA 4G37A 1T5OA 3FUVA 2WWFA 2ZIXA 3SZOA 4IEIA 4BGIA 5DHTA 1AMOA 1AZSC 4HB0A 3MMXA 3C3CA 4KQHA 3PDIB 1B15A 3JX9A 1FDRA 1KY2A 1LPPA 3DFUA 3I1YA 1OI3A 3QEKA 3T1QA 2HYDA 3WISA 2PQ6A 2BBSA 3I6QA 4EHAA 5BY2A 2I9KA 3M34A 4KR2A 1BVYF 1C5KA 2FXIA 4OB6A 3IE0A 4ZXPA 4E2ZA 1UC8A 1VB3A 3RT1A 3PFWO 4N49A 1WUIS 4XGQA 1FJ2A 4KC0A 2YINC 5B4VA 2O3UA 2OQVA 4M8LA 1N2GA 2P11A 4EA8A 2Q7OE 4ZOBA 5DNEA 3INTA 4OKIA 4BNNA 5AKKA 2J5QA 2OQ2A 2RGNC 2VHEA 2WJJA 3N6XA 3OZAA 3DXZA 3O0TA 1ULHA 1R6XA 5EIBD 1GT91 4YBZA 3RSSA 1LSJA 1Z7YA 5KPDA 1D2CA 1UP6A 1ZAKA 3DPSA 2VPYA 1XV5A 2POCA 2D8AA 2VZ8A 1M1YE 1XAHA 3ZWDA 4MUAA 4JHLA 1SD5A 3IDSA 1FU7A 4PYNA 2NU6A 3K30A 2AN1A 2I03A 1ODCA 5JZBA 4NK5A 4YJ2B 3GOQA 4G1MB 3LG2A 3WNZA 3C4JA 1E3LA 3KT6A 2C2WA 3Q9UA 2V59A 3RDPA 5TRTA 3ZKWB 3NX4A 4MJ7A 4HATA 3LIPA 3AVWA 4PQFA 3ROKA 2JJQA 1JDSA 3WKCA 4KAFA 4G5FA 2NACA 4WNIA 1CF4A 4JUBA 4NOMA 4ETNA 1H2XA 3I76A 4ATNA 1J9ZA 3M7IA 1XVVA 1XRPA 3KE8A 3QXGA 3N28A 2XWBF 3NM5A 3NIFB 3QKUA 4YBRA 1JDNA 3ETLA 2X5XA 2PPLA 5EPEA 3VTFA 3VR3A 2Z6QA 4HAZA 3T95A 1QH8B 4GHWA 2XLCA 4AN0A 5B4TA 3LKVA 2ZJ4A 3TG2A 4JLBA 4IFBA 3WHLA 5J9FA 4CXMA 4I1PA 3UCFA 1D8TA 1N6PA 5DF1A 2QY9A 1IIBA 1MO6A 3E9YA 1P45A 2G70A 1GZ6A 1J09A 2WF9A 1XA3A 3IV9A 2FRVA 1EUDA 2AC4A 1E1KA 2YDXA 4RSRA 1NGSA 1DIBA 3GUZA 4M76B 4NJEB 3B7WA 4BV9A 3WNCA 1KVQA 3UT5B 4RV9A 2E4YA 4AP5A 4CBVA 1L4YA 4RWZA 4C4OA 2BSXA 1X9HA 1P75A 1QG6A 3R0QA 2VBCA 4TSFA 1DVRA 2QHXA 1DOAA 1R4MB 1JWAB 3HNOA 4FGKA 4O2BB 1CUSA 4R2LA 4NNPA 4E2XA 1BXKA 1WSAA 2JF0A 1E2BA 4IJ6A 4M2LA 1XGKA 1Z4NA 2GN8A 2J9RA 2H2DA 2MT9A 1GQ2A 2OQIA 2QE6A 2IBSA 4OUDB 4RVCA 3EMDA 1BEZA 2WTBA 3WL7A 3EYWA 3L0PA 4OOEA 5CG2A 3A2LA 2PO5A 2OB1A 2EVWX 2I1LA 4LXIA 4AO8A 3KKMA 3M6MD 4OFZA 5T57A 1AHPA 3GDWA 3WWPA 2LCQA 1WXXA 4BPRA 4DJEC 5BOSB 3D5TA 3KTOA 5IT4A 2JATA 3TD2A 2J4FA 4ZDIA 4PSCA 2PGLA 2QNRA 1KOFA 4X90A 2C9YA 4GWLA 4XB6B 3ETHA 3IVAA 4HP8A 2J33A 4RFLA 1ZIDA 4QO7A 3MILA 1B00A 1X8KA 2H11A 4QFDA 5LB2A 3ENKA 1EDZA 3VA7A 4QVIA 3WLOA 2ZYTX 4F4HA 3VVCA 3QVJA 1CK4A 4JVMA 1LNQA 3PC7A 1KYWA 4QVKA 1WULS 1QB7A 2QAIA 4F5WA 4A2CA 4RCZA 2BUAA 5H02A 2C58A 4D4MA 1Z35A 2J3HA 3ETDA 3F3KA 2IEBA 4TS9A 2CYBA 4NCKA 4KV9A 3H9UA 4RORA 1A9PA 1PNOA 4JOBA 1SQSA 4DC9A 1L4GA 4Z4CA 2I91A 2IS1A 3NP9A 2FPOA 1T9HA 4CKXA 1JHDA 2BJHA 1DXQA 3I2JA 4FQ8A 4CLDA 3SZ3A 3KQNA 4RF3A 2I62A 1DQRA 1ICEA 3CXRA 3DE7X 1D1PA 3H1AA 1RWVA 3JD4A 1QPBA 3WV5A 4ZZ0A 3F46A 4G81A 3HXQA 1XYYA 3O4JA 2W2KB 5KNLA 1MABA 2JEZA 4BGVA 3I9OA 3T38A 4FEAA 3SAJA 1Z73A 4Q16A 4CQLA 4CGZA 1CC1S 1RQGA 3NCTA 4U0KA 2LR0A 3ZY2A 4KQXA 3ZWPA 1TAHA 2ZRNA 5CT5A 3HR7A 5I7UA 2VBIA 4EY6A 1Z6TA 2X9LA 1I6LA 3D31A 3NKLA 5JWRA 1YMVA 1EZ4A 4LHYA 4AJJA 5AVQA 1T5LA 4B79A 1J00A 3QVSA 2H4FA 3QUTA 5F1PA 1A69A 3AFIA 3HCWA 4UMDA 3VYRB 1OBOA 3MHTA 4ER3A 4L4RA 3CTPA 3IIJA 5TT1A 2B7LA 4KVGA 1VSTA 2QSUA 5MN4A 3UPTA 2QMYA 3I04A 4N5NA 4B47A 1Z68A 4FFRA 4MRAA 5ICCA 2R7AA 5CEFA 1IHOA 1WZNA 2PTHA 1J0CA 5AMXA 2EP5A 3RWMB 3L4KA 2BL4A 1W93A 2JK1A 4Y0NA 1UWKA 4E5MA 3H11A 4PWYA 6REQB 1O7JA 1UM9B 3IDOA 5GVRA 2WD8A 4YUWA 2AF4C 4QBKA 4X8MA 2GWRA 3SC2A 4U2KA 4BO2A 4GX0A 1SM4A 4R1PA 4EELA 1BTOA 2PT6A 1C1DA 3PCXA 4ZQFA 4GI3A 1UPCA 3SCZA 3FUUA 3DYBA 3K3PA 3CX8A 5EHIA 5G0SA 3R5KA 1K3UB 3FAKA 1E2EA 5IAEA 2VSXA 4HTFA 1WL8A 5GTDA 3NOVA 1RLMA 1U0HC 1C7ZA 4DFDA 3R74A 4HWSA 3NBZC 4G0YA 5A2GA 2PUEA 2C1ZA 2F6RA 1SBNE 3KJZA 1DDIA 3NVAA 2J09A 5CFOA 3OLCX 3MD0A 1M34E 2VAWA 3EF3A 1IVYA 5CW2A 5HGJA 3LF1A 2H65A 3LC0A 1OYOA 4UC0A 2WDPA 2WE8A 4QE3A 2FSPA 3SF8B 1SVKA 3U26A 2WJ4A 3FOBA 2WMDA 2XCUA 2VP0A 4CMKA 4D9GA 4DT1A 4DR4B 3IOCA 2VNJA 4C88A 3SM3A 1QS0B 2VDWB 4RNCA 2H1RA 1JAIA 1VJ0A 2B5VA 1L7OA 1U0RA 3WI7A 1MJGA 4JJIA 3VNVA 2FJPA 2RH4A 4GDMA 4M6WB 4X1OA 1FU8A 1JPUA 4TZTA 3C6MA 5AHXA 5A9TA 4US2R 3PKZA 1AK2A 4WI1A 2VQFB 4A2QA 1M7GA 2YXDA 1RI3A 5IJ9A 3EISA 4H6WA 1B3BA 2PMWB 4IXTA 2BGUA 3ZDQA 3M33A 1DBIA 4JX8A 5KNCA 1P9WA 4BZPA 4OK3A 2F8LA 4N6GA 1GA1A 1P6XA 1WV0A 2GYYA 3EFHA 3IAHA 3KVYA 3NH9A 4PGHA 1RIFA 1WWKA 5HIMA 3EZFA 4H1WA 5LFAA 4DIUA 2UDPA 3G8BA 3GJ3A 3NALA 4KLCA 5GZ1A 1N1EA 2Z5LA 1D3AA 4FCTA 5K3DA 3X44A 1KZ4A 3B3QA 1KETA 4BOYA 5CEEA 4UVHA 4ZALA 4Q18A 4UCWA 1I9GA 3NC4A 4WAUA 4YQFA 5BWCA 3DCIA 5HIJA 1F2TA 3CRQA 5ECDA 1L4LA 4D9IA 4IINA 4ZI7A 2XCTB 3IGFA 1NQOA 4EVSA 5ALRA 1DKNA 4ND5A 1OZGA 2NU8B 4BX3A 5AM0A 4CJXA 4JLDA 2QQ0A 3UWKA 1RZRD 3FTPA 2BISA 3GEIA 4DXAA 1Y8QA 3F49S 4NCJA 2WTEA 1E4VA 5EKXA 4D42A 2IYUA 2IZ6A 4DUZB 1H0KA 3P32A 3THYA 1NQUA 1RP1A 3KZVA 3ZJTA 4NEGA 2HPAA 1F9EA 5K0EA 1D1SA 5KX5B 1XQYA 4EX6A 3FUTA 2NT4A 3ADCA 1SRQA 1XA4A 4OA5A 5K6AC 2PX6A 1JG2A 2HF2A 2Q3LA 4BJ3A 2A8YA 1JR2A 2XB6A 1VA5A 2HO4A 1DARA 1WHTB 5F1KA 2FR8C 2XKKA 2EARA 1FNCA 4CCYA 1CRWG 4MWGA 3W9YA 3G5MA 4DV5B 3BTVA 4FMDB 3NNNA 2ZR8A 5LIPA 1TIPA 3SMQA 1Z3IX 2AMYA 2WU8A 2CNNA 1SPBS 3OZUA 4GNKA 4NONA 3RLIA 5FWYA 3EZYA 4G63A 1DX4A 1A2BA 3AYZB 4GMFA 2GEDA 1LWNA 2I4LA 1LNZA 3O8QA 4MUHA 2X7HA 4XJTA 1XNHA 2VCYA 1YZNA 3ORRA 4GOLD 2ZWVA 3ROTA 2CK3A 4KZPA 2YS6A 2JCBA 1GGNA 3PEWA 3M2TA 3ZE2B 2D2FA 2HIHA 3NORA 4TT3A 3OUZA 4XGKA 1BN6A 4M88A 1L9XA 5T8KA 1ISHA 4Y2VA 1KOLA 5HKKA 3HDYA 3KSMA 1HBJA 4OB8A 1KMIY 3KWLA 1UCFA 3AXSA 2Z6VA 2NUBA 3V1TC 3BWMA 1U9IC 5GAJA 3T7EA 4ND3A 1AGRA 2IXTA 2G1KA 3K20A 4IW3B 2IX9A 5BSMA 4Q7QA 4ND1A 2PSJA 3AL0C 4ZVQA 1HV8A 5EKSA 4BATA 1F5NA 3EUEA 3AONB 5A6VA 5DM0A 2NUPA 2ANCA 2AZ4A 2ZIXB 4FGWA 5EVJA 5A7HA 3PRKE 2I7XA 3WGIA 3R6GA 5C7IO 2H9IA 3LM8A 1NXWA 1G3UA 1LVHA 1ZL0A 3KR1A 4BKMA 2C2BA 2IZ7A 5D7NA 5ICMA 1ZMOA 2BMFA 4GUDA 4ETIA 4V03A 3RADC 1RRCA 1NY5A 2G06A 4G97A 4R9SA 1E1RA 2BMAA 2PH1A 1LDGA 4PIVA 1T2UA 4A6XA 3TDKA 4BQOA 1G16A 1U7ZA 1VMKA 1M6HA 2WIBA 3DC2A 3EGEA 4G41A 1GZ5A 4UDXX 1LU9A 3SOPA 3ER8A 4URWR 1W8IA 2EZUA 1D9XA 4QDKA 4R84A 1YA4A 3VNUA 2D62A 3U40A 4IO0A 3QKSA 4YACA 1CJUC 3H5AA 2DECA 4OYRA 4X91A 1G2QA 2W6JA 4B7ZA 3OT5A 4GYYA 3A31A 2G67A 2RHRA 2H2HA 4LMRA 5CA1B 4DMMA 4OQYA 2FEOA 2GYVA 2OESA 5DT9A 5H83A 1Z4KA 3URKA 2CSXA 1QIMA 5DOVA 2BHLA 1W59A 1EHYA 1DKMA 4XUGB 3V7UA 3QELA 1Z74A 1XZKA 4YGYA 3BRWD 1NDQA 3L0CA 2NG1A 3K05A 1F0NA 3WLFA 3FYTA 4S1WA 3L1IA 3O5AA 1AQNA 8ABPA 3CEAA 2FDRA 5HJ7A 2EP8A 3EMKA 1M0EA 4I46A 3TLEA 2FJUA 4H3HB 3E15A 4F0MB 1ONSA 1RYYA 2CV0A 3NHLA 1Z2OX 2YV3A 3DFMA 1T5DX 2BF7A 1ZQ1A 4L76A 4QULA 4NU8X 4FSHA 4HK4A 5FPHA 4ZYVA 3WL8A 3D6NB 5U4QA 1P5HA 2VK1A 4UE2A 3WB1A 3M3PA 5E2AA 4IKPA 3EARA 4CMAA 1TZCA 3AT1A 3LWNA 3WKDA 4D8VA 1WTCA 2F62A 4C7OB 1EVEA 1DIOB 2IYQA 4KUHA 2WPDD 1IHYA 1GPJA 2P2SA 1MB0A 2XBLA 3NFRA 4KXQA 4QX6A 1DV2A 5C1IA 1RFLA 5JAIA 5IYZA 3K15A 3MOIA 4FYMA 5IDVA 5JEDA 1QRUA 1SNYA 3CPJB 1KZ7B 3KT0A 4PAOA 4C01A 2H1HA 3WQRA 4UAJA 3BE6A 1UMDA 4JCCA 3OZWA 1BW9A 1GIAA 1WBBA 3V2HA 5B55A 5F2OA 1G9SA 1QC5A 1UBSB 3K2EA 3UHOA 1Y6FA 2RHJA 1MJ5A 1Z2DA 2RGNA 4PZ0A 4UEOA 3RODA 3WRVA 1WBDA 1EUDB 1VL0A 5ALSA 4IMIB 1H2YA 1ZHFA 4LE1A 4HWKA 4LJYA 1ADGA 1H66A 4PO9A 3G2JA 5DM60 2ZQZA 3QENA 1C80A 1J8FA 1E3JA 1JTVA 3OZBA 4FDLA 3HLTA 2X8BA 3ROZA 4ZIRB 2C7PA 1KSHA 2I55A 3HXPA 4TWRA 1GJRA 3W5SA 4DKJA 3V1NA 2X4DA 3H4VA 4OLHA 2R4QA 3AKZA 1U3DA 3ZUGA 4UVIA 3MWLA 5B4UA 5HXAA 1QP0A 2P90A 3ZNOA 1YCDA 3HKBA 4MPTA 3TB6A 1LJ8A 2HEGA 4YONB 5FNZA 3WIBA 1WMBA 2V4ZA 2H8KA 4PSUA 4K9PA 3P26A 2WHEA 3VAAA 3ZR4B 2Q0HA 3E9NA 4QU5A 4U2DA 1NJGA 3DZHA 5JCOC 1KDRA 3EA5A 1DKRA 4AJIA 4FEEA 3Q88A 2VF2A 1H5NA 2BHSA 2ZE7A 1GAXA 1PS0A 2FRXA 1WUKS 1GZ7A 1BXGA 2EF1A 3BQNB 4IV8A 4MI1A 3E61A 1T35A 3IO5A 3UTDA 2DUWA 4H7FA 4JROA 3G13A 2O9JA 2PD3A 2XUQA 1OZ0A 1T13A 4I0WB 2HJ9A 1ZSYA 4AWBA 1YZUA 2G0AA 3H3FA 4IJMA 2I65A 4LNHA 1D2RA 2WKSA 1OPRA 3R24A 4LXYA 4LWQA 3ZCUA 4P36A 1CUXA 5HOEA 1EA7A 5KWJA 3BRSA 2MR6A 4BL5A 3MWFA 1KH2A 5IHXA 3N2GA 4NQRA 1KNQA 1PEDA 5IUKC 3NHPA 4K1LA 2J0SA 1JA9A 3OLVA 1KK3A 3ZDRA 4AKEA 5JISA 4J4HA 3DEJA 4B81A 3B6KA 3W8NA 2VWPA 3COZA 4K8OA 1YBVA 1VPLA 1JAHA 2O7QA 1FLNA 4HN2A 4U2FA 2AN4A 1XELA 5EIXA 5CB4F 1V96A 1XK7A 2CXRA 2GASA 1ZXLA 2BE9A 2C94A 3ZCQA 3BGIA 1NPTO 4F1WA 3QU5A 5C52B 1GGHA 1FNNA 1UFQA 3GP3A 1N32B 4DRYA 1YQQA 2XHEA 4DR5B 1D2NA 3OURA 5AVWA 1E1QD 4G24A 2VT7A 1MABB 1R4ZA 1SZJG 3B5IA 3H2GA 4I66A 3R0JA 3ISTA 3AR4A 4YV0A 2HMTA 4K9SA 1N5IA 3FDXA 1NL3A 2G04A 1FA9A 4TLLB 4Z0HO 3V4ZA 5FAKA 3ZJ5A 1ZU5A 3E9DA 2QUZA 4CKYA 1IR21 1KYZA 3LPCA 4OO3A 3BMQA 3NTVA 1NYTA 1J07A 5JVDA 4AC9A 3L05A 3LDAA 2CUNA 3FNHA 3MMSA 1ZNQO 3FRJA 3P9NA 4R6WA 2CV1A 2XBMA 4MWEA 3MRSA 1TO2E 1T8PA 2WTAA 4J9UE 5IARA 4J0GA 3S70A 4RTPA 2NP7A 1NZDA 1HY3A 4KK4A 4TV9A 2Y27A 3MFYA 4EH1A 3FM9A 1NP6A 1XD8A 1Z0KA 4FJ2A 3P0HA 4I99A 1YB6A 1VIAA 3E4CA 1T5TA 2V6GA 1P44A 5FTWA 3HKEB 1P2FA 3ONWA 3RSQA 1OBCA 2XR1A 3IIEA 2IPNA 3KC2A 1V48A 5F4ZA 2W5UA 3FKSD 2VHWA 3E9RA 4OHVA 4URYR 2HT1A 1DUVG 1CZRA 2UVDA 3WR5A 1OTYA 3ROFA 3SC2B 1VIDA 4LV5B 1H2WA 2CDCA 2OHIA 4HH4A 4V0SA 1K7EB 2AI2A 1C1DB 4KLZA 3I0NA 3G8DA 2NZUG 2WSIA 4L4XA 4QTTB 4U2BA 4W7SA 2REQA 2BZGA 4ARIA 4M36A 4HAUA 1M6WA 2WHXA 2BIFA 5JLAA 1E2DA 2IXDA 4HNRA 3A26A 4LE0A 4OCZA 4WXPA 5DTMA 4J0IA 4DMLA 1QQ6A 4Q5IA 3WBFA 4PTYA 3PGVA 3TBKA 1AM4D 1ECBA 2PS9A 3BKWA 1X80A 3HFSA 4TMYA 2FGJA 4JYBA 5ALNA 5LXTA 3JCZA 3SNHA 1PV4A 1Q7CA 2AFIE 3H87A 3JU3A 5LSAA 4YO8A 5AUOB 1HNZB 3LCUA 4YR9A 4PBTA 1BNCA 1WUYA 2EQBA 3OEHD 2Y2VA 3OWXA 3IAFA 2B92A 3PNYA 5HEKA 4DV4B 1JH9A 2UZ4A 1Q1NA 2QMUA 4D9FA 4MDHA 2Z95A 1E6KA 3UJHA 1ISJA 2IP4A 2ZZMA 5ALPA 4DFCB 3I9KA 5JECA 2VDII 5KYYB 3CUUA 5AVOA 4UTNA 3QEBZ 4M0LA 4Y2UA 2FXVA 1G5FA 2OO5C 2PKEA 3MB5A 1FL9A 4HUTA 2DAPA 4GOXA 3UWOA 3C5CA 1KYIA 1FSZA 2AQ8A 1CZLA 1HETA 2E6UX 3EZ9A 1QM5A 2V55B 3ID6C 4RMGA 1DQSA 2E0IA 3WZLA 5IJ9B 1PR5A 5IHPA 4FSXA 2QI9F 4U5XA 1AS2A 1JJAA 3FIUA 4JBGA 2IIBA 5EC8A 3OQIB 1GDHA 2HDWA 1JSXA 2J31A 4FIDA 2VDVE 4H7EA 1E2KA 4I8XA 2TSYB 4J0EA 3HM2A 4RVGA 5CYPA 2G6BA 3HJCA 5EESA 2F8SA 2ZYVX 3R3YA 4MW0A 4YXFA 5GADl 2YWBA 2R6FA 1O6FA 3IB6A 2YH2A 4AW9A 4EJSB 4MRMA 3L92A 3UUGA 4OOFA 5EQJB 3BK2A 1VTKA 2WAMA 3W7VA 3W5HA 3HCBA 1RAHA 3GJZA 5LOVF 2J59A 5IKOA 2YCLA 2OPHA 3OMXA 4RAOA 3K70D 1T9GR 4WECA 2NVUA 2P9QA 3HBJA 3HDQA 3KZCA 3SZMA 4ZI7B 5BUSA 1KEKA 5EJ2A 5MDHA 5G41A 4TTQA 1V6SA 1Z33A 3RU2A 3TW0A 2HU5A 2HGSA 3NT4A 1UM8A 3LZDA 4D1YA 4D4IA 3R1IA 2ZCJA 1NVBA 1OGJA 2FPKA 1MJNA 2H7VA 1Y8QB 3GRFA 4KXXA 2B34A 3QHPA 2DTDA 4HZUA 4I9GA 2OBXA 3C7TA 3T4PA 2WVGA 1LK0A 3HCEA 4FYKA 5CB0A 4L78A 3JRXA 2YWRA 3THYB 1ESDA 5C7YA 2H4JA 3ACCA 4ON9A 4KUEA 1QAQA 4LDAA 4RJIA 4LNUA 1WCWA 5DCUA 1YB4A 3AHFA 3RAPR 1G5RA 1ZGGA 2NO7A 3OE1A 2XE4A 3PYLA 5K8CA 3E9ZA 2UVQA 1Q83A 1LLUA 3GVXA 2FPGA 4MJXA 2ISCA 2DSNA 2D2XA 3MCWA 1A9TA 4LJ4A 3CU5A 3TR6A 4D57A 3I5AA 2BGJA 2C1EA 4EVIA 3CG4A 3BCUA 1VFPA 2BFCA 3OE7A 3TDMA 4F21A 1MB3A 1ZVQA 2IYPA 3O8QB 3ZQKA 1L7AA 3P97A 1P1CA 2QN8A 4YJKA 3FD8A 3SJAA 1PT9A 2EKBA 2WFLA 2HC9A 1M67A 2ZAOA 3OOYA 4MROA 2UUOA 5FBLB 3V3KA 4R2KA 1PUXA 3DXYA 5JHHB 4RACA 3PFHA 1SKYE 3PE4A 1E94E 1KPHA 4CEHA 2XQJA 3O6VA 1TF7A 1G2OA 1XALA 2VBFA 1SVSA 2VXOA 3FNIA 4KGDA 1P9OA 1V3UA 1EIZA 1GAJA 3KV3O 3OP1A 3TLZA 1Y34E 1BAPA 2CEKA 4QWMA 1OX6A 3L4EA 1UKZA 2C92A 1XNJA 1R37A 1S2IA 2Y9MB 4EO9A 2PSSA 3UMRA 2I76A 4R54A 5IZ4A 4PYOA 3N2NA 1PGQA 1QTRA 3B3FA 4N54A 2NUPB 3VFDA 3K1AA 1H2HA 3ZV7A 4DBZA 4UMVA 5KJ6A 3SS9X 4WCDA 1YDMA 4W5TA 3NPAA 5K6AA 1AKYA 2BONA 5E6SA 5HCNA 4OF4A 2C8VA 2HHCA 1PTKA 3FZYA 4YRPA 4F2HA 1OX5A 1PWEA 2OGTA 5F21A 2J85A 2AXQA 2FR8A 3T1TA 4B0PA 1KF0A 2G77B 5FAXA 1UAGA 2I3BA 4F5YA 3U44A 1KE1A 3SIWA 2VT3A 2N0SA 1IQUA 4ZCPA 4RO0A 5HOQA 4ZV4A 2IW3A 4X8HA 1IXRC 2MU1A 3RARA 4ALLA 3VR5A 2NXJA 5K45A 4YTEA 5DYTA 5FLEX 3CZCA 1OXMA 1YGPA 3ME5A 3QKSB 3HB5X 1Y80A 4D82A 3ZD7A 1XRNA 4XIYA 4N01A 1E58A 3M3DA 4EI2A 4GKBA 2ZJZA 4RABA 1L5ZA 2PZEA 4OG2A 4AECA 5JZMA 2V0GA 4YAWA 4WY8A 2ZGVA 3I5MA 1M10A 1NSYA 2W4QA 3KUKA 4EKGA 1D7AA 2QJOA 4AJEA 3O1LA 1CVRA 3ZBTA 4ANFA 2RK3A 3QELB 3STHA 1FDIA 5ALKA 3EZNA 1VJTA 2GB4A 3ANTA 1JEJA 4ZVUA 4H77A 1UEIA 4YMSA 3TVYA 1AQLA 4C1BA 4OAQA 3SZUA 1D2HA 2I4MA 1X15A 2VZ9A 1FYVA 4FYPA 5EQDA 4OBWA 4YJ3A 3UB4A 3I42A 2W98A 3K4PA 2PTGA 4R1MA 4WXRA 1L6IA 2YWHA 3VZSA 3W06A 4BJ5A 2MSCB 4L73A 2P2ZA 3PEEA 3QF7A 4GP9A 4CT0A 1OXSC 2ADFA 2HJRA 2W4IA 1ZIYA 3D8UA 4OHUA 4B43A 2ISSD 1I2BA 2BKUA 4B6JA 2AVNA 2WE7A 3ANLA 3CNQS 3IUJA 5TNXA 2WBLC 2B20A 2WNSA 3Q1LA 1I30A 1CNEA 1EB9A 4S1NA 2HRQA 3ZW8A 1PEKE 4AZVA 1DX6A 3T99A 3R75A 3VNSA 5IYZB 2C88A 4CMEC 1IL0A 3IT2A 3KJEA 5EYPA 5CVDA 1K68A 2WA1A 2JVIA 5D85A 5E3JA 3JAWA 4BQIA 4JGIA 4M1TA 3D6HA 4HLCA 5A5VA 2B9VA 4V02A 4GVLA 5EKDA 3K2IA 1QC5B 3S2GA 3E03A 4J9VA 3M6LA 1Z56C 4YRAA 1Q7RA 2O54A 5EG5A 4XAQA 3QW2A 4M1OA 2NSLA 1EJ6A 4PX2A 3IKMB 1GNTA 5GQSA 4MUEA 1UMBA 1WP4A 2O7SA 2ZSEA 3FZGA 3BICA 1RKUA 2HX1A 3MJHA 4O2RA 2QRKA 4LJ5A 1L3IA 4C3VA 4QTXA 1HKUA 2WILA 3E7DA 2J9XB 4L9WA 5ETJA 4NBKA 2Z04A 4XDHA 4QPDA 2DE0X 3PG5A 4L0CA 3OJCA 4IIBA 2PUGA 3G8YA 1TZ2A 2AYZA 4QPCA 1YHYA 2X58A 3FWHA 2JFUA 4Q37A 2J3EA 1DNPA 3IJEB 4NPCA 3VR0A 3K9NA 1ZK0A 2PGJA 3TZHA 2WJ6A 2OZEA 4WE3A 3WMGA 3TS1A 2JAOA 2ZREA 4LYGA 2RC5A 4YYEA 1HSZA 2XCSB 1F1BA 2E2WA 2WTXA 3AZQA 3PC6A 4KQMA 4FYIA 4RPJA 1TM4E 2I87A 1UDBA 3UMVA 1UP4A 1LJLA 1PLJA 5JNSA 1PS8A 5HRUA 1GGMA 3LKBA 1AHIA 1N8NA 3P4UA 1BXGB 4CLEA 5LDHA 3QBDA 2WM3A 1L4BA 5AFSA 1X1SA 3L7JA 4R51A 4L75A 1DOHA 3S44A 3RS4A 4AMUA 2GZHA 1JLMA 1L5FA 3A1CA 4ZYWA 4RANA 1A7KA 1IUKA 3BXHA 3QX8A 3I9JA 2W22A 4HDCA 2EBWA 2VJMA 3HJNA 2O2HA 5CAEB 5I3ZA 4D0SA 5A3QA 5TEVA 3NYQA 2C5GA 1K8RA 4G4GA 3RJ9A 1SCNE 2OCLA 4RHFA 1XPRA 2SBTA 1H0HA 2ZTSA 4I4TA 4LGYA 3TLMA 4J0DA 4UJ3A 5HFNA 1E98A 4DG8A 5KTSA 2JAXA 3N53A 2CVQA 3S8MA 1C9JA 1KARA 3L7BA 4XM1A 2GRAA 2PXAA 1FTGA 2Q4DA 2JLSA 3CX4A 3MCUA 1SOVA 3N86A 3GH3A 3JSAA 2FWJA 4QGBA 3LGXA 4MJ3A 4X3CA 4DXHA 1EVLA 1PT5A 1BWSA 2HRBA 4GGPA 3RTGA 4TMTA 2JFFA 5JAQA 1E3IA 4MQLA 2IPMA 5GY7A 3F9IA 3KAJA 3BWXA 1EWYA 3K5IA 4ZQIA 4C6TA 2Q6OA 3GCXA 1DEHA 3KYDA 4P6VF 3DVAA 4LZAA 1YZKA 5CNMA 1NBHA 1CUFA 2OSVA 3OX4A 3QWIA 4H17A 2QGZA 1NW4A 2AQHA 1YT5A 3PQ2A 2IH5A 4UOZA 3AMVA 5A04A 4Q03A 5LQDA 3FOWA 1A9QA 1O5IA 2B0JA 2NO5A 4OQQA 1YZVA 1UWAC 1GKKA 1QYCA 2ZRPA 1BGVA 3HDJA 5JVDB 4EJ0A 1TTHA 2F67A 1AO0A 1EQ2A 2GCIA 1GNPA 2QZ9A 3KKLA 4Y2JA 3REQB 1P91A 2UYQA 1KI3A 3V2IA 4CUKA 1ZR4A 4UEJA 2IY9A 2IF2A 2XIJA 4PO1A 3Q98A 3LBHA 2O6HA 3W2EA 7ABPA 2JIMA 3LOQA 5BSKA 3UMYA 3VU3A 5D5HA 3TYXA 4HYYA 3UMFA 4ENVA 4B4VA 1M2GA 5BR7A 2JJ2D 4ZJZA 4UNQA 1R0RE 1SB8A 3C3JA 4PPFA 3H4IA 4YJDA 4AM8A 5HQTA 1UK9A 3U4QA 1VL5A 2OHHA 1W2HA 1QRSA 1PSWA 1UXJA 1Z13A 1Z8NA 5CPBA 1L7EA 3PPIA 4UW9A 5EPUA 2VA8A 4DSZA 2DKOA 5H1YA 1KPIA 1XDDA 3GT4A 4OJKA 5G0TA 5DYWA 1RC8A 2IIPA 4Q47A 4DCGA 2REQB 2HPHA 3JYOA 2G9RA 1JQEA 4V0ME 4JUCA 1NMSA 5DVZA 3AEXA 4OYYA 2EJCA 4ND7A 4JIGA 3ZTTA 2LDXA 4EW6A 2WJIA 1D0IA 4ZGBA 1RBQA 4G9BA 1EFTA 1F48A 2O1WA 4BX9A 3JWPA 3UENA 1JEDA 1I2CA 3TMYA 3AJAA 3P0FA 4AMZA 2R87A 3ZE9A 2JIOA 4O5AA 3TEMA 4DVJA 1FRVA 2V96A 4AUMA 5EJMA 5KQPA 1MTZA 2AEJA 3AL3A 3EDRA 1AN9A 3LXXA 4W4TA 4YB8A 2I0FA 2OCDA 1YRWA 5GWXA 3ZNNA 3ZVRA 4DLKA 2BFBB 2XQVA 4EW3A 4TKVA 1RLJA 1TM5E 1VG9B 2PRJA 2VK2A 1LLFA 2ZUWA 3G89A 2HLPA 3OCUA 2H2GA 3ORYA 3PXGA 4YV7A 2GBGA 3ZGOA 1V1MB 1ZICA 1VI5A 2AJLI 1K9SA 1MNAA 3VJKA 3E5MA 1YFLA 1GGVA 1CBUA 4XD7D 3HS3A 4JQCA 1UXKA 2PNFA 4KU4A 2Y6UA 5AK5A 4INAA 3WK9A 5FUXA 2ORVA 2ZQYA 1GYPA 2Y66A 3B5JA 3T41A 3QYJA 3QXCA 3U62A 2I66A 2QL7A 3JATA 2VYCA 4ZQGA 2NUTA 4EJ6A 2FSIA 3QKRB 4QUKA 2C7BA 4C4TA 4DAEA 1C3OA 2EBUA 2JFWA 5COBA 2GN6A 1N3BA 4FWIB 3OO1A 5IC6A 4NPHA 3UUEA 1RQLA 2WQZA 4MRMB 4NYMR 4R9VA 1PK8A 4YRLA 1HLFA 5IBRA 2HD4A 5JZ9A 2RIRA 4PU0A 3HABA 2CCJA 1SC6A 3KQQA 1QLHA 2FZKA 3A9RA 3GJYA 4KO2S 3SS7X 2DHCA 2NTNA 1JDBC 2YW2A 1R15A 4RFSA 3RU3A 3EPHA 2WM2A 4UCFA 2OZVA 1ZYUA 2QVLA 3EEQA 2GZ3A 5CVVA 3DO6A 3NRJA 3X1YA 3AKYA 1YTLA 4D0LB 3PUYA 4W8GA 3QY0A 4M9SA 5LZ9A 1H42A 1ZO8A 1ODIA 3O8OB 4WOPA 1A8QA 1H8HD 2FI1A 3FZQA 3K8ZA 1LQ2A 5CIWA 5IAKA 4UM9B 8ATCA 1TDJA 1ORWA 4I14A 3KPYA 4KFRA 4DE5A 3KUDA 2H1WA 3L9WA 3ZZ1A 4I5DA 2JFPA 3EY9A 3GP5A 3I8XA 4HZUB 3NDJA 4DSOA 2X6QA 4W5QA 2OO5A 2GBPA 3CZ5A 4YUVA 5DYGA 5IAOA 1VJ1A 3KYCB 2GVDC 2LNDA 2F9LA 3VZPA 4LNUB 3COSA 4JJEA 4NYIR 1P29A 1T2FA 4BVHA 3KEQA 1HXHA 2VDLB 2FFAA 4PF1A 3WMEA 3HDHA 2FPGB 5LNK1 1Y4SA 2O4UX 2ZSAA 2Z98A 3PNSA 3CT6A 4AO6A 4A82A 2ZRAA 3BC1A 5E7IA 1RRVA 4OQLA 1ESNA 1EGHA 2ZIWB 2NOAA 2IYSA 2F9MA 1RI2A 2A86A 1H2FA 1R66A 1BROA 3DDHA 4D98A 1GLNA 4DR3B 1CZNA 3IOEA 3HU5A 5AIBA 3PBKA 1KJZA 1WP9A 3ZEIA 2O1SA 3IAAA 2WFLB 3DM9B 4BZWA 3C8MA 2J0QA 4Q1DA 3FY4A 1VIVA 3VDQA 3AF6A 1DCTA 5AI6A 1JKJA 4QXPA 5EJ6A 1SXJB 3SQXA 2XLBA 4Q1CA 1ESEA 4JR2A 4RJJA 3HR8A 4CEHB 2VJQA 4M9UA 4N6NA 4PZLA 4DTCA 4DSAA 3DBRA 3TBFA 4DVGA 5K0TA 5AWFC 4AY2A 2VLIA 3O84A 4NFSA 2G1AA 4XVHA 2FMKA 1Y3IA 5HHTA 4IJKA 2R79A 4OK6A 4WEQA 2QTVA 3S55A 2VTVA 3DWIA 1NRXA 1B0UA 1T0IA 4G0OA 1O03A 1G8JA 5AHOA 5TE9A 2WWGA 5G53C 3VUFA 1PD1A 3IQWA 5DHQA 4OI0A 2YVKA 4D8XA 2JKVA 5EMNA 1XMIA 1TUEA 3OF3A 4RSHA 1VQ1A 3V34A 1HLGA 2B7CA 3SR3A 4B2IA 5DNAA 1BDJA 1QE3A 1QOQB 3ACBA 1OFTA 3D6MA 3Q8WA 1T8RA 3G5AA 2PLAA 1DJLA 4D7AA 1YR6A 4HN4B 3L8ZA 3GA7A 3H8WA 3IQGX 3KWJA 2V6AI 4BO1A 2PN1A 3U44B 3H2YA 3I32A 1U94A 3VSBA 3DP7A 2IYWA 3FYUC 2ZBDA 4IOMA 3K92A 2D5BA 3TSWA 3CVXA 2AMFA 1WCIA 2DM6A 1S8AA 1BGXT 2DFPA 1SBIA 4D6YA 3MAJA 4L1KA 4XXHA 3V00A 1ZKMA 4LQCA 4U63A 4I9HA 4ECAA 1Y8RA 4P7JA 1QX4A 1KI4A 1Y9EA 2BGRA 2AMVA 3VZDA 2NZ2A 3MJ4A 3N7UA 1ZMXA 1P1JA 2IHTA 3C6QA 3HUDA 4M9QA 5AK3A 3UMJA 1XZIA 5AW3A 2ZUFA 3TKLA 5THXA 5CP8A 5EOVA 4NMHA 2O8CB 5IP5A 2XUAA 5K0NA 1K7YA 4Q48A 4WUTA 3RAEC 4AI6A 4GX5A 3E9MA 3P9QA 3FNBA 4M1MA 3UV3A 3G2IA 1N8KA 1YS9A 2BKXA 2YR0A 1HDIA 1PT7A 4W1RA 3UK2A 3WVNA 5DJ5A 2OVFA 2ODPA 4YJ3B 3WYBA 4LK3A 3R7FA 4OIFA 1EWQA 3AM5A 2KYRA 4LW8A 4RZ3A 3GN1A 4GQAA 2ABWA 4RK7A 3R41A 1AGXA 3KVNA 3NHUA 4WASA 4YJFB 5H81A 2HF7A 3WGGA 4ME6A 2AX4A 5BMVF 3OKFA 5IPFA 2JBHA 2RHHA 4WDRA 4F3YA 4GR5A 5K20A 3NCHA 4HLUA 5U9CA 2BGWA 1MDFA 1XMSA 4AZSA 4UBLA 1DRWA 2JKZA 2QLTA 3GXBA 4OMDA 3IVXA 2QLMA 2JEYA 1GAWA 3GRUA 4QNNA 3EFEA 5AK0A 2YX1A 1PWZA 4FOOA 3A3NA 4E2WA 5H4GA 3GLFA 4B34A 3ZXUB 1NJ8A 3G02A 3R7WA 1OPXA 3ZV6A 2DRIA 4QSMA 2PMEA 5I51A 4JLAA 5EYPB 1W52X 5SY6A 3JAWB 2WYHA 2QS9A 2IYRA 3KG2A 3GO4A 3CR8A 4O0MA 1GTSA 7MHTA 4MQBA 4ACBA 3MT8A 3BF8A 1NI5A 2JDID 1XTIA 3RVDA 4QATA 4FE3A 4MVJM 5KJEA 1SKMA 1JEYA 3NMUF 1E79A 1ZNXA 3NUZA 3NNSA 2MJLA 2XI4A 4JBWA 1AVTA 2B4AA 1O4VA 2GZAA 3HXLA 5JWHA 2C42A 2PZGA 1H93A 4J6EA 4E14A 1FYFA 1AS3A 3ESRA 4G0NA 4X92A 5CNJA 5B2ZA 3TCNA 1KEVA 4RGQA 3EUAA 4BQRA 4E22A 3IBCA 5BT8A 2J1LA 3BDVA 3LPNA 1N5DA 3E3MA 5BR1A 2AR0A 3N8KA 3GLQA 4KVAA 3NLLA 3UJ8A 1FS4A 3W8DA 4WXHA 4L0MA 2JC3A 1RRMA 5ANRB