3U4MA

Crystal structure of ribosomal protein tthl1 in complex with 80nt 23s rna from thermus thermophilus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna/rna binding protein
molecule keywords 50S ribosomal protein L1
publication title High-resolution crystal structure of the isolated ribosomal L1 stalk.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 67
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3u4mA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u4mA02
3TG8A 5DM70 1AD2A 4QVIA 4QGBA 5DM60 1ZHOA 3UMYA 3U56A 1U63A 1I2AA 4QG3A 4DFCB 4LQ4A 4REOA 2HW8A 3U4MA 1DWUA 1CJSA 1MZPA 4F9TA 3ZQJA 3FPNA 3QOYA
chains in the Genus database with same CATH superfamily
4DBZA 4DIUA 1O0SA 2CLDX 2IOFA 3CH4B 1E7WA 4EUFA 4F2DA 1HM5A 3K9FC 4WASA 2XCOA 3PUHA 4ARSA 3MT9A 5ARBA 2EFJA 3MXOA 4QDZA 2GK7A 3Q8MA 1DTEA 3UKDA 3OQPA 3S1SA 1EEXB 1KEUA 3L84A 3IEXA 4IDBA 2QAIA 2IZ1A 1KC1A 4UBJA 4PX9A 4BO5A 5JXWA 3ONEA 1ZSNA 2YXEA 1ENYA 1JAHA 1ZK2A 4I4CA 5FL7A 2JLYA 1LW7A 3MQFA 5CVTA 4PEVA 4JI5B 3U40A 4CMIA 4JMPA 3UAZA 3H0EA 1NUAA 2J87A 2WKQA 5BSGA 2F90A 2QZ4A 3PIDA 4HDRB 1SC1A 1JHPA 1NSFA 2OYRA 1NRIA 3TCKA 1Y6RA 3KYCA 3QUAA 3SOZA 3P0FA 3OU7A 5JASA 1EBFA 1M1YE 1JR3E 1JG6A 2VYFA 3INNA 1AD2A 4YMIA 1ZGJA 5DGDA 5ALMA 2ONJA 1J07A 2PZFA 1PWXA 1I4LD 4PPFA 2JFYA 3WP1B 4WLVA 4XM1A 4F3TA 3LFTA 4JA2A 1ZJWA 3IUPA 1RYHA 1G7CA 5FUBA 4D1YA 1IJEA 1JBKA 2XCRB 2Z09A 1KIAA 1NGSA 1Y98A 1H4QA 4GQIA 1Z2DA 1JVBA 2DHQA 2OTCA 2Y27A 4E08A 3ANXA 3IH5A 2BZSA 3IUQA 2QX8A 3OCCA 3L4JA 1KGSA 1W87A 3SZRA 3PLAE 1K06A 4A6PA 4RU1A 3CCCA 4JKOA 4F6RA 1RZRD 1WZ2A 3CNHA 1VPWA 3PDIA 3UICA 3RFXA 3KQKA 4R3NA 3UKJA 4HAOA 1G0NA 5ALWA 3L0YA 4AWAA 1C5KA 4RY9A 4JLOA 1Z35A 1K0UA 2PRZA 1WUJS 3DMGA 1EXDA 1JALA 1N2ZA 3MTQA 3VR2D 4JDUA 5GVSA 1ORRA 4GBJA 2BGIA 4YJ2F 2I80A 3NQ41 1HG0A 2PZKA 3HHPA 3IC5A 2Q3LA 1ZH4A 1ZD8A 2EFYA 3KTOA 4L9AA 3U16A 2BSAA 5C7OO 2QRKA 3B5IA 1SU6A 1V45E 1ATZA 3IELA 5ALKA 2BMAA 4LDQA 3DYIA 3T5AA 4EPXA 4H6VA 2ZYGA 1E59A 3MERA 1KQ3A 2IC5A 2BY4A 4LBYA 2NQ8A 3JWEA 3ZXYA 9ATCA 4B5KA 5JT1A 2AFVA 4IDAA 5A02A 4C4AA 1TLLA 1VHTA 4V0ME 4QBTA 3EG5A 3GMSA 3O6VA 4COOA 1BS1A 4HH1A 2UZ0A 4DOMA 3H2GA 4WINA 5KYUA 2I1LA 1PR9A 1CJCA 2ZWAA 2JS7A 3Q3JB 2GM4A 4J1NA 1KI3A 2B36A 5J4KA 3IGFA 4PQRA 3R0IA 2BTEA 3O0TA 1OY1A 1YNOA 3FNRA 4FU0A 3LGAA 1VDZA 2QGZA 5ALGA 2Y1DA 3NTOA 4M76B 2HMTA 1JSZA 5LZ2A 2ESRA 3WOVA 2QRJA 2Y8EA 3DDOA 2QQ0A 2AI3A 1A3CA 3H3FA 4PZDA 4JGBA 3OWHA 1U11A 3FTDA 4IGAA 4J0DA 4X91A 3W0LB 4YROA 5FORA 3CJTA 3U49A 1W5SA 1ZINA 1S2GA 5EMLA 1P8AA 3RWMB 3A31A 1AA1C 1VE6A 1UOQA 1FRZA 3KQTA 2XMSA 4G8DA 4ZO7A 4BX3A 3P19A 5KTSA 3KR0A 1Y6QA 2J07A 2W2VA 5I9TA 3RUDA 1OTYA 3GA7A 1PZXA 5E3JA 1QV6A 2OCKA 5CHEA 2JBAB 3TZCA 5BN5A 5C46F 1AXGA 4NHOA 5AI0A 1R0RE 2HZ7A 2IA5A 2WIDA 3AHIA 1Z63A 2QD5A 2MSNA 2YFQA 3S4YA 4C6TA 2WIFA 6PFKA 2JI8A 3DCYA 1QP8A 1SCKA 2WJJA 3VR4H 3EE6A 2VH1A 4IFEA 2B30A 5T8KA 4MQFB 5GOZA 1K5PA 3SHWA 2DJIA 1TU4A 3WL5A 1VJ5A 4G9EA 4V0LA 3THYA 5HK8A 5CJJA 7ABPA 2OB1A 3RUFA 3V55A 2C4KA 3RK1A 3O8NA 2GBLC 3VMFA 3BB3A 2J3KA 2NXWA 3RRBA 2IHKA 3GO4A 3UCEA 3LWDA 4MVXA 3F4LA 3F71A 1AM4D 4CWAA 2GEVA 2OQ2A 3GVIA 5AVTA 3O4GA 1OI3A 4YO7A 2Q4TA 4HX5A 3UQZA 5F23A 3H11A 1S6YA 3M7IA 3EDYA 2BT4A 1CNEA 4N39A 3NC4A 2FHSA 2YQZA 3D0OA 4BNHA 4U7PB 5FPQA 1AKRA 1H3EA 5EESA 1F0NA 3BWDD 2F43A 1W0JA 4FFVA 2FXIA 5DBIA 1RP1A 1VJ0A 1Y1PA 4Q1CA 1KS2A 1MMFB 2P69A 4BP1A 5E6RA 4D9EA 1FFXB 3GRKA 2JVIA 2QR3A 3KLBA 3I05A 3PJGA 4OM8A 5K0JA 1BFKA 1NNI1 4G09A 1N57A 3FBTA 3GRYA 3USCS 1QFMA 2HZBA 3ETLA 3FPHA 3THWB 1EWQA 1JEQB 3DWGA 4J1TC 1V5GA 3OX1A 1CC1S 4YNBA 3QOWA 1E8DA 3TXXA 1E1KA 3DT8A 4HQLA 5K8TA 2PFKA 1UAAA 2E1PA 4LGCA 1J0DA 2QDKA 2OM2A 4GMFA 1KETA 4LF6B 4NBVA 2R8OA 2G08A 4DDMA 1LVUA 1G5IA 3C3AA 4GPTA 4KE7A 1AHHA 4X95A 2X40A 3NVMB 3DKKA 3BERA 3ELWA 1IN7A 1Z36A 1GKYA 3KOOA 3PS9A 4KE6A 5CNJA 4URUR 3UXHA 1TK2A 4BS9A 4YRNA 2OP0A 1ESZA 4JOQA 2G8NA 4FYJA 1XRPA 3C6YA 4EA7A 1QHHA 4PBRA 1RM3A 3G2MA 2IL1A 1KK2A 3FHLA 3GRAA 1U7XA 3H5LA 1PRYA 1QE3A 3SKYA 4D42A 4DBLE 1Y33E 1GYQA 1YR2A 1DQPA 4D6YA 1TQ8A 2I65A 4J9UE 2ETXA 2VZEA 4FR5A 3LMKA 2V96A 5FR1A 3RWBA 5JS1A 4NFYA 5EZ6B 3OJXA 2V7GA 1GOTA 1QNFA 1ZVKA 4PBTA 3GCGA 1UZMA 3LX4A 3WL7A 3UVEA 1SOUA 2IODA 1ZEJA 4LXGA 4ZQIA 3TZLA 3FNQA 4DZRA 1VLVA 4YK7A 5EQFA 4W5RA 1JHRA 5FPSA 4O2AA 2AMLA 1EJ6A 4YRRA 1ISGA 2PX4A 2N1BA 1EFUA 4HQOA 3KHSA 5KSYA 1G38A 5JQGB 2RHLA 1Q91A 4IHAA 4I4NA 2EG5A 5D84A 1DINA 4HO1X 2VDJA 1DEXA 5AW1A 2O50A 4RVFA 5E6UB 4LPSA 1XEWX 2WFZA 1KAEA 1C3XA 1XK6A 1MJNA 4B8YA 2BRUA 4RSHA 1WM1A 3O8QB 1SWVA 2O2EA 1JTVA 2EDCA 2EWVA 2FPMA 2PZJA 3IMKA 2ZU6A 4XX1A 2MCFA 3ZTTA 3K0KA 1V7PC 1U8AA 1GG5A 4R9SA 1PT9A 3LRPA 1N6NA 4CMAA 4DT1A 2YBEA 4I8DA 3AG6A 4B73A 1OX4B 1NUUA 2PNFA 5FEUA 4ND3A 2Q8QA 1RCTE 3DOCA 1ZM2A 4FWBA 3RTGA 1IC6A 5FTMA 4IQ0A 4ARZA 2NO6A 1T8WA 5BV0A 4PO3X 2RMKA 3M9XA 4W5WA 3SYRA 4P86A 4LF4B 3GLRA 4R16A 3VR6H 3B9PA 1CQXA 1G8JA 2V54A 1SCBA 2OCBA 4MQ4A 4Q39A 1G2QA 4QPPA 4YYZA 3TQQA 5EZSA 2HU8A 3HJBA 4QQRA 3F6CA 3B3QA 4BMCA 1KYVA 3G0DA 3RADC 1UZDC 3D8SA 3GEEA 3KIPA 3OH8A 2ZTHA 1E62A 1UIMA 2BGLA 4C01A 4ON9A 4ONEA 2B8EA 1FVFA 4ENSA 3WMGA 4FMPA 5C8YB 3Q1LA 3QHQA 1KDYA 3P9SA 4N0DA 5AR1A 5JBNA 2DZDA 4GC5A 3NWEA 4UE6A 2O8BB 3JYOA 4WCFB 4IJMA 4R6WA 1DSSG 1HFKA 1TKBA 1OC4A 3FUWA 9GPBA 5C51B 1VJCA 2N42A 3V7WA 1DL5A 1TT7A 4W5HA 3KYBA 4NMLA 3UV3A 4B9AA 4KFUA 3U3XA 3BXOA 1KI1A 3CJQA 3SYKA 2NXJA 3ZWKA 3PTAA 5FOSA 1L5QA 4KIWA 1KYWA 2AF3C 4WV3A 2J7PD 3KEOA 1PU2A 3PJDA 5AHWA 1H6BA 1CX9B 1GQSA 3M6UA 4HWRA 1DUIA 1RC1A 4ZRMA 4ZAZA 4RVCA 2F48A 3KLOA 3T38A 4AQDA 2GM5A 5GPBA 3VFDA 1K6EA 5IUKC 1R9MA 1IZYA 4O2AF 1CT9A 1KYIA 2Q6TA 5HGXA 1U2PA 2J46A 3WLFA 2BC9A 2EBUA 5KVVA 3Q8XB 2RD2A 1CFZA 2H4WA 2PD3A 1XXHB 4HN2A 3V1LA 2VDWB 4KQXA 1AURA 1HC7A 2YYZA 1PR4A 5B3JC 3O0DA 1W5TA 2ZWIA 3MT0A 1NURA 3Q0IA 5JAOA 2VAPA 4OOEA 1F51E 2OILA 3Q9NA 1ZA2A 3X1XA 2BEWB 2YTZA 3S55A 5CAEA 3ZW9A 2H4JA 1N32B 3N6XA 5DM60 3EEYA 3HKDB 5G2OA 3T15A 1PJRA 1CRPA 1ULBA 1U90A 2FPIA 3PD1A 1VMIA 3NBAA 4WECA 3DZKA 2YYAA 5BPHA 1JXOA 3COWA 3EC2A 3L7KA 4OXIA 3SM3A 4GXQA 5B2ZA 4AP6A 4B80A 1KBOA 1S8AA 4MV7A 4E4YA 2OUIA 4LTNA 4TV8A 3AEUB 4G5OA 5GGYA 4KNYA 2C97A 2VK4A 3EX7C 1ZUWA 3DMYA 2VWGA 3KKPA 4O1IA 5JBIA 5LDHA 4RKRA 4BB0A 1IHPA 2JDIA 3VYRB 2G9UA 1YQWA 4M1SA 4BKQA 4X1IA 5EGSA 1ZA1A 1MFZA 1P4AA 1JG3A 1MABA 1O7JA 2XE6A 3D54D 3LQ1A 3G89A 1XZKA 4RO0A 5HKKD 4YP6A 4QUDA 4CKBA 2M1XA 1C4XA 3QBEA 5EUCA 1L6IA 3ZU6A 1IY1A 2OHFA 4RCZA 1CSEE 1M7GA 4D0LB 1U4NA 1WZIA 4HDAA 2QNBA 3B78A 5K3DA 2HHAA 4WACA 4XD2A 4C7JA 1YRAA 4TQ9A 3H2ZA 1Z2OX 1ZCZA 1A88A 2BF7A 4NBLA 4TLCA 1NJ5A 5D7BA 1J5EB 3LY7A 2OCLA 4NY1A 2V7QA 1FYVA 3HJNA 5FKJA 2CLOB 3VDMA 2D13A 3F2VA 1FJ2A 3OQ1A 1Y5MA 2A78A 3LFHA 4R2JA 1XKQA 4JU9A 4D9JA 3BT7A 1AN0A 3L01A 2J5QA 4PLZA 5IX8A 3CW9A 4ETNA 2FSFA 4FDLA 4ZVOA 1VFPA 5DXJA 3FMVA 3QX7A 4HVLA 4QTYA 5DW0A 5IHPA 1PK7A 1TCAA 4MGIR 5FX2A 1JEJA 1K8XB 1K7YA 5M3BA 4Y98A 2P5YA 2ZOSA 1CEXA 2G7MC 2R11A 4M60A 3BE4A 4KI7A 1DAKA 4OLAA 4C7BA 2WA2A 4F91B 2VNKA 1U2GC 3IV7A 5KYVA 2WT4A 4M7OA 5JNVA 3VTAA 4Z3OA 4TYWA 5D5PA 3PQ5A 3W6ZA 3K35A 1H93A 1LVGA 2HLDA 1KEPA 4MR7A 3ELYA 1LLUA 3EZ6A 4HN4B 4W9NC 3SP1A 1F14A 3KAKA 2MSEB 3SXUA 1IR1S 4EJSC 5L95A 1KPHA 2GPYA 5GZ6A 2PZLA 2YBDA 4ECEA 3SYMA 1D1PA 3IFSA 3LX5A 4NCXA 3SZLA 3ZS9A 1FY2A 3RFVA 2D59A 1AK1A 1LS6A 4FE7A 2SCUA 4KP7A 4TV8F 4YPFA 4D82A 1LNSA 1RRFA 1CDEA 5HTKA 1YK0A 4F4UA 1WKCA 1U1CA 2RB5A 3JQAA 5ARDA 1P0IA 1N8KA 3A4NA 1FK8A 2VUTA 1CZRA 1ULUA 1JQEA 3GPBA 2GCEA 3NG1A 1IK6A 2MYPA 5FF9A 3GGSA 3IKMB 5AJZA 4UXJA 3T5CA 4QVGA 2ZIWB 2BW0A 1NAIA 2Q5JA 5F5LA 5C7IO 4EGFA 4CIAA 1OIWA 5HJ5A 3IKJA 4F7WA 3FPNA 4OREX 3FMOB 5EP4A 2D1YA 2YOFA 4CQLB 1K9VF 3OOSA 2NSYA 3GWZA 1JA9A 3WBKA 2J41A 1CUHA 1FLDA 1THGA 2PZMA 2DBVO 4P34A 5G4KB 4C5BA 1SN7A 4A0QA 1PDWA 1VMDA 5DZSA 2VHVA 2WNHA 2ZUFA 1Q11A 1EK5A 3HBNA 4N0EA 2JJYA 1P81A 1JS1X 4IBOA 5GM1A 1XKTA 1VKRA 1JHZA 4I8IA 4TL9A 2NNWB 2C4MA 5EXEA 3R4VA 1MRSA 1HDRA 2HMVA 2I2AA 3L6CA 1LDBA 1NW3A 3NX4A 1XPJA 1FRFS 2OO5A 2IYFA 3SJAA 3DL2A 4S1PA 3FKSA 1MLDA 1PVOA 5CURA 5DLDA 4BO8A 4HWOA 4F3CA 3TTVA 5FQNA 5GM2A 4U63A 2HEIA 4H7EA 2B1QA 3C0KA 2JF0A 4PO8A 4RHYA 2CCGA 3OHPA 1E9EA 2ZYWX 1QH1A 4HDQB 3ZVMA 1QH9A 1TKRA 3F67A 3K0AB 2X6TA 3H5VA 4RVUA 1EDEA 1M6HA 3RVOA 3LZDA 5JRJA 4TVBA 2ZSHA 2XCIA 1ONPA 1XK7A 2PGOA 4BNKA 4L4SA 4CCYA 1R8QA 1LJUA 4X3PA 1DBRA 1SOWA 2DHRA 4BFXA 2BKEA 1IQ0A 2Q41A 3KXKA 2Y1LA 2VP6A 3R1IA 4FHZA 2Q2NA 2CZQA 2VRCD 5CB8A 4JWTA 5CFQA 3WZ2A 1EHIA 3QPCA 4IRMA 1DOHA 2REBA 4YRAA 3M89A 2VVTA 1IZ7A 3B9QA 1SUFA 4HDNB 5JNWA 3HQ4O 5DGTA 1A98A 3FPKA 3M2TA 2QWXA 1NQVA 1HDOA 1WMSA 1YIDA 4LDZA 5KYYA 1VG8A 3UNXA 1NT2A 4X92A 3TQSA 3B6JA 5THXA 1NU6A 1M2FA 1P9LA 1WHTA 2E7ZA 2H2FA 2X1VA 3LUKA 3UG7A 3UH0A 3I58A 4B75A 1EIWA 3PCRB 2X9LA 3LLMA 2QN6A 4FX2A 1NJGA 1CR6A 1DV2A 5DCYA 4JC0A 3T9BA 3IAEA 4F1WA 3JRNA 3ODPA 4BLUA 1RKVA 3FCAA 1KS9A 3BIXA 5JECA 5K9ZA 4A10A 2ICAA 2W70A 3QF4A 1FNCA 3NXSA 4XA8A 5F5XA 2OFFA 2GFQA 3RT1A 3J7AC 2VYCA 1DNPA 4BWFB 2C2YA 1NOJA 2I22A 2J31A 1NULA 2GBCA 3C3XA 4OHUA 1G5RA 5JNTA 2RBGA 2VCHA 3ZE8A 1JLHA 2GN4A 2OCDA 4RA6B 2YW9A 3K6SB 4BAZA 1GTG1 1OB5A 3INYA 3D8UA 1U2DA 1YB4A 2WKRA 3MGBA 4FOOA 3VAAA 4DTIA 2JHFA 4TROA 3RNOA 3NNNA 5DTEA 3BQMB 1NN1A 2YDXA 1KVQA 1WLSA 4CV3A 1T29A 2QRNA 5IKXA 4GQAA 3T6KA 3OZVA 3NT4A 2W2PA 1UFOA 2DUMA 2O57A 5LYYA 3KXIA 4ZYLA 1ZUNA 3T9CA 1KNXA 1RS0A 4PG8A 1XQWA 2O2JA 3D81A 5L4SA 3JQBA 4MPTA 2YFKA 3PE6A 2B8TA 2DHDA 2WSMA 3F9RA 1W4BA 3GD5A 4ZXFA 4G4SP 4C5CA 3OVMA 2QRUA 4Q1AA 5SY6A 4MP6A 2AFRA 2YWJA 2RGNC 4LW8A 1USUA 3WRVA 3ZGLA 1N8NA 2DFTA 1XHEA 4OO3A 3FUUA 4BC1A 2A1UB 1P1CA 5CDYA 1WA5A 4BOYA 3H19A 1TT5B 4GM0A 1BD3A 3SCZA 3OCYA 1FRNA 1P2UA 3ICEA 1G6HA 1V71A 3KQLA 1DKNA 2C00A 1EVQA 5KWEA 2BFEA 3N2ZB 2OZVA 1MJFA 1EX7A 4PYKA 3UJ7A 4GBMA 2YV3A 3ADPA 1DTWA 3LRXA 3OUUA 5LVAA 4EAAA 4MCAA 3G5AA 5LU9A 1RXWA 2Q62A 2XVAA 2FA9A 4N40A 2Q1WA 1V1MB 1T2AA 2Y0PA 3AHHA 1GZ6A 4KUHA 2P9HA 3C87A 2H18A 3V32A 1NV8A 3JZDA 2GEFA 2ORED 5ELMA 5IEBA 2I8CA 5CR9A 2NWQA 3F74A 2H11A 4GLLA 1DV1A 4GO1A 2QAGC 4IHJB 4EG1A 5HK9A 4XPZA 1P0QA 1T4MA 3EAGA 3N0RA 2QVXX 4A3SA 4YDQA 5JIBA 1UK8A 5FFMA 1XWWA 2C4UA 1I51A 1YKSA 1AK2A 3OP1A 3A1DA 4CCWA 1GXSA 5LWHA 2VOJA 4HB4A 1XPRA 2X8BA 3GVXA 3KETA 5JXGA 1WCYA 3QTLA 4L07A 2YMLA 4KJZA 1DIAA 1Y9JA 2B69A 3M70A 4IYRA 5KTYA 2QROA 1EUQA 3HVIA 1Y1SA 1X7ZB 4LRSB 1WB4A 2EQAA 4RPLA 2APJA 2OGSA 2WJAA 3GZNB 1QGOA 5INTA 1UFRA 1V7ZA 4B45A 2AE2A 4YCNA 3WBBA 3ER6A 4OQEA 2IV2X 1CK4A 421PA 1M2OA 2AG6A 4YXWA 4JENA 3UC9A 3PWTA 3E3OA 1KO5A 2P2DA 1BDBA 4U7WA 4MCHA 1LW6E 1G6KA 1FU7A 3AKCA 2RJNA 4JLBA 3U7RA 1PDVA 4QFMA 2IU0A 2H06A 3PPYA 4EIWA 1NF2A 1NOKA 3N74A 4GVLA 1QIFA 2DUJA 1P2DA 4YMLA 3BGOS 3UWPA 4KMSA 2HU5A 3SQNA 1L8XA 1D6NA 2ISSD 3MWLA 4BQRA 1DCMA 1L8LA 3PNOA 2AW3A 1BU8A 4FCVA 5B7PA 4N0MA 1B8OA 4YY3B 4CW7A 4ZO6A 4X6XA 2IOQA 1AQLA 1FYEA 5LP6B 1BZYA 4H27A 3T1YB 1N6KA 5LA6B 1XRJA 1JN0A 4M9ZA 1PJBA 1M6NA 4AKTA 4YJ3B 2GBFA 3DLCA 2YCLA 1V16B 2G63A 2RC6A 4XM2A 4U7DA 4E2XA 5G0UA 3EWNA 1B2RA 1O89A 2JKYA 4OI1A 4B3XA 1NFRA 2BFPA 3I92A 2AK3A 5JCJD 3FTCA 2VK1A 4BLQA 1HRDA 1KU0A 3HCWA 4JT8A 4N49A 3K8ZA 1CJUC 1W0CA 4C4TA 1I1OA 1H2HA 3OJ0A 3DMHA 4I1RA 4PSVA 1VCIA 3ORSA 1NZJA 4GI5A 1BN6A 2FRXA 2GB4A 3UC5A 2JW5A 2B4KA 4RPGA 5A5FA 2I6SA 2YN4A 1D6JA 3T3HA 1HKHA 5KTRA 1G4UR 3D6TB 3TSOA 2XCTB 5LXTF 1KI2A 2HADA 1U0BB 1MIHA 3EEFA 4U7HA 3OIUA 2ZSIA 2PKQO 3IVRA 3OKCA 1N2OA 1QH8A 4OXXA 2HPZA 1RJ9B 5DGHA 3BD7A 1UKVY 2V9PA 2ZIXA 5CM2Z 1EXVA 1SXGA 3EYAA 1UP6A 2WJGA 1RVDA 3HGTA 2JANA 3JVIA 5AHXA 4J0EA 2FMHA 3WADA 4A5SA 1M6EX 4CMEA 3GOHA 4IV5A 3AR9A 2V7XA 5EINA 5JYEA 2W42A 1HBJA 2RHCA 3MMPA 2R4UA 4Z9AA 4BBJA 5B36A 3VTFA 5GGXA 4B32A 5FBQB 2Z04A 2ATXA 5C1OA 4KGZA 1XNHA 4KUGA 2IXEA 1XWFA 5JFOA 1JPNA 4OPMA 4DZZA 4A8JB 3I01M 4GP9A 4HRVA 1FPQA 3LS2A 3ROKA 1DVRA 3NHMA 5DIZA 5IJWA 3W5AA 1AV7A 2CNBA 1H2AS 3IV6A 3M9LA 1CNFA 4RLFA 3STUA 4MW4A 1XZLA 1XDGA 4JD5A 4IX1A 1GL3A 2O52A 2WVJA 1WPRA 3D7LA 1OT5A 3DOOA 2PZEA 4WBXC 1IY8A 1GFZA 1U7DA 5AI5A 4BNDA 3Q98A 2JIQA 3O31A 1C1YA 3EXG1 3O82A 1QONA 3HB0A 3NWPA 2VA9A 2WVHA 2EW8A 4ECAA 3AMVA 2IEYA 1GKKA 4G1VA 2WLTA 4JBHA 2G80A 1U7TA 2WJ3A 1FYDA 1TEHA 3GF4A 4R0VA 4TLBA 4FD2A 2FYTA 1XB2A 1I3CA 1JQ5A 3AF6A 3FMFA 2WZQA 2HJSA 4FOLA 1ZG3A 3E2IA 4KWCA 5ALQA 1QDLB 5EJ9A 5J2UA 2F3TA 1MKYA 3OIGA 1J8DA 1XTZA 2C7VA 3BVPA 3OCJA 3GP3A 4W5OA 5JANA 3L05A 1A9OA 1MIOB 1HG1A 2LCFA 4LV8B 5KVAA 4ARUA 2R7NA 3LPMA 4YUZA 4BQOA 2HJRA 3KT6A 1N78A 3DW1X 1I3LA 4OQZA 3RJZA 3B7GA 2Z08A 2YWHA 2G76A 1LV8A 1GTL1 2VPPA 3I2JA 2VDKB 3OJFA 3BMCA 1MTZA 4E46A 1V8OA 3A4LA 4NYJQ 1KK3A 1N5OX 1T6BY 2Z8YM 1XZIA 2OYSA 2XMRA 3JXEA 4GXRA 4RXUA 2Z95A 3NBQA 1WZUA 1XD2B 2K87A 2J0QA 2C0PA 4MH0R 4DKJA 2H9IA 3ZKWB 2ZAMA 5CLFA 5BNTA 1UWAC 1T5BA 2D7DA 2C7RA 1E1YA 1TCBA 2EV9A 2XRFA 5HJEA 4CIVA 1MJGA 1FSGA 3BMNA 4LXHA 1M8JA 4JUBA 1WEHA 2F6RA 1CDZA 3AJAA 2BFCA 4NMXB 4C43A 3ZJTA 3EOZA 5HDBB 4FOTA 1G2OA 1AZWA 4J7UA 1JJIA 1G2PA 2V8BA 3URKA 5DXAA 3GXBA 5BSTA 1K8ZB 3O5AA 4C05A 3WIVA 3EVEA 4H7HA 2CJWA 2FX2A 1KP2A 3DMRA 4HJXA 2KPOA 1GL6A 4ZP1A 3TNYA 4UHKA 3HDHA 4CM1A 5KYTA 2EP5A 4WSOA 1GCIA 1JDPA 5FBZA 1UBFA 1H1LB 1T5DX 1VLLA 5IK2A 4NX2A 3DBHB 3IUMA 1JDBC 4Q21A 4EELA 4OQ4A 4QELA 3KL4A 4X1YA 4DQUA 4BJ6A 3X0DA 4J90A 1B0AA 4PSKA 3B89A 3CH5A 3VR5A 1BJRE 4NNPA 5CVCA 4Q47A 2B4QA 2GR9A 4GLFA 2JGNA 1U3DA 1GA6A 2FZCA 1FXUA 3X1ZA 1E8NA 5IM5A 1D1TA 4YDSA 4UFNA 4BO7A 3QVLA 2BRUC 1ENOA 3EZ9A 4RM2A 5AXBA 4HCJA 2DFXI 3CNOA 2QX7A 3MN1A 3WGMA 4LY6A 3VSDA 3KUKA 4G81A 3UA3A 2VF5X 5J2UF 1URPA 2DUUA 3GFPA 5FA8A 2Q7DA 4WZBE 3UGKA 4DIFA 1WWKA 2DQYA 2Q99A 1SXJA 3JQGA 3LSYA 3R7LA 3V9PA 4LCJA 1MDBA 4XFJA 3WTCA 3ORFA 5L45A 1UCFA 3QYAA 1RHUA 3QKRA 3PP8A 1X7YB 1EIZA 4BU1A 3VOBA 2Y99A 3N8IA 4MYTA 4CBVA 1NVAA 4INZA 1ECJA 1MO2A 4YRJA 4BNMA 5D86A 3E1SA 4ROTA 3BWBA 2C8LA 5HILA 4CLEA 2HIGA 3GCXA 1P74A 2EHDA 1SHJA 1LSSA 1MG0A 2Q5CA 4RS3A 4WLFA 2JGEA 3DULA 3JX9A 4YQZA 2BFMA 1PR6A 2COUA 4HS4A 3WMEA 1MGPA 2FV8A 2JLSA 1OV4A 3AKDA 4HKTA 1P39A 1ULTA 3OFND 1UPAA 1K66A 3GAFA 4DLSA 3AHCA 3WZMA 1H8ED 4H60A 3H4IA 1XAIA 3RARA 2XBUA 4Q9JA 1NP7A 3OLQA 4JQZA 3WKAA 5CG1A 1FMFA 4UVHA 2A92A 1F9EA 1KYQA 1ML3A 2FOXA 3V33A 3G2OA 3NPAA 1Q3TA 3QLEA 4RLSA 4OKIA 2GT1A 3ANTA 1ZOPA 3GARA 3E8SA 1X80B 2BI8A 1SUDA 4YJHA 4RKEA 1TF7A 1ZGAA 4AP9A 3AVTA 4RAQA 3L0BA 2JFZA 3FRIA 2FAXA 1MGOA 1R2QA 2P4UA 3EGWA 5U4QA 4DZTA 4CXMA 3A6GA 1KFKB 1VLQA 1TW3A 1C9MA 1I4DD 4INAA 4HEA6 5HWSA 1FJHA 2PGJA 1SULA 1X9GA 2QE7A 1MU0A 3HM2A 1MAWA 1Q0SA 3KVOA 4XX0B 4ZQFA 1W4CA 5CH3A 3ZWXA 3FG9A 4PC7A 4DREA 5A0VA 1PJZA 4H77A 4E1BA 3LT4A 4KG7A 3QJ5A 5A6VA 1Q44A 1OW3B 2WUGA 3N3BC 4EFNA 5SV2A 1ST3A 1WUIS 2DY1A 2ERYA 2Z5FA 2BKVA 3Q88A 4M21A 5DRYA 5EEHA 4AURA 4D0GA 3MWDB 1JWAB 3PR1A 2QIOA 4ZALA 3T4PA 3KAPA 1YJCA 1Z0UA 5KZMB 5A4AA 5BVHB 5J47A 3KB6A 2UUCB 3E6AA 2BEUA 3MTJA 1LDNA 3VC2A 1R0ZA 4FNOA 1U8UA 3PNQA 5EKUA 4LY9A 4ESEA 2X5XA 4XRGA 2P1ZA 2QDXA 5ALDA 1OXVA 2IRWA 3ENQA 2G5GX 5AOBA 1CUAA 1CZHA 3EQ2A 4Q9DA 4DV0B 3QX8A 5KDOA 3BMOA 3I45A 1KAHA 2O7QA 5A04A 4D9CA 1OX6A 3ZK8A 3CUUA 3KVYA 4IDPA 1W25A 3ES9A 1TYDE 2GD1O 4L08A 1W85A 4IUYA 4TMZA 5AW8A 3N2NA 4F8EA 2MU1A 3EIUA 4FNGA 1ZL0A 3ANNA 1AZTA 1BGWA 1F8UA 4LJYA 4XW2A 4NCBA 3FLBA 3KAJA 3OQMA 4BHTA 1R74A 1NSYA 3ZC3A 1O87A 3OIDA 4QFDA 1NU8A 1SXJE 2PKWA 2FEKA 3ENZA 1D6MA 3R5JA 4LXXA 1ZESA 1YQQA 5JSKA 4B09A 4XSVA 4BO9A 1KFCB 2RH9B 4Z9YA 4TS9A 1TJ4A 2DCMA 3TG2A 1SUAA 3KYDB 4OOFA 3IIIA 4WOKA 3FBGA 4ESOA 1WMEA 2XMCA 3PQFA 4FQ8A 3ED5A 4N3NA 1DBVO 1TYZA 1CFJA 3C1TA 1PWZA 1HF3A 2C04A 2HA5A 4GOMD 3WWCA 1NR7A 4DCTA 2OK7A 3IO5A 5DWVA 5IS2A 3R0XA 4IEEA 3WAGA 3G85A 2JI9A 2WYIA 1WD7A 3Q8WA 2Z57A 1QH0A 3TMAA 1WUTA 4P2GA 1WMFA 4R98A 3KE9A 3U4CA 4IF4A 1OQAA 2M6KA 4MARA 4CG3A 5BQ3A 4RDIA 1W1WA 2CHQA 2ON6A 3AR7A 4YALA 3WFIA 2EJCA 2O2DA 1KO1A 1OZFA 1T9ZA 2VF2A 1UM9B 2EKDA 4UW9A 4O4HB 4LYDA 3TLGB 4EQZA 5BYKA 1HFEL 1RAIA 3AVWA 3BMQA 5CYOA 3KQSA 2HC9A 5G53C 5HIJA 4WKOA 3SKXA 2WAYA 3AWDA 3GJSA 4LZJA 3HFSA 4WXPA 4ZODA 3VZCA 4ANFA 1P29A 5K20A 1DZIA 4TYPA 1X0XA 5BSHA 3EIFA 2XMZA 1JDTA 3A6DA 1FSFA 1Z4MA 5BOVA 2VP0A 1NXQA 2JJQA 3ZV4A 2BZ1A 1K8RA 3CLTC 2AX3A 4A4DA 4F97A 5CITA 1IZ0A 4R2IA 5AVYA 5DXFA 3FOWA 2EX4A 3NOVA 2CK3A 3KOZA 4AU1A 4GX1A 3E7WA 4HTFB 4NIMA 1KNQA 1YDGA 2OXFA 4HY3A 5LZ7A 3VNRA 1VCNA 2AJTA 5DI3B 2IVZA 1DO8A 4QNMA 5KNDD 2ZKIA 4N3CA 2P41A 1XRLA 2FPWA 2ZJFA 3SHFA 3ZK7A 1GQFA 4OU4A 4JH0A 1FUUA 1L4LA 4R3UC 3UJBA 3I9V1 4RZUA 1BFDA 2WD7B 2W2MA 3ZCRA 4DMRA 5IAOA 3AH8A 5HP4A 4PZLA 1H5QA 4DLUA 4GWGA 4GZ5A 4LMRA 2RGYA 4PV7A 3K0FA 4ZYXA 3OZDA 2I6GA 4KH0A 3C39A 2YJNA 4MA5A 5DASA 4BV3A 4EUHA 1SGWA 4BFVA 1F6BA 3GNLA 4COKA 1CRLA 3WAKA 1O58A 4HMPA 1NVKA 2D7CA 1F3OA 4UZFA 4TSFD 3ZDZB 4B76A 1PZFA 4BUZA 1M67A 3BAZA 4CM4B 4DG8A 1MF7A 4C4OA 5BNWA 4AZ0A 1R0KA 2Y1CA 2BDEA 3OETA 4NARA 5FWDA 3O3CA 4P8RA 4WKBA 3RTBA 3UN1A 1E1QA 4LZOA 4B0OA 1FLAA 2Y9MB 6Q21A 3M9WA 2DAPA 5CYGA 4FX5A 4A5OA 3G17A 4HSEA 2DY0A 1B3RA 1H9AA 4MO9A 2I2DA 4ZVLA 4OQXA 1LVHA 2REXB 2P2ZA 3ESCA 4R5MA 3NRCA 4MRMA 4S1VA 5CPBA 5D1NA 3FOEC 3T1OA 2XUFA 4L51A 5DPMA 4KNVA 1T3HA 1E9AA 3N0XA 2XUIA 4G84A 2IH2A 1DKOA 1PL0A 3H4TA 2OO5C 3EH2A 5A4FS 3D4LA 5HE8A 1FNMA 1XVLA 3I9LA 5A5DA 1M6VB 2ANBA 2Z58A 1YI1A 4C6SA 1ZH6A 1GM5A 3G8BA 1DBIA 1F2UB 3AINA 3JZIA 3OE4A 3HBJA 5E9AA 1C0IA 2ZRHA 2AJLI 1C0EA 3K5WA 1D5CA 3PQ8A 1WY7A 2A33A 4Q01A 3SHQA 3GPLA 2Q5QA 1E2KA 1OI4A 2PH1A 2PRIA 2WF8A 3I9OA 1V4VA 3AV0B 4D25A 5FUVA 1NDQA 2QRVB 3T1NA 4F3NA 5D3ZA 4BYMA 5CT5A 2FSIA 4RJTA 1TEXA 3WLSA 2VR1A 1NNEA 4BYGA 1YU6A 4YRKA 1NW4A 5HCUA 1P33A 3P5BA 2ZUSA 1GTSA 3SF8B 4Q3LA 3VZBA 1N77A 4TTAA 4Y9TA 3GD7A 4OK5A 3P9NA 3WB1A 2ZJBA 4D6PA 1R5NA 1G5QA 2ST1A 3RASA 1YBHA 5FWXB 3M82A 5DNYB 3WKBA 1YVEI 2QUZA 4LF7B 4OGWA 1XIVA 3QA3E 4WN3A 3UOGA 4L74A 2ODBA 4EVQA 1WBDA 1YZUA 3VYTB 5BVGB 1RI3A 4EA6A 1KAMA 5E1MA 3P4YA 2WHXA 4RIEA 3PXGA 4E5NA 5CEJA 3QELB 4FMCF 4IQ8A 4BRWA 4MINA 2GN6A 4Q19A 1W36B 3W7VA 3KL2A 5ECWA 1USKA 5BRJA 3PYXA 2F1OA 3BIJA 2OXIA 1J00A 2PA0A 3M1AA 5FO0A 5ICCA 2WFAA 1UC9A 2NUTA 3BCUA 2A88A 4LYYA 1R4NB 3LJKA 1GRVA 5H7XA 2V67I 2A4KA 4JUIA 5EWLB 3WFZA 5JRZA 4NYIQ 1T4GA 1SBTA 3HLTA 4IIUA 4RVDA 5A7HA 1UDWA 4DWVA 4CJXA 3JWHA 2DQ4A 3CONA 1GKUB 4IS3A 4IQ4A 1CCWA 2FTKE 4EG3A 4AZWA 1XTIA 4A0FA 3RSHA 1GKLA 5FPHA 5CDGA 3EHDA 4DN6A 4XQGA 4EJFA 1TIBA 1U0SY 4RC9A 1EJ2A 1ZMRA 3IL2A 2ZRFA 4R1UA 4CEJA 3KV3O 3AUTA 1XNGA 1U3TA 4UKDA 4OL9A 3AL2A 3QPUA 1SA0B 2L2QA 3ANLA 3LV8A 4XDZA 3PEUA 5B2EA 4K87A 1EDOA 4GMHA 5EG5A 2X0DA 3K0BA 4RUBS 3QXCA 1BU5A 4W99A 2QYOA 3F47A 5CX1A 5BSMA 3LRTA 5A3JA 3ZX4A 1DU4A 1SPXA 2CXPA 1YAHA 3KWJA 3A3NA 1M2NA 3GLGA 4HHEA 5BUZA 2HHHB 4JOCA 5ALSA 5ADVA 4F9EA 1C1DB 2R2GA 3NT2A 4JKIA 3EXG2 3JQBC 4NE9A 1HTWA 4C2AA 3DPSA 4G8BA 3HCEA 2FUG1 3AFHA 5KTOA 2EP8A 2Z6VA 3OTOB 3NORA 2D7JA 1IHYA 3E5NA 2A6PA 3JQ9A 3QZUA 3WYAA 3AERB 3I23A 5DYIA 1SIWA 2FZGA 1MD9A 1CP3A 1S4QA 2BGUA 3HRIA 2H1FA 4J94A 5DX1A 3FGOA 4RGYA 4ISCA 4Q3KA 1DX4A 1H22A 3LPNA 3PC3A 4LY0A 1I4WA 1PI3A 5I7HA 1LRLA 1ECPA 5DO9A 2YQ5A 3S2GA 2JLUA 3QYPA 4E09A 2GDZA 2AYXA 4C89A 3T9AA 3FVWA 1QMPA 4BP8A 2XDQB 1TAGA 3UHJA 1JLSA 4MAFA 4NI5A 1VG9B 4XVUA 2Q5IA 1J8FA 4WFKA 1J5PA 4MRNA 2OENG 2P11A 3WLQA 5C8DA 4MIYA 1Q83A 1GQYA 2WMNB 2NX2A 4ZEXA 4XGRA 1VOTA 4MI1A 2UV8A 3L2OB 3GELA 5FHRA 3ZU5A 1VZ3A 2GFIA 4Z4CA 4WKPA 3THSA 3EVBA 2KW5A 3OMLA 4TWZA 5HM8A 1U1IA 1BXKA 1II9A 4AZVA 2CWWA 1UBEA 1Y7PA 3RYIA 1QUEA 4C2UA 2F4NA 1JKIA 2ZREA 3EXHB 3EA5A 3II6X 3O90A 1HDZA 4AG3A 4DXAA 1A76A 4XARA 2BFNA 2W2OA 4YRGA 3HY4A 3ITEA 1IUOA 1I94B 2GBPA 3UA4A 1IRXA 5CTJA 4GIBA 1L3IA 4JB0A 4TKUA 1S8OA 2D0PB 4IQFA 2DWQA 1I1HA 2FW9A 4DL9A 1JU9A 2FLVA 2FP4B 3PCXA 3R6GA 3MCZA 4GOND 3CZ4A 4P98A 4QEDA 1YE8A 1L5NA 4E4RA 1NE2A 3AEQA 3OLYA 4G24A 3OAAA 4G67A 4L7VA 5KOJB 5LMCA 5C4GB 3DFFA 1Y7TA 3SY8A 1VE9A 1RLTA 1Q7TA 4R2WA 3ZWOA 3R09A 2H57A 3L5OA 1YGYA 1G8MA 4B2LA 1GZ3A 4A6DA 2D5IA 2XF8A 1JAZA 3P2EA 3DTYA 4FNAA 1WDWB 3GU3A 1H0KA 4IJKA 4GF5A 3TN7A 2ZJ6A 1TK9A 3NIBA 4D5EA 5B3KA 3REOA 1F48A 5ALPA 1S9HA 1YJ8A 4O8ZA 4YWHA 5KEIA 4G0VA 3QKSB 3N0WA 1E2JA 3MYRA 2ID8A 1SM4A 2PPLA 1L4BA 3FB1A 3IQGX 4WBSA 1CVLA 4X24A 2WF7A 4JHXA 3CQ9A 3GT7A 3OJWA 1N36B 2FCAA 1IJFA 5EIAA 2LNDA 2O5VA 5CB6A 3ADCA 5IZ4A 3GLGE 5LR6A 2N9UA 5AVUA 2ZAYA 4HX9A 4LV5B 5EYPB 1IWBB 3QEAZ 1NMEA 3AM3A 5AJWA 3TZKA 2G0TA 2ZG6A 2ZBEA 2VNHA 2GF9A 3GJ0A 2XOKA 3C8DA 2FF7A 2D1FA 3LVFO 4IXTA 3ZGNA 1KAOA 2C9YA 2DWCA 2M2IA 3C41J 5ALRA 2ZRQA 2NMVA 3QOYA 3I12A 3MSXA 2XH8A 4JL6A 5EZYA 3MZ0A 2Q50A 1ORWA 1E6MA 4F12A 2XSZA 4G5QA 5H81A 3L6DA 1A8UA 3QPWA 5EIWA 3EPJA 1RYDA 2NO4A 4HQNA 1CDDA 3RVRA 2C9CA 3D4OA 1CEQA 1Z7EA 3DBRB 3NASA 3NM6B 4B74A 3P5SA 1O95C 2IYOA 3EVTA 4GZ6A 4E5DA 5E3IA 1BDJA 1YACA 1WNTA 1SKQA 4CMEC 4CV1A 2R79A 1EK2A 4LZAA 4RD2A 2VHTA 2FPOA 4KLNA 2F00A 2O6HA 2WKWA 3VBEA 3ICQB 4CM6A 3E9QA 3CZ5A 5COBA 5IKPA 2E5LB 1KPIA 1NI4B 1VIVA 3FZNA 3M4JA 2JKZA 1MEEA 2QY9A 2HN9A 3I0ZA 5CVDA 4DV4B 1MW9X 2VKQA 4QHTA 5LUAA 2JAQA 3DDCA 4MEBA 3N8HA 2C2WA 2VDMB 3LDUA 1A1VA 3GLFA 1Y82A 2Q5EA 2OG2A 5EWJB 2GCIA 3U9TA 2IYWA 3G0OA 1L3BA 3OBBA 4P4SB 2C7PA 1XMVA 3QIAA 5KHLB 4LBWA 2AC2A 2C5HA 1I32A 1Q15A 1ABFA 2GBIA 2QX6A 3O91A 3I1IA 3DG9A 4G1BA 4PRLA 3N5KA 2G72A 4KZKA 4LJ8A 3MJTA 4RF4A 1GP2A 3CZ9A 4WOBA 4ZOLA 4Q3CA 4MMZB 1DXOA 3IEKA 4G9GA 1ONNA 5LYJB 2B8WA 4TN1A 3DJFA 3CSSA 1WETA 2PUAA 1X7XB 3RFUA 1AMOA 1D6SA 3DEKA 1C0PA 2AN4A 1MEOA 1WBBA 3LPAA 5E3HA 3A9CA 1GU1A 4ZTBA 4AY3A 1Q0RA 3FD8A 4EHKA 4BO4A 1RCXC 2J67A 4WZAB 5GJVC 4GC9A 1FMLA 1RYZA 4E7PA 1P2BA 2VDPB 5LNK1 4IJVA 2BH2A 4TQUS 2Q4OA 1I3MA 4Y6PA 3K5IA 2PVPA 3BH7A 1N4AA 3VZRA 2H00A 4TXHA 1XCPA 4ENVA 7REQA 3LLCA 3D7KA 1IJBA 1VJRA 1SHKA 4JWKA 4OVKA 3I9JA 1WMAA 3F6YA 5EZYF 4PY2A 4KHPB 2VDQB 1RSCI 1R15A 2NZXA 2HDWA 5DSTA 5E2BA 3WDMA 2I66A 4E2WA 4PC1A 1AB6A 2A84A 2QTGA 4FYHA 1VHQA 3LX6A 4BWGA 6YASA 1OUMA 3RBZA 4R83A 1K2WA 4DUGD 2F9FA 3F5FA 5C7YA 1O5OA 4GKJB 2EKQA 2R4QA 4ALJA 4BWVA 2W00A 3PDUA 5CD9A 1RDFA 2ARKA 5ITWA 5B3LA 5LJLA 2X86A 4K0RA 3AUKA 2O2ZA 3IB3A 3KOYA 3A4IA 3V4ZA 3QEJA 3AOEA 2G8LA 4L15A 1BKDR 4B6OA 4YQFA 3G8YA 4LGYA 2A0KA 5TGTA 1Q7RA 1VI6A 2JAHA 3KUUA 3NAQA 4JYCA 2ALJA 3PR3A 5JJIA 1V8BA 2FG5A 3L8HA 3W7BA 5T3UA 2Q1SA 3JVUA 2ZVJA 1CPYA 4PVCA 1A7AA 4OP3A 2YN2A 3EGEA 3IDSA 1FLVA 2RI6A 5ALTA 1T9BA 2IKQA 4KI0A 5E4YA 4A9AA 3FLAA 2BISA 4JSTA 3ZDXB 3UXYA 5KQPA 3FYCA 3EDOA 1IZ9A 3EDMA 4I66A 2FE1A 4L2IA 2HF8A 3NETA 2UUBB 3EW7A 4D9BA 1ORVA 2ZJYA 2E18A 3ZKAA 3ZJ4A 4DMFA 1LD3A 1QRSA 3SSNA 1UQUA 1NIPA 1A9SA 2OBLA 5CLIA 3VZPA 3VC3A 5K5EA 2EKPA 2O7RA 4NNJA 4ZOLF 3E23A 4QGAA 3OTGA 1NT4A 2CMDA 3DO6A 4M0CA 1FP1D 1NN3A 2P62A 4KXWA 3GDHA 2GKSA 3CUKA 3G5TA 2CNOA 2AJCA 3GLHE 4YAJA 1Z18A 1Z0ZA 4NE7A 1P3DA 5E9QA 2WWVD 4WXEA 1LQTA 4BTLA 3K70D 1M2VB 2MJLA 3KV1A 1JHXA 3C85A 4UTRA 3UWDA 1Y3BE 2X1MA 1CZLA 1WXHA 2I1WA 2I6XA 3PXCX 2CDCA 2A8YA 4KDRA 3S2YA 2OMEA 3IHTA 4HYYA 4U7GA 1SXJC 4OFBA 4BXOB 1PQUA 3JCZA 1Z15A 4Y6RA 3BTOA 2JGFA 2D2VA 1PNVA 2IIVA 3RE1A 1DWOA 2C58A 2VOEA 4MP8A 3MMZA 4JS0A 2SICE 1KGDA 1KOGA 4RF3A 5I7EA 3WWDA 3M2PA 1T0BA 1XELA 4WRRA 4NZYA 3VZDA 4YQYA 2BKXA 4I99A 3R7DA 1IHDA 7MHTA 1NBHA 1X9HA 3GBVA 1J8MF 1JBEA 1SHTX 1N0HA 2ZUDA 3HYTA 5IH7A 3GPIA 3MWYW 1RLOA 3H5AA 5L4NA 3I6BA 4BJ3A 3CRVA 1C7JA 4YP7A 3O2SB 5D6NA 3VI4B 2YIVX 1ODSA 4PC6A 3S0JA 4IRXA 1W8IA 2PS1A 2WK1A 1JIJA 3QXHA 5THKA 1BG6A 1R50A 4IFBA 1GLGA 2E85A 3KHTA 3VSAA 1XCJA 2GYVA 1VSQA 3L1IA 4DSTA 5TT1A 3F1KA 4P3OA 4TMWA 3UHFA 1WUYA 3K4QA 3V1TC 1DG1G 2A0UA 3H5WA 5DEIA 3E2PA 4K40A 3ZDDA 1ZX1A 1QQ5A 5AUPB 4KAFA 1GGJA 1PBNA 2Y0EA 1J23A 3G23A 1QGDA 3NOOA 4KE9A 1ZLXA 2P3LA 3OY7A 1OYWA 4RD6A 4N5IX 1B26A 4Q3BA 4CQMD 3CWQA 4BIIA 3AVOA 5FBRB 4EFDA 3OZBA 2KQUA 1JTEA 4NS4A 2PLNA 4OBEA 3RC9A 1TAHA 2WT8A 2C83A 1G9TA 4HDMA 3VTZA 1NLMA 1NZDA 3PEYA 1T3ZA 4KPUB 3QFFA 1A9XB 1J24A 4UUBA 1E7RA 5HBRA 4P7FA 2A5FA 3C8UA 2EEPA 4WDRA 3ZIAD 4PQGA 1QDUA 4IWXA 1T1SA 1WOMA 5K0EA 2YIDA 5D7NA 1ISSA 4PLTA 4RANA 2O8CB 1E5LA 4LOAA 3L0IB 4HLNA 221PA 3P9KA 4I4TA 2V69I 4ZT5A 3WIBA 5JBQA 5K0TA 4FGLA 1WNFA 3QHPA 4U1RA 3VA7A 4K2HA 4CLRA 3QVKA 4TX1A 3D6FA 5F1OA 1MNQA 5A9SA 2W93A 4HDSA 1NXOA 4S35A 5JO9A 1Q0HA 5L3RA 1QX3A 4I9FA 4CMCA 2X7JA 2PSHA 1EUCA 1I7NA 3T3MB 5JLJA 4LOHA 5JISA 5IBQA 1CU1A 1HYHA 1KR2A 2PLWA 3OKAA 5HFJA 1QBGA 1TM4E 3JASA 1RLUA 1QLJA 1S8NA 3LHSA 3UEOA 4AJ9A 5IVPA 3OT1B 1UDRA 3PNSA 3TQCA 2PBFA 1BMFA 4NPCA 2WHPB 5BV1A 3DOHA 5IT9A 1OWPA 4EI2A 4E4TA 3L0ZA 1WLYA 3R7SA 3MTIA 2TMDA 1IQUA 2QXYA 3FTNA 4HGPA 4MZXA 4Z0HO 4EB3A 4GSKA 1YA6A 3Q2KA 3IAS6 3O3OB 2EZ8A 3MINA 4JEMA 3C16C 2G67A 3DWIA 4LC9A 5GADl 1N33B 2OCGA 5LMNB 1RU3A 4BCBA 1W93A 1SBCA 5AKIA 4WESB 1GG9A 2OPHA 3UXMA 2XA2A 3QVXA 3F97A 4BQNA 4ASUD 4PIPA 1UXGA 1VJTA 1GV0A 3U48A 1Q20A 4IF6A 4FQ5A 5DCWA 3O47A 1MW8X 1I4EB 1PT7A 1WP4A 1L5MA 1FFBA 1E98A 1OLSB 1R6VA 2JI6A 2RK6A 3C2QA 1QTIA 4GM1A 4OBXA 2A7XA 4TQGA 3ZQKA 4NZNA 3A2KA 2GAFA 3THRA 1CYDA 1YFKA 2UZ3A 3FLEA 4CIXA 3B8EA 1U0JA 2AXQA 2IPNA 1OX5A 1RLJA 4MV8A 1GT91 1ONSA 4KYVA 5KINB 1TDJA 3EBOA 2GEKA 1AKQA 4WD3A 5C1BA 2F64A 2O1SA 4UMFA 2PT5A 4R69A 5FT9A 4C0KA 2MYUA 1YZKA 3LU1A 1HE3A 1UFQA 2W6QA 4JJIA 4BMNA 5B12A 5MFPA 3V46A 3CCBA 4NCNA 4RADA 3C3WA 1PGJA 2Y4OA 4QYXA 2H1SA 5FLXA 1XKLA 1LBIA 4ER3A 1DC7A 3PWSA 3QIVA 1BD4A 3P2YA 4BN4A 1AXRA 4LXUA 1EAYA 4I4TF 1J2RA 1KAGA 1DBPA 4IVQA 5ILQA 1JHDA 2HBYA 5H9WA 5T5QA 2O8EA 2PZAA 4W1PA 4ZK2A 3WHPA 3L7MA 3AT1A 3E1GA 1VI5A 1CZNA 1P91A 1RKBA 5L3QB 1ADBA 5JH7A 4RSRA 1CB7A 1G1MA 2NVWA 4M9UA 1LK0A 1USGA 3DV2A 1Q7EA 4X65B 2XNKA 2QMOA 2EG9A 2QL6A 4P4UA 3CO5A 1PZEA 1VL1A 5FR2A 3NTQA 4XB6B 4D3FA 3AWIA 1XTTA 2AJDA 2YZ7A 3MCWA 5CT4A 1G9SA 1NUPA 1XVAA 1R12A 2A9OA 1PJTA 3GC6A 4EYEA 1EWKA 3CXRA 3ZJVA 2LP4Y 3EIHA 3TUJC 1U8ZA 5IJ0A 1VL0A 2RARA 2OLKA 4BNJA 2QYSA 2PKYX 3EF3A 3QW4B 4DXHA 4QGSA 4G5FA 1PS9A 3U7JA 5HRUA 2X9NA 2Y1KA 4QM7A 4P0PB 4NDAA 3G9UA 4N7RA 1YZYA 3V34A 1MV8A 3DUWA 5B7QA 2O14A 4F85A 1JV2B 3K53A 4RPIA 4ZHQA 1SB9A 1P3Y1 1K4KA 1RWKA 2R1TB 2WU1A 5FTNA 1C3OA 1TZJA 4I36A 3TWOA 2WYHA 3JQ8A 3SS8A 3HCAA 2V03A 5JW6A 2CNWA 1DC5A 3ND9A 4LKRA 4PHGA 3RK4A 3Q5EA 3NZEA 2V0GA 1GGHA 2H48A 1PKXA 4HLUA 1OAOA 2VN8A 1SXPA 4R05A 1PR0A 2Z2IA 2BAGA 4NCIA 3SFTA 2QG6A 2IBMA 3G2HA 4EG6A 4HGYA 4REMA 1KEEB 2A0WA 3AFIA 1T0PA 5ESXA 4B3RB 4MDFA 1UBNA 2ZRKA 5BV2P 3RANA 1ZS9A 1JLLB 2J30A 2O4CA 2WJIA 2XYVA 3L8GA 4I1YA 5CPFA 3EXEA 4QFBA 3S2FA 1NA5A 3GLIB 1KRWA 1BYUA 4L4ZA 4Z99A 1QIHA 1XA3A 1USWA 3BS4A 1GGMA 3NNSA 3QJGA 4R01A 1XR3A 3K5HA 4YP9A 3RS0A 2UYYA 5JAUA 2QQ5A 2QN7A 1MVNA 2AHOA 4DPMA 4EVRA 1L7PA 3N05A 3KVRA 4CL0A 5DYTA 3RVDA 3NHUA 1QC5B 2A1TR 2NO1A 1YS7A 2RAVA 2FWJA 2CLLB 3HKEB 5LQNA 1JR3D 4J3NA 4B84A 2UXCB 3LNTA 4E31A 5M29A 1M34B 2XODA 3KJZA 4P4LA 5B3AA 1CQPA 4G2TA 5JUWA 3E70C 1SU4A 3QU4A 4URFA 3R3HA 4LMPA 5JH7F 1XAJA 5F33A 4IXMA 2I4IA 4QA9A 1D04A 5EZQA 3KQHA 3B8HA 5J2TB 2DLDA 2Q21A 5ALVA 1F7VA 4KKVA 1W1UA 4I55B 1K98A 4C7MA 4EPWA 2XYGA 3Q5GA 2OHJA 2WDPA 3VHQA 2OXEA 2Q2WA 3QWFA 4L3WA 4RJLA 4EEZA 3U6KA 2A3NA 1DXHA 1IMOA 2HNKA 2P3QA 1DC4A 2AJ8A 2BH9A 4HUJA 5CU7A 3R0ZA 2BLLA 2XF2A 2ONYA 5I8PA 5IKMA 5IUJC 5CXUA 1PZHA 5K0ZA 1MQAA 4H4CA 1M2JA 4OHBA 2WAMA 4NC9A 5AKZA 3K70B 3UJAA 3K6JA 1JKFA 1N7JA 2G6TA 3KTAB 1PYDA 2ZT5A 3NBFA 5JWHA 5TF4A 3N2GB 3V8NA 4F1JA 4PICA 3W1EA 1J2YA 4PBSA 3ZBPA 4BCCA 3V8QA 4ZHQF 4CTNA 3LLVA 4QOIA 3SEQA 5A5EA 2Y2UA 1SXQA 1YB2A 3MK31 5DI9A 4QXOA 4AICA 3OT5A 2JPDA 1HO3A 5A4MS 3U7FB 3TPZA 4MW5A 4TKMA 3S6JA 2PX8A 3R24A 4BO1A 2VP3A 4WJZA 4JUAA 5FUMA 4JK3A 4M49A 4FE4A 3KEFA 5K09A 1MB4A 3N76A 1NVFA 3F1LA 1J22A 5AP9A 1SBZA 2IP1A 1T2DA 3PPWA 3KB2A 3GFOA 4TMXA 4ETIA 4ZCTA 3EZ2A 1NMSA 3SLGA 1UADA 2R6CA 3BXGA 3ZE7A 1WSDA 1QWOA 1QFSA 4FGJA 3PPXA 3IT2A 1N92A 3GP5A 4MDHA 3SIRA 5JSQA 2PGLA 4XGIA 1RD4A 1VYUA 1XTRA 1XZHA 2YY5A 1L7MA 1JSXA 3KVVA 2OXTA 5IT0A 3IVXA 3JAKB 2OCAA 1E5QA 2R86A 5YASA 3CUYA 2HEGA 4ZD6A 3WYNA 2AOXA 3HO1A 3PTLA 2Q2VA 2VPQA 3CBGA 4Y9DA 4CHGA 1YC2A 1U5CA 3JQ9C 4BVJA 3ZE6A 2ZM6B 2CFIA 2GWRA 1XUOA 1D8TA 3E22B 4JVNA 2IDKA 2XQIA 1QS0B 4CQMB 4CV2A 5AW6A 2ISCA 1E58A 3JY6A 2Z4TA 4UVIA 1NC1A 1GSOA 2PA3A 5B1EA 3G7NA 1JNYA 1DUVG 1V5FA 3R3ZA 5FL7D 3VPXA 4OQYA 4F2HA 1RWXA 2FZLA 3MWGA 4BY9E 2VRBA 1PV4A 1ZONA 3W6NA 1X1BA 1T3GA 3DHNA 4HDKB 1T9DA 3FFXA 4J91A 5K1ZA 3L7AA 3C6KA 4AY2A 1W73A 1YOVA 2JCBA 2RHDA 4XVRA 5AM1A 2XB2A 4GUDA 3OQIA 1HRKA 1OGIA 3RS7A 3X2FA 2JLWA 1EFDN 1TUGA 4R1SA 4DMGA 4F5WA 1OXMA 1TYAE 1V26A 1UMDA 3OM8A 4G4SO 3K0SA 3BFJA 1S2LA 5FA6A 2IXGA 3R9IA 4QKQA 1AKVA 5C3MA 4IIBA 3GRPA 3HLYA 3MWEB 4R71A 1E4OA 2Z0MA 3T4EA 2RKWA 1BOFA 2VDRB 2X13A 2PLRA 4IIDA 4YUYA 1RXYA 1VGVA 4U9UA 1CE8B 1V8PA 1SBYA 2GYUA 3ZBQA 1EP3B 2RB4A 4PE5B 2Z8ZA 1E3TA 3RH0A 1DFGA 1WB6A 3PFWO 1JVSA 1TZBA 3KD3A 1K08A 1NFFA 1YRYE 3EVFA 3W3AA 1QE5A 4NPHA 2AR9A 2PX2A 5ALFA 2UUPA 3SC6A 4HK4A 1ONOA 1T9GR 2ZKLA 2IXTA 3B1VA 5JMPA 3VTKA 1JG1A 1OXKB 3GMTA 3DA8A 3RI3A 2R66A 3MTGA 5C80A 4DARA 1EM8B 1XZJA 4U8GA 2E21A 1J33A 3B2EA 4R2XA 5IVHA 3Q3IA 2TMYA 3D6MA 4OLJA 4UZEA 5AW9A 1M1XB 5D2CA 3F8TA 4DDKA 2I78A 1HQKA 4NMMA 1PE0A 4HDOB 9LDBA 1UT6A 3R5TA 4JC8A 1IMJA 4P9NA 4PS1A 2XITA 3JWGA 2RHJA 3NTUA 3QOFA 1FDIA 3GZ4A 4JX8A 3WICA 1WDTA 2YQ4A 1JECA 2ECFA 3ACBA 4YB8A 1SQ0A 1QYRA 5C3UA 3W9YA 3IT1A 4EGAA 5K99A 1TKAA 1XVVA 2WUVA 2PHZA 4FSXA 3JV7A 4Q12A 5BT8A 1V1RA 4YVFA 2RHMA 1V11A 1N1EA 2NZJA 2W6NA 3IVCA 5I8WA 1JIXA 4LTDA 2RIPA 3PZBA 2ZRPA 3VUFA 2FQWA 4DQDA 2HSGA 1XLWA 3H8SA 4YASA 5A2GA 4WL0A 2LCQA 5F51A 2WP8J 1Q57A 4PF1A 4BFCA 4XLLA 1SVMA 4UDOA 5F5NA 3FROA 1CRWG 2NSLA 4KXXA 3ERCA 5CIQA 4RK6A 5C34B 1C81A 1EX6A 1HLPA 3NI2A 4EEKA 4EJSB 1N7GA 3J7TA 2REQA 3U9SA 5CA1B 1UF9A 5I01A 4B3BA 2WTXA 4BGUA 4DRYA 1T9AA 4M0DA 3PJRA 4CEHB 3D1LA 1ZGGA 3MJRA 4YRQA 3PFKA 5JSFA 4L95C 1J2EA 2IZ7A 4Q9IA 2G0AA 1I14A 1UXIA 1WEKA 1QHYA 2DFKB 1D1SA 3O8OB 3QPDA 4INOA 4MVCA 5T67A 4AK9A 2JFFA 1EGMB 4EO9A 5DM70 5H4HA 2DPHA 3IPLA 4Y2VA 1NUSA 4XAQA 3IE1A 4Z51A 3IUEA 3BFXA 4W5JA 2JLZA 4ZVMA 2VJAA 3WKDA 2V9CA 1GCUA 3M5DA 1XC7A 3PXAA 4HQRA 5B55A 2OG1A 3KC2A 5JD5A 3NYWA 3RSFA 3HP1A 3R0QA 3WWYA 4EP1A 3ZPXA 1A1SA 1DG9A 4EUKA 4WVLA 2QS9A 3U26A 1DCTA 1QG2A 3V8BA 3FPGA 4B6GA 5JMTA 5KNBA 1HUQA 1DX9A 1RFGE 4PAMA 3TTTA 4HR7A 3G7SA 4HFRA 4NBNA 4CKWB 1YDMA 3RS4A 3H9JA 5B1YA 4YCBA 1MPXA 1UODA 3TLCA 4BKOA 3H2KA 2KM1A 4ZQGA 6AT1A 4Z5XA 1AVTA 4OXKA 2HHCA 1O6ZA 3COVA 4QJIA 4HRAA 1XTPA 4PLGA 4X3OA 3D43A 2QTTA 4DWOA 1M7BA 4ZDJA 4FYMA 4XTRA 3QVGB 3RYCA 1Y34E 5B1SA 1ARZA 5JYCA 1V9CA 3KZMA 4F86A 2X15A 1NTRA 4NDZA 1MC4A 4KGDA 1QHGA 4HFMA 3ZH9B 4CG0A 1OPRA 1ZR2A 5IAEA 1MC8A 4MO2A 1W0JD 3LUPA 3FPFA 3DP7A 4JROA 4L0CA 4RHCA 4D96A 1CBUA 1LI4A 3A05A 3A06A 1NNUA 1NNSA 1OYOA 3EMBA 2PN1A 2RGWA 4MIEA 2GXUA 3L0SA 3P9RA 4BO0A 3WJAA 1Y81A 2FHZA 5DOVA 4WXHA 1IPFA 1K63A 5KTPA 5M7EA 2XLBA 4TVOA 1YKGA 2CSUA 4X1KA 5TQ2A 4JLWA 4IUDS 4Q48A 4W1SA 1YE5A 3P9IA 2FK8A 3T0IA 1DAPA 4Q1DA 2QL5A 4KITB 1N3YA 1Z2EA 1IM5A 1O77A 2AFHA 4PQYA 1Z6YA 2FEXA 3DVAA 4X00A 1SKAA 1S5PA 5AOAA 1N1MA 4FBGA 3Q8KA 4PYNA 5ULLA 1PR5A 3PG5A 1MOSA 1BE1A 1VKHA 1BJKA 4H4DA 2QW1A 2PS0A 3M34A 4KFSA 4UU7A 2JLXA 4IKPA 3AHDA 4E5SA 4A1FA 1E4VA 2G4VA 3O2JA 5JZ9A 1DO0A 4OA8A 4Q16A 4CIYA 2R5FA 1XMIA 1EGVB 4PNHA 2FPGB 4TSRA 1KPGA 1A50B 6REQB 1MN6A 2JH9A 1VXRA 2UKDA 3HACA 4NF2A 3WY9A 4F1KA 2X3YA 2K2QB 1E99A 4PXYA 4YV1A 3QQ5A 4UM5A 2C1XA 3OFSA 2AR0A 3TW6A 4EB6A 1FTNA 1TADA 1KMNA 2XRYA 4KJXA 4BU0A 4M22A 3I9MA 4QQKA 1ADFA 3ZR4B 2VBCA 3GCWA 5CTAA 4EGJA 4PTYA 5ENDA 1BJTA 3RFFA 5JRDS 4OHPA 4RACA 3PSHA 4TWAA 1TE2A 3CM0A 1KSGA 1KYZA 4LCBA 2OD7A 3UGQA 1LRKA 3LC0A 5BSRA 3SWWA 1NF3A 3I53A 3W5HA 2EC5A 3K0EA 1V3QE 1CUGA 2DVMA 1OSNA 3ZJYA 4TS3A 4X1OA 4YDHB 4EA8A 4M0PA 2XYHA 3VI3B 3I61A 3HB5X 3OFKA 2ACWA 1N2GA 2HFKA 5KWJA 4MVJP 1L5VA 1YJQA 4AWBA 4BB6A 4I6JA 1P1JA 3HVRA 3KQWA 4HAVA 3MWJA 5K03A 1VJDA 3MWFA 1TA4A 2XJ4A 2UDPA 3BHMA 4RVOA 4D8VA 3R7FA 3RRFA 3B53X 1X19A 1EB9A 1EVLA 1L0BA 5JG7A 3V2HA 3FFWA 2OK8A 4KDCA 3V7NA 4BVKA 3TKYA 3DLHA 1ZEMA 4RLHA 1J9ZA 3QXJA 1UJBA 1Z5UA 5EJEA 1LQ2A 3CF2A 1L5YA 1TB4A 3G82C 4PHHA 1CZUA 2Q0XA 1DCFA 3MPOA 2VA8A 2O2SA 2FRDA 7MDHA 3ZZMA 4YJ2B 1JQ3A 3W78A 1KA9H 2Q6IA 4ZOCA 5EJ7A 3ADDA 1QF6A 2E6KA 4HV4A 1T4DA 4J2OA 4OF4A 3FYUA 4Q4DA 4QSMA 2AOTB 2RFLA 4U0JA 4KYUA 2HT1A 2JFUA 4YXFA 5CLHA 1JSLA 1TUBA 1KDTA 1PJ4A 1Z2CA 3O7MA 5ESRA 1PS8A 2HQRA 2DLCX 4P58A 4RD4A 2XB4A 3B1FA 1CY7A 4U8HA 1VIYA 4GT1A 2IOFK 5GMOA 4A6EA 4UBKA 3SX0A 4IOKA 3M4NA 4HS9A 4JUDX 1SD1A 1T1RA 1YHNA 1KRXA 1BXRA 4RTNA 3BILA 1SHZA 4EMUA 4QYIA 4MCJA 1ZSYA 5AH0A 1NSTA 4E88A 2Z2XA 3OZEA 4JI6B 4D45A 1Z33A 1T6ZA 3FCUB 4M1KA 4JLAA 4P53A 4CLXA 2EL9A 1HT1E 3UYKA 1QLWA 2W4IA 1BS2A 3L4EA 1ATIA 4OXQA 2LW7A 4FHEA 4LIPD 2VDUE 3P94A 2XVZA 3PA6A 2AFHE 1LC3A 2Q9BA 1M0SA 2I3BA 2WC1A 3WO0A 1QO0D 4CMIB 4UPEA 3SZUA 1SK8A 2X5OA 2CUKA 1E79A 1PW5A 3SQMA 3FFAA 4K6GA 1TNDA 3ZHVA 1EZ1A 3KYCB 1R66A 4AO7A 3ZYZA 4DXDA 4EA9A 1UBTS 4C3UA 1U0LA 3G0CA 1BOOA 3BGDA 2EKLA 4G0NA 4BDTA 4F21A 1PL6A 2GD0A 3GRVA 4HHHS 1LFDB 3FGPA 4MLPA 3SS9X 3HSSA 2M98A 3FJOA 5AVXA 1GFWA 2H59A 4HFJA 4Y8VA 3KT0A 4QECA 4RABA 621PA 1G6Q1 2BFFA 4F3KA 1NPDA 3SG0A 1P2TA 2NVUA 3NC1C 3UJHA 4BEVA 5HOEA 3FJYA 1X92A 3IOMA 1P62B 4D5GA 4F6RB 3PDIB 3SLRA 2YHIA 1Y37A 4ERXA 3K2BA 4PG7A 1HMYA 3KK0A 1ND5A 4YRLA 4C2TA 5DX8A 4OGKA 3N39C 4M1TA 3GT4A 3KZNA 1CTQA 3RRNA 1SU8A 3N75A 4NZOA 3Q6IA 4C4PA 2GYWA 3AFOA 1MOPA 4U6NA 3GA5A 1KC3A 1QIEA 1QE0A 3R8FA 4FYKA 4JNKA 5FI5A 1SKYB 2JDID 2NTEA 4CT5A 3ZCXA 1WXQA 1BIFA 1YJXA 5KSZA 5ES4B 2AR7A 3PXEA 4J1SA 4B4UA 1FFWA 2AEMA 3LQRA 3M6WA 5FI1B 1NASA 3F78A 4LCEA 5DT9A 1NM5A 2XUHA 3U4HA 4XIJA 1ZW1A 1DKPA 1FTYA 4NBUA 4KR9A 1OKKD 4MWTA 1YZVA 1N5JA 4OJKA 2WT9A 4FFNA 5EP1A 4NOKA 2HLPA 4IQGA 4BQFA 5K3OA 3UJNA 2NZ2A 4PHTA 1EESA 2BMEA 2VJMA 1BTOA 4JI7B 2ZYVX 4N9WA 1Y0BA 1ZPDA 2UZIR 3RC3A 5LL6P 4JY7A 4YUAA 1OFUX 1JB9A 1G4AE 2OOKA 2R9VA 2VJCA 3WB0A 5KYUB 4QHYA 4QTZA 1YZHA 3JQ7A 1JAXA 4LC0A 4XJSA 4XQCA 5F35A 2G28A 2V7QD 2WZBA 4C4RA 1P72A 1N6LA 3GK3A 3KQQA 4P33A 4D9NA 1FS5A 2QORA 3DFIA 3J80A 3VHRA 2FFAA 1JFFA 4ZYZA 1ESNA 1NI5A 2P0AA 3MJHA 5DFAA 4D26A 2VDNB 3QPVA 3Q8LA 1ZI6A 3O8BA 2RHTA 1NKSA 4AJLA 3VDQA 4FJ2A 2XDWA 3RSLA 3RRMA 2FWRA 2IEGA 2J5KA 1RSZA 1Q5PA 1PQWA 5TY0A 2CVPA 1RBMA 1TQ4A 3ROQA 5L40A 4P22A 2DXIA 2JIRA 2ZXUA 3O2NA 2IIQA 5C5EA 2VXCA 3WA7A 3JQQA 4WNCA 4YJGA 3UT6A 3ZQ6A 2I6TA 2JJ1A 1Z5VA 3OLWA 4MQ5A 1LGYA 3PQ4A 3CRMA 5F77A 2W2QA 2Q8PA 4ZOBA 2RBEA 1A8PA 2VP9A 3HWRA 1TX4B 3KNZA 1OBFO 3HG7A 3Q85A 4DY6A 2IYAA 2PSFA 4CQNA 121PA 2EOAA 5BN5B 2HLDD 3CLTD 3W05A 2A5LA 2O5RA 4IZ6A 1CY8A 3JQDA 3TLXA 4AS2A 5JS6A 1TA9A 3N07A 1VKZA 5I9MA 1SUBA 1RBYA 3DBLA 4FZ5A 4P5EA 4B7AA 1ECFA 2PQMA 2WJWA 1M7HA 1MVLA 1F8GA 3TSAA 3A0UA 1DAMA 3THYB 3K6RA 3SE7A 3GUHA 5G1NA 1HDYA 1MQ8B 2V4UA 3W5SA 1QK4A 1U80A 1KI6A 4RVNA 5AKEA 5HHTA 3LECA 1AE1A 2E87A 1KQFA 1BMQA 2VDOB 1IXYA 1QP7A 3VVCA 1B1AA 4QOEA 1EWRA 2JFXA 1I5EA 2AG0A 4FSHA 4ML3A 1C8VB 3R5FA 2UZ1A 4OG2A 5BYBA 1CIVA 4U2KA 2H51A 1NLYA 2ID4A 3H11B 1FUEA 3O93A 3WLHA 1GNPA 1FNSA 2J0UA 3VUEA 4PGFA 4CE6A 4KMMA 2PGXA 3N8GA 5EUMA 3GFFA 4O2RA 1OXTA 1RC8A 3ZXWB 4G5HA 4YMUA 1FUKA 3EWIA 4LNHA 4EITA 2F43B 4LYAA 3E7DA 2D0IA 4ZPXA 1CKEA 2CB0A 1XRMA 5E6RB 4AQYB 1RHQA 1WVIA 3N8DA 2JIMA 3P2OA 3TW8A 2I4RA 1JIKA 5HDQA 2BHLA 3KB1A 4EPVA 4CF3A 4BJHB 2QSUA 3KZCA 3D6HA 1O96A 1G20A 1Y4SA 3N6VA 5ALUA 5JDCA 4D0NA 2AZXA 4GDMA 3TF5A 1N6PA 3F8WA 3C3CA 5LLDA 3PCTA 1O0BA 1C9DB 3TTUA 3B1WA 3IAM1 1B0ZA 3PGXA 1RRCA 3ADOA 4MR9A 4Z4IA 3TNFA 4DWJA 1FSPA 4XCXA 4FEAA 4C9BA 1DRUA 3FKSD 4NBWA 1M74A 4U39A 3A6JA 3UOWA 5BRAA 2OCXA 2FNAA 1TYEB 3SOPA 3CRRA 3RV3A 1E9CA 4N18A 5AK4A 1SHUX 4GXNA 4UE3S 2GRAA 3EDQA 5JZVA 1LDMA 3ET4A 4YEDA 2E2WA 5FCDA 5JTTA 1Y7HA 1WXIA 1I6WA 1OBCA 3K4PA 1OAOC 1GAXA 1QHHB 1A9QA 1YDWA 1NBAA 1L4FA 3UQYS 5AOCA 4RZHA 1R7RA 1LA2A 1X7DA 3CLHA 3KU4A 3EGDA 4R8RA 1R6DA 2HA2A 3OEWA 4IL5A 1YBMA 4U5QA 2KX7A 3BYZA 2C2BA 5GOTA 4K05A 3I04A 3F5MA 1SOVA 1T1JA 2Q3CA 4U2BA 1DKLA 1ZIYA 2EJBA 2YHBA 3C7AA 3GGPA 3CLVA 4WTOA 2XDYA 3O26A 1B8UA 3S8YA 4KQIA 2VK8A 3H2HA 2MSLA 2D1RA 1TMYA 1JDBB 4DSOA 2CVFA 2CYCA 4O2AB 4HWGA 4RZSA 1SVUA 4P81A 4H17A 3UXEA 2QTRA 3JWPA 4LJRA 3RBVA 2VUIB 2D54A 2XEXA 3GJRA 3MCVA 4JUCA 1Z6ZA 3TB6A 3MT7A 2C8JA 1IFXA 5HEKA 1RYBA 3DAYA 4IV0A 1UZUA 5DE3A 1QBKC 1LB1B 3P2JA 3C3BA 2HO5A 2C7QA 4MLDA 5IJXA 3LC7O 1M75A 1D03A 2GZ3A 3D3JA 1FC0A 1HDEA 3LWNA 1XDUA 1I5OA 5K3FA 3NC0C 4XB1A 1IOLA 1RXUA 2OO3A 2XMBA 3ZHRA 2ATIA 2QU8A 3I32A 3RAGA 4BPRA 4H7JA 3WDSA 1RBQA 4IIJA 3C3MA 1D4ZA 1Z5GA 3CBQA 3B6KA 3H3XA 1QQ7A 1GUZA 2HU7A 1K9SA 1HYBA 3MCUA 4HXFB 3RUAA 3VNQA 1PWYE 4B3JA 3LYAA 5K0BA 1M66A 4DT1B 2FSSA 4Z4FA 2QM0A 4AO6A 4XEUA 4NABA 1Z38A 3AKYA 1UL1X 9LDTA 2VDLB 3KSDO 4RD1A 1A71A 1ES9A 3GEDA 3AI7A 2BJVA 1XV5A 3AESA 4XJTA 5B1HA 4ARZB 1R8SA 1G5HA 3ZCQA 2DUWA 1DIHA 1AQYA 1HLFA 2PFSA 4JJFA 2A9PA 1OAKA 1U5BA 3BFPA 5C35A 1Q12A 5T4BA 1TQHA 5H3LA 2ZVDA 4ZCLA 2PBZA 1F06A 1GILA 1NONA 4HZGA 3W6OA 2VRWA 4BVAA 1XZAA 1U63A 1AUOA 1CUYA 2NZYA 1ISHA 2AIRA 4I3FA 4O63O 1UZLA 2JK0A 1YA8A 3F0TA 1RE0A 4XVHA 3ZE1B 3M5PA 4PNZA 4M55A 1ACJA 2FN3A 4ZT2A 2W8BA 3KFVA 4BMZA 5B1DA 1UOOA 3L7CA 2B6NA 3NBUA 1RWQA 3PX2A 4LF8B 3BE5A 3I4FA 2YJGA 4WGFA 3LWBA 1YCGA 3GCDA 3HDTA 4UCQA 3O1LA 3UMBA 2G5TA 3OHMA 3OZUA 1HX7A 2C59A 3VKVA 1G20E 4HXEB 3PYMA 2VBIA 2D3TA 1M5TA 1FOEB 4RQTA 5PNTA 1CEYA 2BCGY 4XDHA 1TQ6A 3OJLA 4LHSA 5K05A 1NR1A 2KSQA 1IG0A 4PN3A 1KYYA 2R62A 4DCUA 2DRIA 2NUAA 1G7TA 2PR2A 4DRXA 1QORA 1U99A 1JJFA 4C3ZA 2IX3A 1L2TA 3GFBA 5TJHA 4RH3A 4X60A 3M3DA 3UJPA 2PMBA 3R3VA 2P9BA 4H35A 1VXOA 2IPOA 3CGWA 1L4GA 1BHO1 3F3KA 5TPZA 2ZWVA 2CYAA 3K92A 4OCZA 2DH6A 3ZVNA 5CYPA 4N0PA 3KKOA 4QWMA 1K68A 2UU9B 4F0MB 3MOSA 5LXTA 1XTQA 2IEIA 4Q3DA 4W6QA 4D4IA 5F4BA 1ZSVA 2X2FA 2B6HA 2QRZA 3K9LA 5F98A 4RQBA 1FRQA 4V1CI 1E3EA 3DCNA 4D4HA 2R47A 3ZV7A 4DGQA 4FYPA 4L75A 2FPKA 1JHAA 1Y5RA 1Z4PX 2AD1A 2JCXA 2YOGA 1DXQA 3DBIA 3FI9A 1TZ2A 4LRXA 4YAWA 4XI9A 3UTCA 3BL8A 3Q0EA 4IIJF 1L4EA 5CAEB 3A6HA 1LUAA 1DC3A 2EBHX 3LD9A 3WVNA 2I54A 3D6JA 3B6IA 1LDYA 2VWPA 4ETWA 2FPIB 2QR5A 3CA8A 2P6NA 2WYUA 2Z9DA 2GEDA 1GL9B 3G1UA 5DNWA 2PJUA 3JYHA 4M86A 4DDTA 1P5RA 3VJLA 5C8ZA 1CP2A 1Q1NA 1X7WA 3H4MA 4TV8B 1NXSA 3DT9A 4YN3A 3B9RA 1EB8A 1GG8A 1QYWA 2NU8A 3FPBA 1DAFA 1BWVS 1T3SA 3A1FA 3AJRA 4MLCA 1HH4A 2AGVA 1H3NA 4OHKA 1IBMB 4LWPA 5KWVA 1N2XA 4FFLA 4MWEA 4EKEA 4DR4B 1IXSB 4FN5A 4EFMA 2UYOA 4X1IB 4YXWD 5JHHB 4IG9A 2X58A 4ND2A 5LU8A 4B6FA 5JU6A 4DDVA 1MABB 5T4FA 1JDVA 4AZ3A 1Z4JA 3DH0A 1FTQA 4GOLD 4ZI3A 3H2SA 3EPLA 4LK2A 4CKBB 1PK8A 3D8NA 1VMAA 3IIMA 1Z4OA 3L0PA 3SBXA 2FFQA 4MYCA 3M6MD 1P75A 5LP6C 2C8KA 4QE3A 4BBZA 4IPTA 2ZWMA 2ZBGA 3CYFA 3DEYX 4FOSA 2QUJA 4JU8A 4A26A 1U28A 3NAGA 1S1MA 4KO4S 4KAJA 1RRMA 2BR5A 3IHLA 3ONFA 4X7MA 4ZZ2A 5IC6A 1ZD9A 5KCMA 1XP5A 3X1KA 4MA0A 1GPAA 1Q17A 4GX5A 4IILA 4PU0A 4BQEA 1FP6A 2CVOA 4FMDF 4CYMA 2ORVA 5SYAA 1ID1A 3OEEA 5DM4A 4DCSA 2XNJA 3E5MA 3L6RA 5JADA 2XZLA 5KNDH 3CPHA 4OAQA 1HLDA 4P7GA 1DI0A 2D2EA 2WVGA 2GCGA 1O97C 2W6PA 3C6ZA 3DB2A 1G18A 4WY2A 5DHAA 1XROA 3PIIA 2VNAA 1OJLA 3CS3A 3ID6C 3G9TA 4N47A 5HKBA 1MXHA 4MX8A 1L5HA 1EJBA 2OPBA 2V58A 2I2BA 2PCLA 4ZCRA 2GM9A 2Q3FA 1FX0A 2YXNA 4IDDA 1WOYA 5EIEA 5LQAA 1V2HE 3DE6X 3E9EA 3O1JC 1P5FA 2P9TA 3NM4A 4Q1EA 4PCVA 1DRKA 1GNQA 2PANA 2CLKB 2XQJA 3A25A 3OEHA 4IFTA 5B5SA 2ZS9A 1CB0A 4PGAA 1VKNA 3D3EA 3OP4A 3KUXA 3Q7QA 4MR7B 4TWJA 1YS6A 3RUCA 3JSAA 4YV2A 4B2PA 3EC7A 3LVBA 2ZM5A 4LYGA 5FPYA 5L3SA 1FZTA 2CDNA 4EATA 3QFRA 3QNWA 3SXUB 1UW9C 1XJCA 2V74B 3JVVA 4WPGA 4B3FX 1FUYB 1IG3A 3GJTA 1D2NA 1NMXA 1V41E 3KXDA 3QI2A 2W43A 5H82A 4GKVA 3R74A 1L4HA 3FY4A 4C3VA 3VPGA 3KPJA 3ICPA 1FS4A 3DGFC 4DJAA 2PIDA 5AD1A 1ICEA 2J6IA 3GDWA 3HCDA 2SCUB 1SCJA 2ZGVA 4HGNA 4B33A 4NXMB 1PD0A 1QPGA 2AN9A 1FQOA 2VJKA 4UEKA 3DLTA 3COJA 3FTEA 1G8HA 3ASVA 3PNVA 3A37A 5KYXB 4K6FA 3ZGYA 1GA4A 3OPYI 1D2CA 3QVUA 3UWMA 1SOMA 2Q4EA 5AVQA 2ZE7A 3OIFA 3SEFA 1EUDA 1P5HA 1VLJA 1AX9A 4G89A 3GIWA 1I4TD 3PGVA 4M38A 2QTFA 1BGXT 4D43A 4Q9HA 4BGDA 2JIDA 1F7UA 4FGWA 3VKFA 5T4EA 3PRKE 4MZDA 1JIUA 3WRXA 2I6FA 3CEJA 4DSZA 2W6MA 3ZWMA 4J16C 4ZIRA 4O4JB 1NMZA 4RPCA 3A27A 3TL6A 3VO2A 5AVVA 2QTMA 2FOLA 2ZATA 3CW2A 5BWOA 4B47A 4R8MA 4UNRA 2J3LA 4B5LA 1BXGA 1YZFA 3GG9A 5IHXA 3LXMA 1RR6A 5FTJA 2BELA 1QANA 2OR3A 4KOAA 4LFBB 1Z4IA 2WAXA 3IVGA 1DLIA 2XWSA 5TARA 3DB1A 3KBBA 3W2IA 1CW2B 3G2NA 1O9GA 1KRHA 3KQOA 2GPWA 3AIIA 3PICA 2QR2A 4PTZA 3E9DA 5AHRA 5B7NA 2OFOA 4KLRA 5HCNA 3H9EO 2QTVA 2V65A 1L9XA 3KM0A 4TRNA 3K32A 3IODA 4QX6A 1RYFA 3D9QX 2ZYAA 3QH4A 2FN4A 3I09A 4MQMA 4P31A 2ZRLA 3ENVA 1J56A 4KCGA 1QH1B 4ARCA 1N0UA 3FCCA 4JR0A 1Y3FE 3C6QA 3L3BA 3MVEA 1T43A 1U9IA 2I62A 4RPKA 4FI3F 2CWDA 5EJMA 3R4CA 2BFAA 3R77A 3ENWA 1CQIA 3HYCA 1WB5A 2CXOA 1AGYA 4KLZA 4ZVQA 4BFWA 3BHIA 3UFXA 1IVSA 5KWSA 4PPGA 1E2PA 1SQFA 2H7VA 3LKVA 3AY0A 3DDWA 3IB6A 4UBOA 2HRRA 2V6IA 1QHIA 3BHJA 3P2KA 2PK3A 3NBZC 4QGFA 1KDPA 1Q0QA 1E7MA 2BBWA 2BR3A 2O06A 4H3VA 4MHSA 4C87A 2IUEA