1ZHOA

The structure of a ribosomal protein l1 in complex with mrna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA
publication title New insights into the interaction of ribosomal protein L1 with RNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein/rna
total genus 56
structure length 228
sequence length 228
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 1zhoA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zhoA02
3U4MA 4QGBA 4F9TA 5DM60 1CJSA 3ZQJA 5DM70 3U56A 3FPNA 1DWUA 4QG3A 4QVIA 2HW8A 4REOA 4DFCB 1MZPA 3QOYA 4LQ4A 1AD2A 3TG8A 1ZHOA 3UMYA 1U63A 1I2AA
chains in the Genus database with same CATH superfamily
3STWA 1DBRA 2OHOA 3U7IA 1EVQA 3U48A 4DLXA 4BNWA 2B6HA 1OB2A 4LY3A 3AHCA 1EQ2A 1D0SA 3KLPX 2CFOA 2XYPA 2FETA 4M60A 4DQXA 4PYJA 5C53B 4TKUA 1IULA 1Y81A 3VNQA 2J4DA 3NWEA 4DXHA 1IHUA 1TT5B 2ZT6A 4WLEA 4QG3A 1L8OA 1UMKA 1UP7A 3SVTA 1M7BA 2FQQA 1G4UR 3QU7A 2GAJA 5E1MA 4OCZA 3LXRA 3QOYA 3ZCPA 3ENKA 1TA9A 5C51B 3OOJA 1DS6A 1KEZA 1N0IA 4GOXA 2C8KA 5TMDA 2HHCA 1LPOA 3EFEA 2VAWA 4YHBA 3GLFA 1N2XA 1I7DA 3L0SA 1QVWA 2FVYA 2B2NA 3A25A 3HJRA 1OB5A 5GJBA 4UNNA 4X8OA 4JK3A 4C04A 5AIBA 5KB3A 3AXSA 3KAQA 4MRVA 2MSDB 3PC6A 4Q18A 4ANFA 4TS4A 4IPTA 1EP3B 3SD7A 3VU8A 4KO1S 1E3DA 5JAMA 1XE3A 3S2GA 2C1XA 1AKNA 5B3AA 4QTTB 1GAWA 4ALKA 2HPVA 3D2CA 1TCUA 2VNIA 1OV6A 2XUDA 5DWDA 3KR0A 3HKEB 3TZCA 2E1RA 3TOVA 3IUSA 1Z7WA 2K2WA 3ASYA 3NXKA 3OOWA 3DUFA 1RADA 1SWVA 4XYGA 1DWUA 3RSOA 3I9V6 3SQDA 4W9NA 2WBLC 2VDUE 1JFFB 1X70A 4IH4A 4Y1FA 5ECYA 2INGX 4EF4A 5AESA 3UJNA 3BWMA 4OLBA 4MR8A 2RIRA 4P81A 5FWYB 2O0MA 4E1BA 3ZDAA 4E70A 3NDIA 2MOKA 3QPBA 1IPHA 3KZ1E 1X7WB 4KJZA 1KI9A 4U02A 4UM8B 4YRAA 1RI4A 1N9KA 1A9RA 2VPTA 5HYVA 5IC5A 3ZGVA 2H51A 3HV0A 1FVFA 2FMHA 4FZJA 4GQIA 1V7QA 1JHDA 1UDAA 1QUFA 1JDZA 2VDQB 3AEQB 3MINB 5ADUS 1JR3A 3BHNA 3M4ZA 2G9QA 4M2LA 4M3NA 5HRCA 3WWOA 4Q9JA 5ERXA 4U3JB 2QAGC 1QCZA 1NRXA 1TTQB 2FE1A 3B8HA 2ZIFA 3G49A 3L04A 4X1YA 3ZI0A 1R4NA 5JROA 2BSQA 4W1QA 1X8XA 2NU6B 4YXFA 1KSFX 1C2TA 1UFVA 4ZGGA 4NDZA 3Q7QA 3IE2A 2VJBA 1F12A 3H2HA 3QVTA 2FPPA 3THRA 4XIGS 3OIGA 1HYQA 2XYGA 1BXRB 5LQSA 4FZRA 1N78A 3CFYA 5HZKA 2GM5A 4JU8A 1NJGA 3C3EA 4QA9A 3RRNA 4K9RA 2BEWA 4F8JA 5GY7A 1LB1B 1P1JA 4ARVA 4ZJYA 3HK2A 5E6SA 5BWBA 4QOGA 1OYVA 3GVIA 3BMQB 4B8ZA 1B0ZA 1GCAA 4M83A 2CMGA 4KQ9A 4IIUA 1CUDA 3CBGA 3DEFA 5F5NA 5GZ3A 4LZWA 2IYRA 1NDQA 3KV1A 4IDCA 5A3SA 3EGCA 4HDSB 1MU0A 2HT6A 3NYQA 5A04A 2PUWA 3EIOA 3HXPA 3P2JA 3UF0A 3MIIA 4F6RA 5IAJA 4MAFA 5CT5A 4TV8B 5SY9A 3IOBA 2FX3A 4ZFNA 1CD5A 4JODA 4F6LA 1J20A 5ULLA 1X42A 3UWDA 2GD1O 4EW1A 3HJTA 3VYRB 1KYYA 3G0IA 2JGNA 3ABSB 4MULA 3OG9A 1X1SA 3TQRA 3ZCVA 1XTQA 4DEVA 4IS2A 3GJ8A 4IDGA 4YROA 3BSWA 4E5VA 2PD3A 4RHCA 1J6UA 3RF6A 3FOBA 5DNDA 4UCQA 2Y8EA 4UM9B 3A4VA 1MEEA 3JQRA 4J91A 1YI0A 3SMVA 1SR8A 4MO9A 3BJIC 2ID7A 3AETA 4Y18A 2WF5A 3B6ZA 4WOKA 4TRRA 3T1TA 1GZVA 4FDTA 1TTTA 3IEUA 5H9WA 3MBKA 3ND9A 4ES6A 1S7GA 5IW8A 4DJJA 4UDYX 3R7AA 1GILA 2ODNA 4B3HA 1LPPA 4HGQA 2AJBA 4FMDB 5DRYA 1G4HA 4Y1RA 2VJKA 3T52A 4CMKA 2ZJ1A 1K8ZB 4YS6A 4X1IB 1L7VC 1DT3A 3GD7A 4RDIA 4WLVA 4RJTA 1HG0A 4M22A 4TLCA 1T4BA 2CLEB 2GZDA 2FSVA 1RWQA 4RLSA 2ZM6B 1PJTA 1T3ZA 3X1YA 16PKA 1X87A 1T35A 3R41A 4OREX 1C4OA 1RQNA 2ZQZA 5AVZA 4RGYA 3SZUA 1OFTA 1P1KA 1P4GA 4MV5A 4A4DA 3QXHA 1IOWA 4QTZA 2C2BA 2B1GA 2Q5QA 3F49S 3TBHA 4L51A 1SXQA 2Z4TA 4BKMA 1B4DA 5EJ6A 1DDGA 3VR1A 4ZHSA 4UBLA 4FGKA 1MDBA 2Q27A 1J97A 2CL6X 2YC2C 5G2OA 3GLRA 3TW4A 4F2HA 4D4MA 4NFYA 4RH0A 2XTNA 4ZPJA 1OIXA 4M54A 1Z13A 1PK9A 4REQB 4QQNA 1DTWB 3TNLA 1NVDA 4OGLA 3S2UA 3WGLA 1P2FA 4C43A 1GXSB 1SU6A 2RGAA 4JI6B 3TX6A 1D8AA 4HAOA 4BKPA 1IVNA 3NEYA 4G4JA 4IO0A 3DLCA 5A4IS 3CG4A 1Y33E 1NW9B 2KX7A 3GVHA 2OZLB 5B7GA 2O59A 2VATA 4NESA 3VAZA 3K70B 3HO1A 5BYBA 1NVAA 3HN7A 4TV8F 3R75A 4N5LA 1RBYA 1IUKA 1VMAA 4LHXA 1JXMA 4F12A 3E1GA 5CA1A 2R96A 5A9SA 5TQ0A 1YQEA 1CHNA 2WTUA 3QE2A 2HPZA 3HCAA 1CS0B 1DO8A 2RG1A 3E61A 2QNBA 2O06A 3N0WA 4LDRA 3MLAA 5ITZB 4XD2A 4AN4A 4BFVA 1A8UA 4YDQA 3FR7A 2I7DA 5IAAA 1SXHA 2PN1A 1K75A 4E14A 3HB4X 2VS1A 3D7KA 2AJCA 3LP6A 4A6XA 2IHNA 2VWGA 1BQ4A 1UP4A 4TQAA 5JWHA 3ESRA 1WHTB 3RNOA 1IN1A 5EQJB 4AZVA 4FBMA 3NT4A 2YIJA 3BWXA 3P9QA 3ZZ1A 1T91A 5CM8B 1I14A 3B2NA 3LYLA 1GYRA 2YWJA 3W2TA 3N6VA 4XVCA 4UE3S 2JLWA 4TZ6A 1PF7E 3TTWA 4HY3A 2ODPA 1E5TA 3JQFC 1WDDS 3V32A 1N2OA 5J1SB 3PEUA 3FZEA 1L7RA 1LC0A 4K2AA 4BC1A 1BDMA 1DJPA 4CLXA 1M1YA 1XK6A 5K0CA 1JJAA 2X23A 4MWDA 4NJMB 2YFQA 1QH9A 2SHKA 4LOLA 1QFXA 2WF7A 3K9CA 1AG9A 4OH1A 3RSHA 1Z4OA 3WL4A 5HILA 5EJGA 3R7DA 4B82A 1Q12A 3DVQX 4FEYA 3D2AA 1OTHA 2Q3MA 3ZZTA 2B94A 1MN6A 1JLKA 2QYSA 1TVKA 4JSTA 2UZIR 1CLUA 4QDZA 4V38A 1AKTA 3J7TA 3DD1A 1C1DB 3HJGA 2VOJA 1GTVA 3ZXUB 4NS4A 1FY2A 4HAXA 2CYBA 2FPIB 4BQIA 4I8DA 4RORA 1A9QA 3H5IA 1M7GA 3KDAA 2A0KA 4DAOA 1HDYA 4ETWA 4F92B 2D54A 4Z8XA 1U7ZA 3WNQA 2PIDA 4R2HA 2QQFA 1VDMA 2R62A 2ZWIA 1M33A 4PSCA 4FGWA 5D2CA 4J16A 3TS1A 2JL1A 3D4IA 4UU1A 5DX1A 1VKHA 5KUTA 2Q3DA 5A0FA 1H9CA 4IDBA 3PQ5A 1KY3A 3U3RA 1NBOA 2AUMA 2C7RA 3EMDA 5KTOA 1B73A 1U0SY 2B92A 5L7WA 2JCYA 2PWYA 2C7OA 3DLTA 3RASA 2BKVA 2GFIA 5CM2Z 5FPPA 2RARA 2RHOA 1CIPA 3VI3B 2QDXA 1IHXA 1XA0A 2OUIA 3ZCXA 2PO5A 4NEQA 3TCXB 3WMFA 2XJ9A 1C0EA 4UHDA 3S8MA 2CHFA 3K6JA 4P7FA 3AX6A 1XAJA 1EUZA 2R1UA 2ZYDA 4NK4A 3UJ9A 1ZM7A 1TKCA 5K8TA 4URZR 2FPXA 5CIYA 2MSLA 2J7KA 4RK7A 3QEOA 2DPGA 1D1PA 4RSGA 4X8HA 3LM8A 3UMGA 1KEVA 5JZMA 2Z08A 3AC0A 3SJCA 4BY9E 4Z49A 1E3JA 5GJVC 1ZD2P 3SS7X 4DLBA 2IKQA 2F59A 2I4TA 2WI8A 2YDYA 2IITA 5INTA 3PI7A 2BKLA 1EDEA 3QY0A 1GZUA 2ZYIA 1QAMA 2AOTA 3HMKA 3CLHA 3FXAA 3G7NA 5M7EA 1W29A 2Q9AA 1CZHA 3QFCA 3R8XA 4I5DA 1AS0A 2YWRA 3C45A 4HQ6A 1B76A 2XVXA 1U90A 1SPXA 1T9DA 3E4CA 2NXEA 2XV1A 3MMZA 5DI3B 5FO0A 3TQIA 3WKAA 3F1KA 4J29A 4C88A 1C4WA 3IJ5A 2X5KO 1OFUX 5CDSA 5KKAA 3NDRA 4ZTZB 2F3RA 2B21A 3CS3A 2W2TA 3L4BA 3A1FA 4BO2A 2VPIA 5I7WA 2IQIA 3LQKA 1IBLB 3W3AD 2P67A 5EEGA 3ENVA 3D64A 5A5VA 1JU9A 3OZSA 1U6JA 2VF2A 3IEKA 4LMAA 3JQDA 1NMZA 3RYHA 2MSEB 4ZMRA 3RQIA 2GK3A 4CDMA 3B1XA 4QT0A 3T12A 3EVTA 1UPXA 3G0BA 2ZS8A 1RHUA 1BIFA 1JUDA 1Z0IA 2ZPUA 4HYQA 2HJGA 2G06A 2E5LB 3Q9NA 2OCXA 4MQBA 5G41A 2GYVA 2VVTA 2W7TA 3C8HA 2CJYA 4G1BA 2VQ3A 4QJ5A 3GDGA 2HEIA 2QVLA 1Q0RA 4II2A 1ISMA 4QLOA 5G40A 4HVLA 1WSBA 1FBNA 1I32A 2REQB 4A7PA 3VYUB 2GJSA 1BEZA 1UK8A 4CKYA 1O89A 1NIJA 3PFNA 4O29A 4XAQA 1J0AA 5EPEA 3WVNA 3LZCA 3TNYA 1NBME 5KPDA 4D82A 1JDTA 1G8SA 2KE5A 3T54A 2JGDB 2I99A 3VC3A 3H8JA 2WHPB 1CJSA 4K9SA 3OTOB 3U56A 1NVWQ 2UYQA 3D3QA 4K3UA 4EJMA 1N2ZA 3U7HB 1E3TA 1NVXQ 5EN4A 1KDPA 2QRNA 3VHXA 2PT7A 3H5WA 5LQMA 1XLTA 1ZR2A 1VZ3A 3BC1A 3F5SA 5L53A 2FR8C 5CW1A 3SSAA 4B3GA 1G2IA 2HZBA 1Z5OA 2XQKA 3BD7A 3HFJA 1FMCA 1FK8A 3FRIA 2WSSA 3QLUA 3MTJA 3UV7A 1L5SA 2Q2WA 5KYKA 1XLVA 1ZMOA 1FB5A 3PIDA 1GT6A 1FQKA 3DEIA 3VO9A 4N12A 2E6KA 1GG5A 4TTVA 2NZXA 1JLSA 2JS7A 3DZ8A 4LJ9A 1KIFA 5KNLA 4LBVA 2BP7B 1L7EA 2YMQA 3DZFA 3G23A 4YRDA 1IL0A 1P60A 4PRYA 4FB5A 5G3ZA 4MVJE 3JQ9A 5EQTA 2BH9A 2FW8A 4G97A 1IJEA 3QVGB 4KGDA 1ZW6A 1GRVA 3FNHA 3I9FA 1IAQA 3L6OO 1HE4A 2ZAGA 4YT5A 1TZ2A 1XRSB 3BMOA 4GOLD 4MKVS 1QNLA 1LK7A 1NT2A 3CNLA 3EDYA 3I04M 4N8SA 4QHSA 3UMVA 3PNVA 5MFPA 3KJIA 4Q4AA 5ECGC 5BYKA 3ZD9A 2KQUA 2XA1A 4GU5A 4XWKA 1HNWB 1VYUA 2YNMC 5FP0A 5B1SA 4C0LA 4H31A 1JFSA 3JAWA 3QX8A 4FFSA 1E1MA 3EAQA 1PUXA 2DUWA 5E1DA 5A0TA 2JFXA 2C3UA 1XDGA 2J09A 2HXSA 3ILXA 1FZTA 1H2BA 3DOHA 4FCVA 4DSAA 1OX6A 3QU4A 3F9RA 4U7WA 2DFDA 1UP6A 4S04A 1JPNA 5T57A 1Z3CA 4P4LA 3VH3A 2I65A 3DVSX 5JXIA 1V4VA 4JIGA 2EHDA 4CQMA 1F17A 1PR2A 1OJ7A 2BBOA 2H5JA 2MINB 2WZCA 3A27A 5IVDA 1L4EA 1R0CA 1U0GA 2X86A 5EQFA 5SYNA 1ULUA 2WU4A 5K3FB 4BZPA 2A4KA 1M54A 1TYCA 3D8HA 4KZKA 1F4PA 5YASA 5TPWB 1VFPA 3IFSA 1UT8A 2BF7A 3I3SR 3JSXA 1ENOA 2O4CA 3IQDB 4LF7B 1DHTA 4HWTA 3DBIA 3LYHA 5REQA 4JYZA 3A10A 5HJ5A 5IABA 2CJWA 3IURA 3MWGA 1F3LA 1PEDA 1RYNA 4IIXA 4O25A 3CRNA 4X1OA 1OZAA 3ISJA 4OHWA 5WRFA 2NOAA 3UWOA 3FGOA 3RQSA 3EH2A 4J1SA 3WGNA 4B3XA 1Z0UA 2Q1YA 4G5OA 4C0HA 1E0DA 4HF7A 4UTPA 5CK5A 5A5DA 2ONCA 2QV7A 3ADCA 3TEFA 4JFAA 4DLSA 3HYCA 4U2BA 5KX5F 2CT8A 2BH2A 5EIBC 1EGAA 1SHJA 1ZDMA 4TTTS 2GCPA 2HHHB 4RZXA 5CLIA 3SKYA 1H2HA 1LSJA 4DIKA 4N48A 1M7HA 2FAXA 2FFQA 2GQ0A 3H7IA 2FG7C 1E2QA 2HCJB 2WOOA 3PR1A 1MEJA 2C9BA 3AILA 3LY8A 4JP5A 3W6UA 2HMVA 2IUFA 1CUCA 2VHCA 3GEHA 3JQGB 1KAEA 3GT3A 3NO4A 4JQOA 3M7IA 3RE1A 1C50A 1NW8A 3CX7A 3RG8A 1OYOA 5B3LA 4JI7B 4I1RA 4X44A 4EZEA 3DF7A 4I50A 4ARZA 4ZOAA 2DFLA 4MV0A 4WUVA 4P93A 1ENPA 3K72B 1A50B 1IZ8A 2CWWA 1KTIA 3P94A 5EIBD 2O8CB 5DM70 4P4NA 3NVAA 4GP7A 3PE6A 3OOHA 2NUBA 3C74A 2JFZA 3LCRA 4WXRA 3NBMA 1MP0A 2I6GA 2NUTB 1BKDR 2X41A 4ZKEA 5K0LA 4AYTA 3KKQA 3R76A 2ZG6A 3A28A 3SQWA 2I33A 3SIRA 4XOIA 4YRBA 4RIGA 3EFOA 2I55A 2D4HA 3GFRA 1GLGA 2HD4A 5AHKA 4J2OA 1GTJ1 3RTBA 4DNPA 2VZEA 1S3SA 2OO7A 1XMPA 2O8FB 1K3FA 1VE1A 3A37A 4PWZA 2ZYGA 3E1KA 1SUDA 5ALDA 3I52A 3A4YA 2XD4A 3RARA 1KOFA 3WNDA 1R0BA 3ITKA 2GD0A 3KKPA 3O5AA 1LWNA 2HDHA 2QYTA 3DM9B 4NU8X 3O73A 1VC2A 1TTHA 1R10A 1VJDA 3BFXA 4KGZA 2OFWA 1D2CA 1DC6A 4IG4A 4ZCLA 4KWEA 4GUAA 3QEMA 3SHFA 3EVEA 4YMGA 3TLGA 1HDXA 5SZJA 1C3XA 1V6AA 2I3BA 3FOCA 2VNKA 2YVUA 1CUGA 4ARUA 4PG4A 4J43A 4ZT6A 4KI7A 1Y63A 3O94A 3IAHA 3OCJA 1RLTA 3Q9LA 5CDGA 1GAEO 2ZYVX 2P9QA 2RAFA 2Q3BA 4BLQA 5LYYA 5I7OA 4P7BA 4O3MA 3ICOA 2JDID 5DGDA 5JQWA 1G5HA 2C8VA 3BRCA 3LK7A 1TF2A 4I55B 4L3VA 2YHUA 2AFHA 1KBZA 2ZLBA 1FXWF 4E2WA 1REQA 5BSEA 1G7TA 3L7JA 3ORHA 4NAUA 4RZUA 3EF3A 2CDCA 4YMIA 2QTBA 5AKKA 3VVBA 1GRRA 2RHTA 1W87A 3NT2A 3QHQA 1N4DA 4Z2YA 3DPUA 1GDDA 1F2TA 2A1TS 3PC2A 2FW0A 5FT9A 5K6AA 1H5NA 1V39A 1SBIA 2MSWA 3ZYCA 1APBA 1L4GA 1VLQA 1G6KA 5DASA 1D6JA 4I7EA 1J39A 5D8DA 3PFCA 5KYVA 2QJOA 4ZO4A 2HXGA 1IM5A 3MCTA 4YQYA 4DF3A 1TF7A 3WLFA 1T5TA 3M6FA 2XW6A 3JALB 4ZGWA 3IALA 4WXYB 4M0KA 3GPCA 3KQPA 4FP9A 2RKOA 4IIJB 3T5AA 1BHJA 4DG9A 1IFXA 4ZQEA 2Q5CA 3ZXSA 1E5XA 3AFGA 5H3HA 2GFQA 2HU5A 3QIAA 1DQYA 3T99A 3C16C 1DQZA 3UHAA 2BI8A 3CH4B 1GYQA 3M3DA 3BGOS 4BLPA 1NX9A 2FPLA 3W6NA 3NHLA 4BBAA 2VF7A 4GHWA 4WCFB 2I6XA 3ON5A 4BMDA 4CUJA 1OPXA 3IKLA 1S3GA 3CEHA 4PZLA 3QK7A 1E58A 4FSDA 1SJ9A 3OZTA 1U80A 4JEHA 2PU7A 4L15A 4KQXA 5DN9A 5EIXA 4OJYA 3A3OA 2Z3WA 1MRSA 3FWNA 5FWYA 3ZN2A 3ZLVA 2PE5A 5CB8A 3DAHA 1KU0A 1F8UA 4A0GA 2AQHA 3BG5A 3WDKA 1OFUA 3E9NA 4QGFA 2QTRA 5DXJA 2JJ1A 3GUZA 1A4RA 5JJ5A 4QM7A 2YZ7A 1SQFA 1WMDA 1ULTA 2PGXA 3QFTA 5K0SA 1KP3A 4PYKA 3TD2A 4KG7A 4DPLA 2CXPA 2P69A 3CH5A 1ZSVA 5JZ9A 2OG2A 4DCUA 5LJLA 3MINA 5EMNA 2A86A 3BTOA 4FUQA 2WJGA 2F1IA 2H1LA 3IP3A 3OP4A 4MUEA 1R5NA 1QYVA 2ZDHA 3EC7A 3RK0A 5CDFE 3TQHA 3LIIA 3IL2A 3UMSA 3QSYA 2YZGA 1R4AA 5FI5A 5CG1A 2BW0A 1RI1A 1T36B 1P7VA 1UJ2A 4NULA 3ZGYA 5DRTA 2MDTA 3M34A 2ZYSA 2NU6A 4H1HA 1FU7A 1I10A 4W5JA 5CJJA 5F64A 5GGXA 3T06B 3AI1A 1O8CA 3KJQA 3L41A 1NSFA 1XELA 4I55F 1ADCA 1SZPA 3CZCA 3OKFA 3QQPA 5CJPA 2CJXA 4HNUA 3LFUA 4JASB 1Q92A 4M1KA 3WL3A 5IZCC 1PQUA 4L3OA 1EUDB 1AIPA 2BE7A 4Q1AA 4UE2A 1K5GA 1BXRA 4Q3NA 1ZRNA 2BR3A 3K4QA 1F51E 1HEIA 3HDTA 3KLMX 3ZWVA 1TPZA 4C7VA 2BFFA 4XR9A 5AR1A 2H16A 1G17A 1JWAB 5AK5A 1H8HD 4FC7A 2DQSA 4TT3A 2IIPA 4GRAA 5JXJA 3BMQA 4OHRA 3FN4A 2OO5A 3WV4A 4WFKA 4BU0A 5B55A 2B7BA 1TEVA 3ZE8A 2P4SA 4HDSA 5FOSA 4IIJF 1X15A 3L1JA 1EFPB 4QU9A 3H9UA 4Q1FA 2H8GA 5T5QA 1IK4A 4ALJA 1KR5A 2EJCA 1CY0A 2D1YA 1H93A 4ZQBA 4ZK2A 4TV8A 2AR0A 4S1VA 4FGLA 3K9WA 4HPJB 3VZDA 1EX1A 1X39A 2NVOA 3LE8A 1C7FA 1YJCA 4IWXA 2COKA 3DPIA 4WVFA 2X8BA 2IY8A 1WZIA 2RKWA 4NCNA 1CVIA 1T4MA 1LI4A 2P9BA 4MA0A 1AZLA 1QHNA 1QX4A 2HXYA 2Q0QA 3STXA 4CBVA 1ZITA 2WNIA 3CJQA 4IY1A 3VU0A 3LNCA 4PQGA 2EFYA 1YJXA 3GAFA 1OZGA 3JARA 3E7FA 4UUNA 1JDUA 2H85A 3VISA 3LXXA 1UZNA 2EFDB 1Z47A 4KXLA 2PAFA 2B1IA 4TYPA 4DA0A 4ZYZA 1C9EA 1UM8A 3PGVA 3A8TA 5DYGA 2MMGA 3ZLBA 2X4GA 5JNVA 2J9XB 3A1DA 3FFXA 3OJXA 1UC4B 3PA6A 4AVYA 5MGNA 1KOGA 4AKHA 5GIOE 4C30A 1QFYA 2EERA 1WXDA 2BMFA 4B8WA 4WAUA 4DDMA 5LOVB 3FGNA 1Y5LA 4YP5A 1KYXA 3QWIA 5LDHA 3H13A 3K1AB 3AUUA 1SWWA 4X1IA 1NC3A 1SIOA 2O8EB 3WBBA 2GYYA 3PC8A 3ZDXB 5BQFA 1ADFA 1A71A 4LWQA 721PA 4R69A 5AM5A 2Q9CA 3OZXA 4B75A 1CWUA 4WKPA 2YW9A 2X0FA 3L6CA 3ZHVA 3RSFA 1RRFA 3D7RA 5JAOA 2Y0PA 4U6NA 4EITA 5FAKA 3DTTA 4EEXA 2XEDA 1FXSA 2PYDA 3IUMA 2K7ZA 5JDIC 4EG3A 4PY2A 3TLMA 3JPYA 2C2OA 2PMWB 3F6PA 4R9SA 1YS6A 3O26A 4QG7A 5KIAA 3Q6MA 3FBGA 4UEOA 4BE4A 3FGPA 1A5SB 2HA0A 1JQAA 3C3BA 1G3RA 3IBGA 2Q3EA 1MABB 3KDSE 4NP6A 4Q3KA 3LF1A 5IDQA 4GW3A 3W5CA 2DT8A 4Z4GA 1P2SA 2IUYA 3I8SA 2VRBA 1JG4A 1WZNA 4RZ3A 1DTWA 3T3MB 1CZUA 1GXSA 1C4KA 4UOZA 4TMWA 1CJUC 1PGNA 4ZIRA 4ABTA 1XDDA 2OPHA 5HUQA 5B3JA 1Z6XA 2YCBA 2D13A 2Q0HA 3GDFA 1Y6ZA 5B2ZA 2X15A 4AN1A 4E09A 1Z34A 3BFPA 1OR8A 3EDOA 4AROA 4F45A 2X5JO 5C4IA 5A1JA 3MG9A 5B7QA 4RL6A 1DAIA 3AYZB 5F9FA 4PQFA 1BFKA 1O03A 3AV3A 5F7JA 1OZHA 2H2HA 3CX6A 5KSYA 1G42A 1NQ5A 1S2NA 1K4YA 4H3HB 4ZAVA 3TLCA 4GBMA 3PUZA 4CIYA 2P6PA 1NBHA 3DOEA 4L57A 4CTOA 4F97A 2CEAA 5JCXA 2Q1UA 4F86A 3AO0B 3CNBA 1FUYB 3OPQA 2RBGA 5A7FA 5BUQA 2GAIA 3FAKA 3B52X 1THZA 4BJ6A 5C5EA 1W36B 5CVVA 1MXFA 4C78A 3IDQA 1P44A 3K3PA 2W90A 2NSYA 2WTMA 4OY3A 5KNCD 5DGCA 4EELA 4PBTA 2V0GA 1GTZA 4AICA 1DCKA 4AZWA 13PKA 2VUSA 1DC4A 1KDVA 5B1YA 4ZDJA 1K86A 1BU5A 3B3GA 2WMNB 3PKIA 3UNXA 3IUPA 1ODIA 4WKCA 2NACA 3PUXA 1XDZA 1WHTA 3EC1A 3QYJA 5AKIA 2MYNA 4B71A 4R2IA 5H16A 3UAWA 1GL9B 5JY1A 2NGRA 1O54A 2R8OA 3TSWA 4BAZA 4C0BA 5LOVF 4G5QA 1OFHA 3QEKA 4PZ0A 1FJHA 5JCJA 4H18A 1W5EA 1EVYA 1AGYA 1Q7RA 2CLCX 5GADl 3UHOA 1UDWA 3Q7TA 2OGZA 1VKRA 4BN4A 5DNCA 4B7CA 2Z6QA 5SY4A 1XQ6A 4W5RA 3LCUA 1FYWA 2HJVA 2GPAA 1ZXBA 2C2ZA 3G88A 4I3FA 2QL6A 4KZPA 5HCNA 5JQGA 4L6AA 3D1LA 5AW4A 1AS2A 5CEJA 1EWYA 2IYQA 2FFAA 3JTMA 2ZZNA 1ONSA 1TMYA 1Y4DE 1VPTA 3IP9A 4TPKA 3G2MA 4WXEA 4YWJA 2OQVA 3TPCA 3ZD8A 4CPDA 5B1EA 3OC6A 3AF0A 1JVBA 4H0NA 4R71A 4AMZA 5C4MA 4MVXA 2B4YA 1GTSA 4ZGBA 5DP2A 3R2JA 4WZBA 1Y3BE 4QNMA 2UZ1B 1RPJA 1XCGB 1LXCA 1SM4A 5FR1A 1ZCJA 1EZ4A 2BVNA 1GN8A 2A6PA 2ZRDA 3L49A 1LPNA 4D46A 4GL2A 2QRMA 4RTPA 2VWQA 4YJGA 3WDMA 1SKMA 1KAGA 1T8UA 1YMUA 2R8YA 3KEGA 4JBXA 5HDQA 4BMOB 1XCOA 2V96A 2XZPA 3GGPA 3QKIA 4MQUA 3UBTA 1QKJA 2VCYA 1PS8A 3VU9B 3OPMA 3PHBE 4IUDS 3PYLA 3C6MA 4HB2A 1KBQA 2GN2A 3FGZA 2LKCA 2VO1A 3QLVC 1X92A 4IXDA 1Z37A 3AONB 3D6HA 4N1AA 1BE6A 4DLLA 1EMDA 1GAQA 2CXTA 1L5MA 2YFYA 3OT1B 4X3CA 4EHFA 1PTKA 5BUSA 4PLPA 2JLUA 5TS3A 1OU0A 1W94A 1XMOB 1YJ5A 2NYVA 2J4FA 4Z3KA 4K9DA 3HRIA 4MSUA 4Y9RA 1KSGA 4M8NE 4ITVA 4MR9B 1HSOA 3GRVA 1KORA 3NAZA 4DCGA 3U4MA 2J3HA 2Z95A 5BQOA 1LI5A 2X58A 2ZAIA 4K28A 4E22A 2BFNA 1YJAA 3AUXA 1O94A 2HWWA 4Y2VA 1VRWA 2C04A 1EVIA 1SELA 5FX2A 5KHOC 2FG6C 2XB4A 1QYRA 4Q4DA 5J5AA 2H52A 2XZDA 2ZTVA 2GSDA 2XBLA 2ZI4A 5L51A 5CT6A 2BFAA 5EWLB 1U9ZA 1FRQA 2GO7A 1Q17A 5LKAA 2XF8A 2PMBA 2IHVA 5T4FA 1E6KA 2Z8YM 5E1BA 3B13B 2JJ2D 4P0PB 4DE5A 1GQFA 1W96A 4OMCA 4EW3A 3CZPA 5DI3A 1DIGA 2G6TA 2G4CA 1I80A 3DT8A 2VH1A 4OOEA 5EP4A 3WGGA 1VKNA 3P9PA 5TLSA 1FU4A 1TCAA 1Z2NX 5FFFA 4YHHB 2KPOA 3QW4B 1BXKA 1WMBA 4YK7A 1J09A 1XZKA 4V0ME 1WPQA 3ZJTA 2IBMA 1E1CB 4WH0A 1QWOA 1F8YA 2JD1A 4N49A 1WLSA 5SV2A 3BGDA 2IOQA 2OYCA 3ZD7A 3V1UA 4LXUA 1Y1TA 3WYBA 1HLDA 2IP1A 3NKFA 3PUHA 3Q0TA 4GEGA 3ZIAD 1NJ8A 4YUXA 4U7DA 2CXRA 5A4MS 2NP7A 3T95A 3ZGNA 4EGQA 4JJZA 1A9OA 2WD7B 3OTQA 4L7VA 3BPSA 3G8YA 2ZRJA 1TW2A 5KWVA 3W5DA 5BSMA 3WWEA 4KREA 5H7XA 2REQA 1A8IA 1R18A 1MX5A 5K09A 3ZWDA 2A94A 1PHPA 2ICAA 3CUTA 4WECA 4F4UA 4URYR 1BS9A 4ZT7A 4MQ5A 4EO7A 1CQZA 2DOKA 1LPSA 3GUHA 2BM1A 4ZP1A 5I9NA 2VYFA 3EZXA 1JHRA 4YJ2F 3EJ6A 4F1JA 4UTNA 5JV5A 1SFRA 3FOWA 2EZUA 1UC5B 4LGYA 2UXDB 4B4OA 1GCOA 4MAAA 1ZK1A 1AKMA 4MITA 1VI5A 1JPJA 4CLHA 1QQAA 2DHQA 3AH8A 3UYLA 2YHBA 3GRZA 1J1ZA 4KO2S 3E15A 4AMBA 2OLJA 1A2OA 1PT5A 3AW9A 5DISB 1TAUA 3NOXA 4ZCSA 4DCOA 2HT1A 3Q10A 3K8ZA 4HGYA 1YC2A 3WGJA 4JYBA 1NKTA 3EEIA 2CLFB 1FW8A 2FWRA 2ZIWB 2F1OA 1NFRA 2QM0A 3LJKA 3ZCSA 1P19A 3MLBA 3NHFA 3OURA 1YACA 1SA0B 4FOTA 4UASA 2AQKA 2W2PA 3B6EA 3T7RA 2BP7A 4Q0MA 2Q8QA 3Q5DA 4M1OA 3PXXA 3M5CA 5C37A 4IHAA 7ADHA 3K0FB 3QXGA 4KUEA 4Q48A 1E4YA 3I01M 1XZDA 4Q1CA 4PZCA 2PT9A 3QVGA 2PH1A 1DDIA 3W1WA 5EI5A 4DCSA 4LQCA 2O14A 1KI2A 3B5JA 3WMRA 2FMUA 4FLFA 2FK7A 5TQVA 4ZJUA 2NV2B 5JRJA 1IB0A 2P62A 2WTAA 5BV8A 2TRSB 3CWQA 3HR7A 3LC1O 4N01A 4OFBA 3DT6A 2WUVA 2EHJA 2Z83A 4EW6A 1TF5A 2GPWA 3NWOA 4IIYA 2OCDA 3H3JA 1BAPA 3GUVA 4U9HS 5JSYA 1M2EA 3BAZA 1EHCA 3E0XA 3ZWNA 2O0HA 4OXYA 2PT6A 2IEDA 4EF6A 4RLHA 3Q8MA 3P0FA 1DVRA 1JVNA 1LD3A 1IWPB 1FMFA 4PTZA 4WGFA 4HQOA 2PJZA 5K3FA 1GPYA 2AI2A 3NDPA 3TMKA 4D80A 1JL3A 3E1SA 5TPWA 3HJCA 4DW8A 2RGRA 5HEKA 3HU1A 3O8LA 2EW1A 4BLRA 4PS1A 2FOIA 1YRQA 2PD4A 3P0EA 2VDLB 4UNSA 3RHZA 4I8XA 2VF8A 4TLBA 2X2FA 1FFDA 4KWIA 3JQEA 1NOIA 1EYZA 4LXHA 4BFWA 1P7WA 5CVUA 2WTNA 3SM9A 4XUCA 1RHKA 3DOFA 4NMLA 3WTBA 5I4KA 5KSOA 5LM3A 2WSIA 1KK1A 1ZR4A 2V68I 3EUAA 4TN1A 5A4AA 2QRHA 3AGQA 2R87A 1I2BA 2VAVA 4HN9A 5F3RA 2H4XA 2AFIE 2GCEA 1ZCAA 2K4MA 4Q37A 1JIUA 4ZO8A 1TZBA 3FFWA 1GGEA 3UWMA 4TM7A 2OHJA 4WLUA 3RSSA 3TVTA 4LZOA 1IPEA 1S8NA 4ID3A 4PU0A 3E03A 3RS3A 3CEAA 1C14A 4EA7A 2XUPA 4DAEA 1DZIA 1UBEA 3VH2A 3JX9A 5LMZA 3AUSA 2DR3A 1KFEB 3JQGA 4PO1A 3TD9A 1X0XA 2ZCVA 4PC1A 1JJBA 4OQDA 4JI0B 4MQ4A 4IXTA 2ZBEA 3DQPA 3RROA 2IS6A 2PXHA 4P3NA 2GJ8A 1DELA 4GX2A 4OO3A 4RPLA 1JHAA 2FLKA 2JIZA 2XUFA 3MOIA 2N3ZA 1NN0A 2IK8A 2BFMA 1I3KA 1R9NA 2J48A 2KMLA 3A6LA 4KPGA 3TKYA 1Q84A 4RD0A 2YWFA 1EVZA 4YT2A 5A9TA 2IW3A 4WZAB 2O8CA 4PONA 1RXVA 3F3KA 1TZJA 2XQGA 3CGWA 1QM5A 2Z5LA 4UOEA 3EX7C 2A5FA 2IHTA 3A1VA 1ZL2A 4JN6B 4KXNA 2VJMA 2NUTA 4CU5A 2Q9UA 4PPGA 1P2DA 2FZKA 2O52A 1OVGA 3VUFA 3MGAA 2F43B 4D25A 3CE9A 2F4VB 5FPSA 5EJ8A 1HDOA 1PCXA 2BC9A 3QYPA 4ID9A 1RAHA 2Y2UA 2ZBRA 5TT0A 4NPAA 3V4VB 5HHTA 4WRRA 1ICEA 2GBIA 2QTTA 1EJBA 2PKRA 3B48A 2Q2NA 4YRCA 5L3SA 2H29A 4ZPXA 1OILA 4O4JB 1FJXA 1EK6A 2J1LA 4XOUA 3PWZA 1ZMRA 1RKBA 4ZDWA 1RM5A 1YOBA 1B93A 1S0UA 4AXXA 1OH8A 3JVVA 5LR6A 2WIKA 2I4LA 4KLAA 2LD4A 2Z3ZA 1YAHA 2GHQA 1PW5A 4MB2A 2XE8A 1KJNA 3E7PA 2AVNA 1P3Y1 3PVSA 4CGZA 3QOFA 5TC4A 2QWXA 4P36A 4U2GA 2XZTA 1EWQA 3T7KA 1BGWA 3R0VA 4YFYA 2ZU0C 3WC4A 1JEQB 2ZAYA 1KKLA 1ZGBA 4I55A 3JSAA 5F7XA 1FVHA 2RE8A 2GDJA 5JNTA 1UWVA 1CIJA 2X2EA 3P20A 5HKLA 1JHUA 2WF8A 2Y1EA 3WLRA 4Y30A 3MWLA 1DEAA 1JB9A 2I66A 4LX0A 4MP6A 3FTPA 1P33A 1GTL1 4MWCA 4OVKA 5AKLA 3V8VA 2DBVO 3WIDA 3E2PA 1ZEJA 4AZSA 1D3AA 1Q2XA 2G76A 3FVQA 4CKCA 5JDCC 2RB5A 4UNRA 2FW7A 1AD2A 1LRLA 3RANA 3WBFA 5F3WB 4FFNA 1UC9A 3ONNA 5BVGA 4N03A 1QS0B 3JALA 4UUMA 4F8YA 3TN7A 1AXEA 5FPHA 1IE3A 3DEJA 4C1NA 6LDHA 1QE5A 1JHMA 4KSBA 4IIJA 4X6LA 3R7WB 4C0XA 8ADHA 3LT4A 1P6XA 1NNEA 2QN3A 1KDTA 3DEAA 4FS3A 4KCGA 2G7ZA 1PWHA 2Y0CA 4I99A 4WTOA 3UKOA 1TM7E 3C3YA 1DOZA 1SOMA 3TZEA 3N8NA 5T6BA 5TY0A 3VR4H 1AMOA 3L5OA 2GHTA 4H15A 3UOAB 4A2PA 1YQWA 5BQXA 2EFGA 4WCFA 3T7TA 1ZRHA 2P3SA 3M49A 3MWYW 3BWEA 4DFCB 5B30A 1SCKA 1HQCA 3K09C 3QOXA 1CPYA 2TMGA 3JCZA 3NOOA 1R6TA 4JS0A 5DTIA 4BGVA 4GX5A 5AQ1A 4N8DA 1C7IA 1UFRA 3U17A 3LCJA 1Q83A 3OX2A 1UOQA 3NPAA 1H0HA 1R5BA 1T0UA 3OKAA 3VR5A 3UMYA 1Z6YA 2ZBDA 4NENB 1N6LA 2ID4A 2OENG 1QMGA 4GEKA 4O4JF 3TIFA 3E7DA 5GOTA 4OLJA 4O4IA 1IHPA 3RDPA 3ENWA 4NZZA 2RIPA 4RX1A 3ENNA 4GOKA 4ZCMA 5I4CA 2RI0A 1OKKA 3Q7EA 1QQ7A 3ZV6A 3KOZA 1UBHS 5ALPA 1CZKA 2OXFA 5KWSA 1ZI8A 3MNFA 4P3PA 1XCMA 2OORA 4Z7OB 2PMKA 1KZYC 5KQPA 1T36A 4BP8A 4MI1A 3KR2A 4ND4A 2DYKA 1V5GA 1AHNA 4UHCA 3UBMA 3RAFC 2RGWA 2XR1A 2PUTA 3H7AA 3NIWA 4P08A 2CVQA 1S02A 4F8EA 4HGZA 1RLIA 5LLTA 1PWYE 4ME6A 2O0JA 3R3JA 2VHWA 1BN7A 1Y8ZA 4ZO9A 1ZM4A 3E3AA 3FPJA 4LDAA 1ES9A 3COWA 4P1ZA 2DUMA 4A0HA 4H7EA 4XM1A 3DO6A 3L43A 4ZQGA 1CZOA 3LHKA 2XYRA 5BP7A 4NKRA 3WDLA 2PEYA 3D3NA 2XGMA 3D8NA 3FR8A 4JY7A 4F1WA 2G9VA 3AIKA 1GSOA 2JD2A 3QMMA 4M9ZA 1V4BA 2B0CA 1CJCA 2WTEA 3CCFA 4KHZA 4QOIA 3DE2X 1PR9A 3KX2A 3Q0EA 3IXQA 3N8KA 1WABA 5MN5A 3WK5A 1L5ZA 3PQCA 2XAAA 2IOYA 4XUDA 3G2QA 5J2TB 2X8AA 3D4BA 1FQJA 1MRZA 4KPUB 2GFHA 3VSBA 2V1UA 1D2EA 3DEZA 2AN9A 4ZYVA 2C0QA 4ZARA 3VSAA 2P4UA 2R7NA 3EHEA 1OI4A 2XGGA 4LNUB 2WVHA 3RYFB 2YN4A 3DAFA 4I36A 2W4MA 2P2LA 2JIRA 1UDBA 2VP4A 1RHRA 1ILEA 3I2IA 2QMQA 4Z86A 4N82A 4RIHA 4PEVA 4N5HX 4UBKA 2MSNA 3UC5A 3AINA 4ZVMA 1J0DA 1CU1A 5FKJA 3N3BC 3G2NA 4AAYA 2NO7A 3LPMA 4GMXA 5MGBA 2IE0A 4BRSA 1JQDA 3V00A 1AKUA 4EFKA 3MT7A 4D4LA 3A4LA 1HNXB 3SBXA 1NJSA 3NHRA 5HRUA 1EH5A 4GUDA 2DH6A 3LTNC 1C9NA 4IH9A 1TLFA 3WIVA 1ZQ1A 4A8JC 3IEIA 2ANCA 3F8WA 3V8PA 1KERA 4PZPA 5BRNA 3FSGD 1TYDE 3A3YA 4O4HA 3URMA 3HWSA 2C82A 1YQXA 5JWRA 5LOVA 2ZT8A 4A27A 3ZHSA 1A77A 1U28C 3CBQA 1QSGA 2DRIA 2WTBA 3HP4A 2Z2IA 3O47A 5DGXA 5EZYB 3MWEA 3MELA 5CH3A 2FPGA 3M9XA 1E4VA 4IOMA 5DXAA 5IVIA 4HZIA 5H59A 3ZDFA 3KZMA 5K99A 2HU2A 3A6GA 3DTYA 3A1EA 4XTRA 5DYIA 3HGMA 1I3NA 1P2GA 1RKQA 1YNOA 3RVBA 1T6XA 4D97A 5G1PA 3EWSA 3RFFA 4KDRA 1E3SA 4KIUA 1KJ9A 1T2UA 4IIBA 2OAP1 1MBZA 1PVVA 2PRSA 2ZSJA 1N6RA 3UJ3X 2VBIA 3U19A 2FZ4A 1GNTA 3D7LA 3JVEA 4IDFA 4WZ6A 3ZKAA 5LZ2A 5AVWA 3S2ZA 1I1OA 3OM9A 6CHYA 1NJFA 5FBRB 3AKZA 1QYXA 5F2KA 2G08A 2ZJBA 4IR7A 1KH2A 1KA9H 2CDBA 3LO5A 3QTLA 2CVOA 1P9LA 4P0TA 5AVXA 3IMCA 2QAGB 5TJ9A 4POAA 1W8DA 1SHKA 3TR6A 3GJ7A 4CVNA 3FKSA 2I2WA 3H19A 5DT2A 4C4RA 1CY6A 2BGIA 1OHHD 1E3IA 2J3LA 4CMGA 5DH9A 2FKNA 3ZGOA 4DC1A 3I9OA 1SN7A 1PQ4A 4MS1B 1X7DA 1UJ4A 3R5TA 2AOXA 4V3CA 2ORED 3L40A 3TRIA 3W8NA 4BNNA 4MUFA 2LWIA 2EG9A 4BO9A 5HKKD 1TC1A 3VJLA 5I3CA 1U1FA 2PYIA 1LX7A 2J3JA 3GD5A 4TVBA 4B45A 2ZBVA 1FJ2A 5LD2C 2ODTX 3SHTA 4WOJA 4CQJA 3KXLA 3QTTA 1OC2A 4E2FA 3KJXA 2II6A 4MVJA 3EUWA 5J40A 1VKZA 4FJ0A 4LIPD 1IATA 4HFRA 3SFVA 4AKEA 5HJ7A 3IS3A 3VAAA 5DOZA 1XZAA 5JD5A 1EIWA 3FYUC 4K26A 1K97A 3ESZA 3DFKA 4JBGA 3HWRA 4TTPA 3HDQA 5A6SB 3PFBA 1DAEA 1DBWA 3CSSA 1LNSA 3T3DA 1Z45A 4RVHA 4IGKA 3TMAA 1LVGA 4N7MA 3QLEA 2J0VA 3JQ8B 2H2DA 1NVMB 2C95A 3HP7A 5JZOA 3BMCB 3K16A 2GLTA 4UVIA 3K1ZA 4RCVA 2J33A 4AXBA 4V2IA 2H7VA 4EO4A 2QT9A 1SU7A 1KYWA 1W85A 2A78A 3DO5A 5EZYF 1E1QA 1NDHA 2ZRPA 3RFUA 5BR7A 5K2MA 4DIFA 4W9RA 2R60A 4TV9B 2DHEA 1FTQA 3QKRA 3VVCA 3W4KA 2CVZA 2UYHA 3GGDA 3V8NA 2ZBUA 5AOAA 4BVHA 2ODQA 4PPYA 5D3MB 3CXRA 2WWHA 2BZSA 2NSHA 2HJRA 4JLWA 3ECCA 4C6TB 2GPBA 2KI5A 3C15C 3C0KA 3G9QA 1ESDA 3IJRA 5KI6A 2RGYA 4WJZA 4N5MA 3EK2A 1KS9A 1C9KA 2UZ1A 2FG5A 2CLIB 3CF4G 3S70A 5I01A 3ZK8A 1PQYA 2YJ5A 3UKJA 5JNLA 1JR6A 1I5EA 1Z4JA 2XQIA 3Q72A 3ABOB 1O5IA 1P0QA 1P5JA 1T34A 2R4UA 1RT9A 3HWWA 4P7KA 1Z4NA 4BFXA 1GRCA 1N3BA 2GWRA 3BERA 1SNYA 2Z8ZA 5T8KA 3VU9A 2ZXEA 3EH1A 1VBNA 3RS9A 2ZB3A 3S2IA 1D4OA 4IHQA 3IIEA 4PPNA 3T15A 2CY0A 1Y89A 2HN9A 4D9IA 4YCSA 3A05A 1JFTA 2H4YA 4IVQA 1KF0A 1N6IA 1UMBB 4N54A 4CDNA 1UBKS 1ID1A 3AIIA 1UKCA 3E5RA 5AKXA 5H1YA 1P7ZA 4RKRA 5LDDC 1H2RS 5DN6A 1DIBA 4HSEA 1TKBA 5CXXA 4N9QA 4LA4A 1U3FA 1I7QB 3D3EA 3ZXXA 1X19A 1IEQA 1FFEA 1ZUNB 2WNHA 3UATA 4JXXA 1V37A 5C8YB 1IM2A 3V7NA 4J75A 4JKIA 4ENRA 8RUCI 3A6HA 3NKLA 2P77A 3V1MA 1DMSA 1G55A 3CVXA 4IICA 1RIIA 1FP6A 5AI6A 2WT8A 2Y71A 5BMVB 1K3UB 3LDGA 2R48A 2ZROA 3ICCA 4UPEA 2VEDA 5J47A 5IM4A 3UXYA 1BWRA 4IEEA 1QDLB 1Z2EA 1KMCA 2FH5B 2HLDD 4O2RA 1I5OA 1CNMA 4R1UA 4GXNA 4ERXA 5DO9A 5ABPA 3T7SA 4CLOB 2YKGA 1SVUA 4MOWA 3TGLA 3FHTA 2BY4A 2BZ1A 2X0EA 1JA0A 1YR2A 3G6WA 2H57A 3MD0A 3ONEA 1V8OA 3I64A 4IJ6A 4NH0A 3MJSA 1G5PA 1NE7A 3BCRA 2J3DA 1UJNA 3ANYB 3OUUA 4KLNA 4WGGA 3UK2A 1NRWA 3H1PA 3QHPA 2PUFA 1MJGM 2ZVJA 5CEEA 4L5YA 4LZZA 4HH3C 2G88A 3FDZB 4D43A 2PKWA 4O2BB 3H17A 4DMKA 2JHFA 1C3OB 3E2MA 3VDMA 2O07A 1GU1A 4AJ4A 4HFMA 1RACA 2BFCA 2JZNA 3P97A 3O0DA 4FZ5A 4Q9NA 4TV9F 4BIMA 1RWMA 4LVNA 2W83A 4GKKB 2UUOA 2BAGA 4IQ8A 4R05A 4N3CA 2H7YA 2F6RA 2ZIZA 1N5OX 4Q9LA 4MTLA 3OPVA 2XHZA 2BCJQ 4YIKA 1BQEA 1HT2E 2B5WA 4X85A 5EXPA 1EGVB 2WUEA 2NZYA 2HDWA 2IE8A 3AFMA 4HVCA 4BGDA 2CVHA 3MC1A 1J8DA 4A9AA 2ZAOA 2JGLA 2KB0A 4HQKA 4XCQA 2W4IA 4EY3A 1RCTE 4D9KA 3DPSA 1KMNA 3MM4A 2WD7A 3GJ5A 2W2MA 1A7JA 3REFA 2LE0A 1Z62A 3N2YA 4RSHA 3KE9A 3C8MA 4XCXA 3DH0A 4CT0A 2FWBA 2JF0A 1QP8A 3OCWA 4LXTA 2DQYA 3MYYA 1SU4A 2WJHA 3FUWA 4OXKA 4KFUA 1H8EA 2NV0A 4FWBA 4JR0A 2BEUB 1P7PA 4AY4A 5JAQA 5K4HA 5IT9A 3MZ0A 1CQJB 4BTVA 2IH2A 2EFHB 1A3CA 1VIVA 4K8RB 1ZMBA 1FJGB 5EMJA 4AI6A 3A1WA 4L85A 1DWQA 1K6MA 2VJDA 4FNOA 4W8GA 3ZHCA 3T5PA 5FI1B 5C8DA 4QFMA 2FPWA 5D3KA 4BQEA 1ZESA 2ANBA 5C8YF 1L4KA 2WKPA 1W59A 3D3KA 1Z0KA 2ORVA 1A5ZA 3FNBA 5H9VA 5BMVF 1B3BA 4IVNA 1CDEA 4RPGA 4B6PA 1JHZA 4AX4A 4PCLA 3VJRA 5B58T 5A1TA 1T5BA 1EA7A 1JEAA 4LTDA 4P5DA 3SICE 4DLNA 1SA0A 3PQ7A 4B35A 3EZ9A 4BQOA 4BVFA 2BJVA 4HNGA 4F71A 2BBSA 1I3CA 3RVQA 4AFNA 5I7FA 3FCUB 2HH9A 3K0FA 1RCXC 2W6JD 3T9CA 2PZEA 2OB2A 2VNHA 4GFDA 4JYCA 2I78A 1I2DA 2NLOA 3NALA 5K4AA 4KR9A 4YCMA 1XEWX 3GJ6A 3JQPA 3P0JA 4HQRA 2IV3A 1U65A 3PB3A 2GERA 4PYOA 4BU1A 3OF5A 5FPKA 4QM6A 1I7PA 5L3QA 1U5CA 5LYJB 4U1RA 5BV0A 2UXCB 3G5UA 1JLLB 1KEWA 4O2BF 4F0JA 3ZQKA 3E8MA 2LNDA 4FE4A 2EKZA 3AU9A 1CZRA 1I6LA 1TD1A 2HKIA 2O1WA 2YINC 3GLKA 3KSZO 3M70A 4AUEA 3CVYA 5CBPB 1R4ZA 5B36A 4Q1EA 3Q3GE 3QMPA 3LLCA 5B37A 1NPTO 2M1ZA 4F9TA 1VSBA 5A05A 4JLNA 4FNMA 2IF2A 2Z4RA 1TK9A 5FD8A 2C3PA 1KZHA 4PQYA 3WTCA 1P0IA 5ES4B 2AKYA 2YZMA 3COVA 1ESNA 3SHVA 1DC5A 4NZ9A 1TU4A 2R8PA 1NXWA 1OI2A 1H05A 3D8RA 1W5TA 1X14A 4C05A 4PGFA 1Q1QA 1OY1A 2YR0A 4LQ4A 1PJ8A 2KW5A 1E1NA 1G8AA 3COYA 4MV9A 2J0SA 2BRUA 1OREA 1UDXA 7MHTA 1Y7IA 1O2DA 2VHXA 2RHGB 4TTSA 1TADA 4XYEA 3WGKA 5DNUA 1SXJE 4TYQA 3DBOB 4BJ5A 5AKGA 4URHA 1WIWA 3RSLA 4X63A 5I9MA 2ZYTX 3Q3EA 4ZZ0A 1YD7A 1EXNA 2J5BA 1WMSA 1BMTA 3T9BA 3JQBA 2OFXA 3JR7A 3RIHA 5EEHA 3V7YA 3FCXA 2JAQA 3FWKA 4CW7A 1VPEA 4FGZA 2CNLA 3RWOA 1KL7A 2PD6A 2VSYA 1EJ7S 4OX9B 3A58B 5JE8A 1T6NA 3R24A 1V4NA 2KWIA 4O08A 4ZAYA 4IGEA 4G9EA 1WPGA 2GBCA 3ZU4A 1CQIB 3DD5A 2WQ7A 2XMRA 2DULA 4QUBA 2CYCA 3O83A 4WOBA 1RP7A 1DPGA 5IJZA 4QXMA 1XNGA 5LLSA 5TMPA 1JR3D 3ONWA 1BE8A 1IXKA 4G1VA 3H2IA 2ZATA 2ZR8A 4R6XA 2JZCA 1RWBA 1RJFA 2IUEA 4K0KB 5DEOA 3AXKS 2ZP1A 4S1NA 4Z1MA 5JSZB 3M6WA 2X0DA 3HDJA 2ZWVA 4I4CA 3UFBA 4NYJR 3CTPA 1HKUA 3VZCA 2ADMA 3A2NA 4ZI3A 5ALXA 1Z8DA 1HFKA 1H6DA 2JKVA 1Z08A 2F8TA 1RHMA 3HY6A 5LYJF 3C5HA 1KEKA 3G0HA 2UKDA 1WDMA 5KTYA 1GUAA 4Y9UA 3D3WB 3KU4A 4HRXA 4CEIA 2ZE7A 2B8NA 1BHQ1 1DG9A 1JMYA 2F43A 2FN3A 2HFJA 1KYZA 2JCGA 2V74B 2XADA 3DVLA 3G2OA 5JMPA 2WIDA 3E22B 1NG9A 4G0QA 4MCAA 1THGA 1TO6A 1E9CA 4JBYA 4LOKA 4A6PA 5K05A 2VAPA 1YR7A 5C3MA 1VIDA 3ZGXA 5JOQA 1Y80A 1PD1A 2CXUA 4XB6B 4G07A 1YKFA 4IVPA 1MC4A 4X7RA 1YFJA 1W4AA 1VL0A 1K63A 3MRVA 3CN9A 4XRRA 3U80A 3HNOA 4MLZA 4ZRDA 5JC8A 5K0ZA 1T3TA 2IY7A 4W4TA 3EG5A 3OCVA 2DR0A 4YAIA 3ZHQA 2C2YA 1JAIA 1QIJA 3EZFA 4GOND 4B83A 5LL6P 4NBSA 3AR5A 4XGIA 2IWRA 4WVLA 4IDEA 4XD7A 1CP2A 2FY8A 3AF5A 4DDUA 3D6TB 3H5RA 4ZD6A 4AWAA 5JFOA 1OAKA 1W25A 3C1OA 4E51A 2VYCA 3F2IA 3TI9A 3TPZA 3VNAA 2GM3A 2HDNB 1JJIA 3LAWA 1R3DA 2WIJA 2A9FA 3UH0A 3ZU5A 1J07A 4M7RA 3KDPA 1W1UA 3G9TA 3WMWA 4BX9A 2A30A 3T0IA 5E2BA 3V3TA 2DR2A 5AXBA 1K2VN 5HOQA 3OKPA 2CHGA 3BFJA 4D26A 4CEJB 2OHHA 4K5QA 5JBQA 3AM1A 4MV7A 5C81A 5JD6A 3CLKA 3C41J 2VG8A 2O2XA 3BS4A 5FQOA 4I8IA 5FUBA 5BSGA 5A2QA 3QEBZ 1P1HA 3N7TA 1GKKA 4LHZA 3KETA 1NRIA 3RRYA 3OE5A 4LE0A 4FFMA 3B2EA 3GJ4A 3IOYA 3X3HA 3OC0A 2IHUA 4ALLA 2ORIA 2HO4A 2YV1A 3GH3A 3GFGA 3EDRA 4OPMA 4OHFA 3RTCA 3WE7A 1XUOA 1KI1A 2QXTA 4JBHA 1U3GA 1CQPA 1I2MA 2PMEA 1MGPA 4ENVA 1QS0A 4B2LA 5EJEA 3FMIA 3WB0A 4LJRA 4RUKA 1M73E 1NXVA 4UHBA 2ZJ5A 3QPDA 1ZI9A 2V58A 2D0OB 3DMTA 3N8GA 4HQNA 3R7WA 4EARA 4FUTA 1YRYE 3SYMA 1GNVA 3QLTA 1HUQA 2PBLA 3II6X 2H54A 3JYQA 4IO1A 1GLNA 1UQTA 2GF9A 1OGIA 2Z2YA 1XDWA 1XPJA 1DEOA 3B8EA 1ZUIA 2C2MA 2IHJA 2YS6A 3GEDA 3RYIB 3OD5A 3UB4A 3WP0A 4HUQA 4PHGA 1QVRA 3OO0A 4M8IA 5E7MA 2AUTA 1G7SA 3JYLA 1DOHA 4NJEB 1LK5A 1UBRS 1GEGA 2GTHA 2WPDD 3E8SA 1NWHA 1H3NA 1KTVA 3HACA 5EIHA 3ZBTA 2VI5A 4J07A 2ZIEA 4BWFB 4QGSA 1VA4A 4ZTUB 1JHYA 2PVPA 2D8MA 2X14A 3IMGA 3OZRA 4FD3A 2FF7A 3GP3A 1QP4A 3MB5A 1FDTA 1H2YA 2AC7A 2EKLA 1K98A 4J7UA 3NUGA 3X1ZA 4K05A 1M76A 1F0YA 3I6QA 1WW8A 3JV7A 3HP1A 1VL6A 3IA7A 1BNCA 2ZJ3A 3LGXA 1RPAA 4I1YA 3P9KA 4MB0A 2DLCX 1ISRA 1OT5A 2GZ2A 4BLSA 2AG0A 5K0NA 3HHPA 4HH1A 3C1TA 4W5NA 3NHWA 4L4SA 4QEDA 1B8VA 3MTQA 3E9RA 2KS6A 3UW1A 2V3VA 5JS8A 1CRQA 3G0GA 2QX4A 1QIFA 2CMFA 3L0DA 4YNBA 3KKZA 4OA8A 5EA2A 2JJYA 2N75A 3AM4A 3PLAE 2EKDA 2PGLA 4D4HA 2B1RA 2E9SA 3NTVA 5F52A 4G2NA 3KR1A 1D1TA 1G1AA 2ZWAA 2WWXA 3NFRA 2DECA 4O0MA 1HFEL 3U4AA 1DUSA 3H2JA 4RZSA 5LB4A 2GNAA 4HV4A 2X8JB 4JUIA 3FTDA 3JWHA 5IWAB 4MWOA 3DWEX 4QBIA 4TXJA 3IAM6 1Q19A 2VWHA 4MR7A 1FDWA 1BXZA 3D6AA 2FFRA 1QDUA 4WCVA 4XWOA 4UQLA 4V1CB 2QZ9A 5ADHA 1LLUA 2C4TA 2QPAA 4DL9A 1JAXA 4RH3A 5F1PA 2FSGA 3KLNA 4B3IA 1ZU5A 4RL4A 2DB3A 2GX6A 2YBDA 2BIFA 2AR9A 4TUYB 1XD2A 1WMAA 3LHSA 4L8VA 5EHZA 4GZ5A 3NR2A 1L4HA 2P9TA 1JWBB 2XDQB 3ZBQA 5FORA 2JKYA 4CFYA 3ODGA 3P8ZA 3SYTA 4A16A 4KPUA 3HL4A 2B3TA 4HX9A 4TS9A 4YONB 4ZXFA 3O2QB 4NCAA 2CLHB 2CGEA 4U2KA 3QITA 5JALA 1CDZA 1XNQB 4AKSA 1UBSB 4NYIQ 3LIPA 4J16C 1GPKA 2ENUA 5FTKA 5EP3A 3RBVA 4BNZA 1MHTA 4EYKA 3REQB 3P9IA 2XMCA 3ZBUA 4QJ3A 4ZCRA 3CZ5A 5M3BA 3GA7A 5KTKA 4LFAB 1UC8A 5E95A 5B6PA 4DT1B 1T29A 4FTWA 5K8IA 4RMIA 4BQRA 2C3YA 4KN6A 3WK6A 1KKMA 1AKEA 1YL5A 4ZYTA 4GPIB 1ZJZA 3FFTA 2E4WA 3WR5A 1G59A 2AA3A 2A9JA 2NO6A 3OCYA 1PR5A 2CZCA 3AV0B 5DM1A 4P6VF 2NZJA 3NTLA 4NPCA 2WJVA 3IE1A 3K7EA 1A2KC 2YV4A 3NHMA 4EA6A 2HHAA 2LGJA 4MKIA 4ZOEA 2WJ6A 1A8HA 3PSAA 4H7KA 1GZSA 2Q07A 2WHEA 1GPWB 4Y2JA 5HF8A 2MCFA 4MYTA 2GEUA 5H3CA 4M99A 2R7LA 3MRXA 2LW7A 5FR2A 4JLPA 4W5HA 2FR1A 3FPCA 1WQ3A 2D5CA 5ECDA 2XUOA 5TDHA 3UIEA 4EGFA 3A14A 5KYXB 4X5OA 1IM8A 2FLVA 2WFMA 4CF6A 1GQSA 4KYIB 1KQGA 4UU7A 1RQGA 4EJ0A 4MV3A 4X1KB 1Z0JA 1VOTA 3P9YA 1EUQA 2BDUA 3DA8A 5CNIA 2EJTA 2QN1A 2YHSA 3ZWWA 3IHKA 1AE1A 1FUEA 2ST1A 4PO8A 4QUHA 2G63A 5EMMA 3ZX4A 3PX3A 3AB3A 4LI3X 4LHVA 5JJKA 2VPXA 3K15A 4PN3A 1Y9EA 2VUHB 5BSRA 5HCUA 4CMJA 1R8JA 1WM1A 4DZTA 1UKAA 1KMQA 1OWPA 1A9YA 3I09A 2WUFA 1CUXA 4INAA 1GU0A 4NE2A 1QH0A 4Q34A 3TB6A 2QAGA 2ZRNA 4HVTA 4TUYF 3FI0A 3HVIA 1XMXA 3CLTC 1JWLA 1YASA 4YRNA 1QIHA 2GPTA 2M1XA 3AKEA 3JR3A 4YMVA 1LV7A 1U1EA 3EF0A 4O2LA 1WXIA 3QUBA 4P4GA 1R7RA 4L2IB 5AKEA 3TKAA 1U98A 1ZJJA 3C6YA 4MS1A 5DX8A 1JZQA 1DXQA 2HSDA 3IAS1 2I3AA 3SVZA 3DMPA 4KE9A 3BTSA 2W11A 4RTNA 2IYLD 4MW1A 1MQ9A 2ODBA 2RHCA 2E4VA 3DMYA 1J9GA 1JIVA 5KJ6A 3AOEC 3PVCA 1G5IA 4U2CA 1L5GB 1XALA 1NONA 1RXEA 4TZKA 1NNLA 1OFGA 2Q7XA 2NU7A 2ZSUA 1YK0A 4PWYA 4YCAA 1Y3IA 3ZQ6A 3KQYA 3GIWA 3U7GA 3R6WA 2WJPA 4MI9A 2Z6UA 4BBJA 3CLTD 3OZCA 3P4UA 3UFXA 1M1NA 4W5QA 1GPAA 3FYDA 4X3OA 1NF2A 2Z56A 3FRHA 1P7CA 2RHBA 4I6JA 3DP9A 1K7XB 2NVWA 4RVGA 5JD3A 2NSJA 4OJMX 1SGWA 3H0EA 2H48A 1P4HA 2DHDA 3Q5GA 4F5EA 3IEVA 2BFPA 1N8TA 2YFHA 2IKSA 2WKSA 3DOCA 3MGKA 2JH9A 1EKXA 1L7MA 5G53C 3JQ8A 4OSOA 1ACLA 2C3MA 1NYLA 5BT8A 5J4LA 3BMCA 4UM5A 1NBWB 2ADFA 2BGJA 2SBTA 1KYQA 1FFHA 2HEGA 3LRXA 3KNZA 2XTJA 2HRBA 4BX8A 4ZYYA 2W6NA 1Z7BA 1EXVA 3U7FB 2EEPA 3H6KA 3N0RA 3KQKA 2X9QA 3JQ9C 1N6OA 4XIJA 1G21E 5F33A 4B3RB 4TV9A 1L4UA 4UJ5A 3FUVA 3P96A 2F8SA 4XRGA 2QJRA 4EL5A 1GEEA 1MA3A 3Q11A 1R27A 1DTEA 1U1GA 1M5TA 4MROA 3KXKA 3ZV4A 3IOCA 4S3MA 4BNTA 1Y5IA 4DLTA 1Y9ZA 3GPIA 1RP1A 4F21A 1YE8A 1TM1E 2VP9A 2YY6A 1QGYA 4WA8A 5J4VA 3B20A 4CIBA 2QS9A 4L73A 1YXMA 3MSXA 1GPH1 1XU9A 3MS7A 2Q5HA 2OCAA 1YHYA 4DWVA 2ORWA 1A7AA 2QSJA 2IIBA 4I3GA 1IC6A 5E7JA 4DUYB 1XHFA 2NNWB 1W2HA 2G5PA 1C0PA 1N2CE 2ZRKA 4JUBA 4CDGA 1C3VA 1P31A 4DSOA 3KU1A 2Q4BA 2R6JA 1H23A 3KKOA 2X9NA 3EGDB 1ORIA 2MYUA 5D7BA 3ROQA 4A5SA 4YMUA 3PEWA 3QX9A 5TV2A 3PEFA 3M6LA 1JFVA 3B12A 4ZEOA 2WY2D 1XRLA 2AFIA 2FMKA 4REOA 2V9ZA 2IVZA 4DNFA 4ZZ2A 3JYOA 2DKFA 1LFAA 1AM4D 3ZW8A 2BJHA 4YJKA 4LF6B 1E3QA 1R6AA 3U5TA 4DRXB 1CS4C 1W1WA 3ZJ5A 2C42A 3BDIA 1WDKA 2ZULA 4MJ3A 3WADA 5GGYA 5BOSB 1XRJA 3FH0A 1ZUNA 2P9GA 3FKQA 1QYDA 3HCOA 1VL5A 5C8YA 1VE7A 1OA1A 1GNLA 1PT8A 4IUBS 3VOBA 3URKA 4QU5A 1IBCA 2VR1A 5DHSA 4CQMD 1L5QA 4YGXB 5DKFA 2WJYA 3O3NB 5ICCA 4PLTA 3ZS9A 1C7RA 3UGJA 3HB9A 1D09A 3DMFA 2J0QA 1U2TA 3OPYI 3A3KA 3MMXA 3WGYA 5H4GA 3K4HA 4OOFA 3VC1A 3AQIA 4GXRA 5KCMA 1X3LA 4URXR 1Z5WA 1CUSA 2ZJFA 3M5WA 4A6EA 3WL6A 3WXBA 1IY2A 2CUKA 3KEMA 5F7ZA 1T9CA 1U0TA 3NFYA 2JNWA 1F5SA 4QOFA 4RNDB 4YRZA 5COAA 3PF9A 2WHXA 4RF5A 4IQFA 1RMYA 3FDZA 1ABBA 2RHMA 4G1MB 4O2BA 1C3OA 2I80A 5EINA 4MGEA 5I6DA 2QZJA 4J1TA 2D00A 1XPUA 5I45A 1S2IA 1QB8A 2CZGA 2UZ0A 3L9WA 4GLBA 3OWXA 4BGEA 3O2JA 1ST3A 3R7FA 1ONPA 1OXTA 5I3ZA 2YN0A 2OK7A 5I8ZA 1KDYA 1J0EA 1JGTA 5TQ2A 2P9CA 2ZIVB 3F4BA 1WXFA 2I8CA 2R6DA 4MH0R 3R9WA 3I3OA 3BYZA 1U9JA 1Z2OX 4I66A 1Y1KE 2BDTA 5AJWA 5E0KB 1QYCA 3ZGLA 3IMKA 4DJ5X 1MX9A 2QVZX 1HGXA 4UAUA 3T3IA 3PX7A 3H2ZA 4FEGA 4DV7B 4K88A 4DMFA 1WDLA 3RUCA 2HSWA 4HADA 4IJQA 3EZ6A 5H02A 4MUNA 1AF4A 2XVZA 2AK3A 2AWOA 1XRMA 2BEUA 3O4VA 4LV5B 4N0DA 4US1R 3IR6A 4Q9KA 4PCUA 4J1NA 4B2IA 4EVSA 2IL1A 1BE0A 2GKSA 2NXNA 3C4JA 3L6UA 3L79A 3MQ4A 3QZUA 4YN3A 4ABYA 3GHYA 1HOTA 3X1KA 1TFUA 4NCKA 1SHZA 3PA8A 3WJ1A 1CBUA 3ER8A 4OLFA 2OBNA 1FW6A 2I4OA 4K03A 1NTOA 3BHJA 2Y0BA 1XFAA 3BJEA 3FROA 4ZRMA 2Q7OE 3VOSA 4EUFA 1KI8A 3PPYA 1FC0A 4MQEA 2ECFA 3H99A 4NFLA 1PLJA 5F73A 2AJDA 2KLHA 4NICA 3I6IA 3OKCA 1VL8A 2OBLA 4GP6A 1KE2A 3UH1A 2WV9A 4DG5A 4H4EA 3K9LA 3K05A 4E5KA 9LDBA 2HA7A 3U7EB 1CY7A 2EJWA 3DZBA 3O4HA 1XQWA 4G25A 1NU8A 4C4TA 4R40A 1E7MA 4E6PA 1FNSA 3N5CA 1P17A 4F9FA 3N59A 3LF2A 2HF2A 1M74A 1WMFA 1JR2A 3U13A 3A2KA 4LECA 3RIEA 5ALOA 2PVSA 4D5GA 2G28A 4XIIA 4J7AA 3NWPA 3Q9SA 3K4PA 4ZAZA 2AJTA 4CM8A 1YGPA 1X1QA 4P7GA 5DMXA 3DKPA 3PDUA 1JF8A 3KSMA 5LYJA 1W48A 2YJNA 2P0YA 1X86B 4FBLA 1JLLA 3RU9A 1JR4A 5FOQA 3I5XA 3BE5A 2HK8A 5DNAA 1XZFA 5DEIA 5CBPA 3TVYA 4P98A 2RAUA 1W9MA 2PMDA 3W79A 5JWOA 2DMRA 3I34X 1XROA 4G4IA 3PG5A 3TF5A 4DBZA 1YMQA 1TYAE 4C0QC 3RSQA 3W3AA 2D1TA 3UMCA 2QB5A 1MB3A 2ECOA 4ER6A 4WEOA 2QQ0A 3IJPA 2JIOA 2WYWA 3MWJA 1P9OA 3BMXA 3PDWA 3IDZA 4R54A 3X2SA 3VKHA 4NHEA 4GH5A 1KH1A 1YRLA 2FQWA 3D6FA 2DG2A 4E7OA 4EQ6B 1ZO8A 4Q5IA 8ABPA 3ADDA 2AQ8A 1QHSA 2GF0A 4OD0A 1MKYA 3TIGA 5FBVB 2QBYB 3S7TA 1Z38A 3ROFA 3HKCB 1WUJS 1E79D 5E9JA 1NRJB 4X8MA 2CXHA 1QGAA 2QN2A 4XPZA 2C07A 4U7GA 4D4GA 3AHGA 2O23A 2MHCA 2VPYA 3LKBA 2D5IA 5LVAA 4MPRA 4FOSA 1QRSA 4BX0A 5BYJA 4TMTA 5JSHA 1CUBA 1H6BA 2DBQA 4BNFA 4I1VA 2YV5A 4JB2A 5F5XA 5UKDA 1XLUA 1EB9A 4L5JA 1GGFA 2ASEA 3I5UA 2XMQA 2ZUEA 2P1DA 3O4GA 1ZC4A 4U9UA 3NORA 3RC9A 5CLJA 2HK9A 4Q02A 1J2YA 2OV2A 4LFCB 4BKQA 3AR4A 4B6GA 3TLXA 4AO6A 3BZWA 2VH2A 1W0CA 3DMRA 3HMQA 2P5YA 2JJ1D 5EJ2A 3FKJA 2YIDA 3DW1X 3FETA 3EUFA 3VRHA 5I48A 4A15A 1BDHA 3U7QA 4X6XA 2WPNA 1E7WA 3RJ5A 1S9DA 4UJ3A 3LP8A 4EH1A 1Y42X 4R8MA 5JSZA 1G5TA 2P35A 3G0OA 4YC7A 3DMNA 2VJQA 1E94E 5TVKA 3J80A 2AEJA 1ONOA 1ZXXA 2F1HA 1ZMXA 1XEFA 2ZUDA 3CLRD 3DV2A 1Y3CE 3PUKA 5HDBB 3UJPA 2FR8A 5IEJA 4YR7A 4BNJA 4PFSA 3ZHOA 1V5IA 3OAAD 4XYLA 2HQOA 2OD9A 4KXWA 3D3WA 3L5KA 4CM6A 3EGOA 1GUBA 4OHOA 1DKPA 1RR6A 2WQZA 4OAOA 4D92A 1XWFA 3E22A 5IS2A 3K1TA 3L4JA 5ALLA 3KR9A 4CF5A 3F73A 4KRFA 1B74A 2V5UA 4XWAA 4RU1A 4YMLA 3HBNA 5HF6A 3OJEA 2JH3A 4LG1A 1XKTA 3C7AA 5BT9A 2G8NA 1MB2A 1NOKA 2FZCA 3MN1A 4AIIA 4L9WA 2W6MA 4RKEA 4YJ3A 3JZDA 3DDHA 1T5SA 3OU2A 4IDQA 4QL3A 3K9GA 4E11A 1LSSA 2F3SA 1SG0A 1N3LA 1D2GA 5DP1A 3WISA 1TUIA 3MA0A 4AO7A 1PWXA 3K92A 1HBJA 4U6SA 1SVLA 3RHFA 1RXSA 4ON9A 5L3ZA 4MPTA 3FWHA 1BXNI 3AIMA 1YJQA 2A9OA 2YNMA 4JU9A 4NBNA 2XGJA 1NU6A 1TVCA 3E8XA 4KGXA 2YXLA 1IJFA 1Z15A 4NOLA 1ZNWA 4V3BA 4DV0B 1QZUA 1D1QA 4E12A 1LQUA 4YP6A 5D5QA 1S2MA 4J6FA 1PS0A 3OT5A 1KZ9A 2CL0X 3SIPA 3TCNA 1CRWG 3VHQA 3E84A 4MYRA 3SVLA 1U1IA 1V1MB 2JCBA 3DNPA 1A8PA 3NC1C 1TYZA 4NBVA 5FJIA 3TZQA 4DLKA 3BILA 2ZI3A 3PC8C 1IVSA 4DA8A 4UDXX 2IUSA 3PHCA 1FYXA 3PXBA 2DWCA 5E7IA 4RPKA 2P6RA 2VZ0A 4PZDA 1YMVA 4RD6A 5A5EA 1VL1A 1LZKA 2FDRA 1G3MA 1T3HA 1CIVA 1W9HA 3U4QB 1DWPA 1Y4UA 1KDRA 4KIJA 5EERA 2QU8A 5FBKA 2ZUSA 1ZK0A 3BHIA 3TZHA 2R0QC 4DGSA 2GCOA 2HU8A 1EPUA 3W2IA 3TTUA 2AZXA 1Y8QB 2H00A 3W6OA 3IDSA 4IDAA 1U3TA 4ZV4A 3QPUA 5CHYA 3HN2A 4A3SA 2GUGA 3CO5A 3JAMA 4TX1A 1KRHA 1S01A 3C8UA 5FHRA 3HVRA 5CD9A 1FFWA 5FOXA 3FSJX 4M1EA 1QANA 4ZANA 5EIEA 2ATVA 4DR5B 1B8UA 4J0GA 4KBYA 5IRCD 4S0ZA 3CRVA 4IRMA 1K8QA 2HJHA 2AOWA 4KVGA 1E98A 4JITA 5B3JC 1Y6RA 2A1UB 4N4AA 4RPHA 5IUKC 1ULHA 1F5NA 1SHTX 2XLCA 3RYIA 4KDFA 2PLRA 3MIZA 3PXEA 1MFZA 4IJMA 3TFWA 1XU4A 4BFZA 5JHGB 4CMEC 3BWBA 3UUFA 4Q82A 5IKMA 2G67A 2FKAA 2MR5A 4RO0A 1CY2A 1VHJA 1U7XA 4C7XA 2QN9A 3V4PB 1PRYA 1XVLA 1M6YA 1Z5NA 3QVJA 4INOA 2WSBA 5HBGA 2IZ0A 4WD3A 1IHOA 4KMOA 1A1SA 3Q98A 4HDNA 4PXSA 3I53A 5LMNB 1SKBA 2JLSA 4B4KA 4YRTA 1QFZA 4H4DA 4XUGB 4XJTA 1E1LA 1V11B 3M6AA 2DQKA 2W71A 1QOQB 3C97A 1FQOA 4HQFA 1M6EX 3ENQA 1U8UA 2UYYA 3PQDA 2MJLA 3NT5A 2OECA 3HBAA 4FCTA 3HA7A 4P0QB 1IYZA 3VTFA 4MGZR 4OQEA 3SG0A 5G4LA 4FDUA 3N86A 4B3MB 1EHYA 1ADJA 3P9XA 2HLNA 4AMVA 4BUCA 5LP1A 4DV1B 1ZAKA 4KQ6A 2BGGA 4IFBA 4HLQB 3TJRA 3R4CA 1JYEA 1QTQA 1XR3A 4O02B 2P1RA 1NJ2A 4ZZ3A 1P9RA 4UKDA 3V8EA 4R2XA 3OF2A 4IXNA 5D3QA 1T0JB 2X8JA 3VAYA 1N57A 4R1TA 2LCFA 4Q4LA 1TD9A 2OB1A 3AL0C 1D8TA 2Y93A 1EDBA 2QPTA 4GM4A 5SYAA 4DILA 2QZSA 1E6WA 2I71A 5CUQA 5AKZA 3T1QA 3V1LA 3W5BA 1K8XB 1RWXA 1Z12A 2V7EA 1ZM9A 4V1CA 2Q5EA 1PV2A 3HSSA 2H3HA 1AK9A 3CRW1 2CFCA 3QW2A 4B44A 5DE3A 3IPAA 1AQLA 4IZ6A 1GOTA 2EKBA 4DOMA 4AN0A 1VE9A 1AT1A 1WCIB 1F4LA 2HRRA 2IDZA 2GM9A 3LPDA 4XASA 5JS2A 5JCJD 5KC8A 5JFGA 4EG8A 6PFKA 3ZY4A 1IUPA 3FVRA 3IVGA 4UBOA 5ISMA 3X1JA 1YZQA 4LJ6A 1QH8B 4V03A 3AEXA 4QULA 5EJIA 2OHVA 5IDXA 3UWSA 2BJWA 2NTEA 1NW3A 2H06A 1GJRA 2WSYB 3BD8A 3H8VA 4MKGA 3A32A 3K32A 1VB3A 3FJOA 3REQA 5F9HA 1M8FA 1J0CA 1VMEA 2VDJA 1TGYA 1M6NA 1P77A 1XMJA 2GK4A 2W2OA 1PTJC 4NYMR 2W5UA 4C3ZA 4DT1A 3C3MA 5T64A 4CKWB 3ZVKA 4QQ8A 5GMOA 2LTAA 2YXEA 1GRQA 4E7PA 3LL4A 1K7CA 3B9RA 3N8DA 1D9ZA 1SUIA 1USIA 2OV6A 4K6OA 4C4OA 4E2ZA 3EA4A 1VSUA 4GKAA 2EJUA 2JFNA 1ZD9A 1USKA 2WQ6A 4QKQA 2VJNA 4QOJA 2IIQA 4BMZA 4EVQA 1RKUA 1TFRA 3K5PA 3LWBA 1G64A 4MUKA 4EKNB 1XB2A 1W34A 1MA0A 4BKOA 1NF9A 1GYPA 1SKQA 1NLYA 2O1XA 2ZB8A 1G8HA 1ZJ6A 1NMSA 3DV0B 4JUDX 3UJCA 3EGIA 2F3PA 3Q1KA 3UHPA 1K92A 4HNSA 1FS5A 5KYXA 4S1TA 1DL5A 2CVFA 4LXQA 4OP2A 1JEEA 2FWJA 1YB1A 3JYHA 4R1PA 4C20A 1ISIA 5AOCA 2O7QA 1ZJ5A 1ZH8A 2IXGA 1X80B 3LY9A 2IBTA 4YALA 2CBZA 2VK2A 4U2DA 5G0SA 3HSKA 3U60B 2ZRGA 3HZOA 3TL3A 1DX6A 4UREA 5FOVA 4GPZA 4EM6A 1PZXA 1T5HX 2H4WA 4TQGA 4XYMA 5B64A 1BWPA 2QD1A 3GJZA 4Y2XA 4FFOA 5A3RA 1GQ2A 1ZMTA 5BSVA 2P9EA 3ZGZA 4GMGA 1AMNA 1B8PA 5K3SA 3EPHA 2JI6A 5AI4A 3RKSA 4L74A 1H8HA 2NYAA 2NZ2A 3AK4A 3MT8A 1KSHA 3Q3CA 3QVLA 1O3YA 2PZMA 2FRVA 3U7JA 1QUEA 2R4QA 3ORSA 3KVNA 4RCZA 4IFEA 4ZT5A 1GZDA 1P0FA 4PZAA 1WQ1R 1O5TA 4AJEA 2CFTA 1SKUA 4L2IA 3GI1A 3ZNOA 3VJMA 2ATXA 4G0WA 1NA5A 6AT1A 5ILGA 4O6VA 4DR3B 4MS4B 1YL7A 1IY9A 1D0VA 2A5LA 3MUNA 4LY0A 3EAFA 4NXNB 2H4JA 5CCDA 2XYHA 3OPXA 1Y1LA 1YCHA 4BC0A 3ZXWB 4BASA 1CDDA 2O5VA 3L1KA 4R81A 4G9BA 3RPEA 1F7VA 1T8RA 3MHPA 4QEZA 1DJQA 3UGKA 4EJSC 2J59A 4OK6A 5DSXA 4CJXA 5AJXA 5TX7A 3THXA 2OMKA 2GI4A 1WBJB 4HVAA 1ECFA 1UH5A 1Z75A 3HR8A 4J0KA 3NCTA 3ANSA 3OU7A 4I6GA 2B4QA 1RU3A 2Q9BA 2FSSA 5KQSA 5IT0A 1T2DA 1Q0TA 1ZPDA 3W06A 3KKEA 3R5SA 1J7JA 2NV6A 2J07A 1PX0A 4ND7A 4BLVA 4IS3A 1W35A 2Z98A 3LBAA 4QPJC 2NUAB 3WNZA 4FX2A 3F4KA 2BEVB 3R09A 4O3FA 1JTEA 2JFWA 3R5FA 4V0SA 2P68A 3CURA 3H5LA 3UXMA 1S7CA 2AL7A 3T4UA 1PJSA 2HLHA 4I6EA 5ED4A 1VFNA 3IGFA 1PL8A 1VE6A 4URUR 1VB5A 2QUIA 3PIRA 1NSYA 2R9VA 4CMBA 4ED9A 1EUCB 1VBFA 1AKRA 4JYMA 4BE9A 4QOHA 1U9CA 4ZI2A 4S05A 1UL1X 1OH6A 2OP0A 2XTZA 3R3HA 4UPVA 1TI7A 2IXEA 3N8HA 3AJAA 3QBVA 4ILEA 3NP9A 2XUAA 4R7ZA 4A2WA 3PITA 2AG8A 4L4XA 4YAWA 4FJ2A 5L4LA 1FPMA 3UOGA 3UVEA 2J41A 3SLRA 5FHQA 2X3UA 2YWDA 1AKYA 4D8YA 2AIRA 2ZR9A 4A8JB 5IHXA 1ULSA 2QY6A 2P7HA 4PE5B 2APJA 3OM8A 1LW7A 2CDRA 2C97A 2O0LA 1TE2A 3CJTA 3VU1A 4BCBA 2C4VA 3FCYA 5LU9A 3QTBA 4OHVA 1NPYA 4GXTA 3QUTA 1OX4A 2QSZA 2PS1A 5ILOA 4DSNA 4OFXA 1U9IC 1ESCA 2CD9A 1V8DA 2D5AA 1IBSA 2V97A 3STTA 3M3PA 2WP0A 2OP1A 1KVUA 4G5RA 4OQYA 3V33A 4EPXA 3BA1A 3TOSA 1W88B 3DLAA 4BGUA 3EGDA 1WG8A 2WABA 1PFQA 4UTZA 3F96A 5GJWC 2WLTA 3ZHBA 2GASA 1U0BB 1A27A 1CJMA 3I1FA 1QGED 4HHEA 2JLAA 4RYDA 2DPYA 2WIGA 3HZZA 4DR7B 1P75A 2PYZA 2Y3IA 3EEBA 3H75A 3OE1A 2QKYA 4DRXA 5HX7A 1MNAA 3GH1A 4NH4A 1AN0A 3AQ4A 4L0DA 4B47A 4CHTA 5EHGA 4BZQA 1E0JA 5ALEA 4ZREA 5ILQA 1UK9A 4KOAA 4KOEC 1UMDB 2C2GA 3O4IA 4QBGB 3QJGA 3KOUA 3E48A 1RBZA 4CMAA 3BSFA 3ORFA 2JBHA 1YZLA 3JWIA 1GFWA 4JOQA 3PEYA 4ZVNA 4OXXA 1O96A 1AK2A 1Q95A 3BWVA 4OI2A 5I8PA 1ICIA 1W2WB 3QU2A 2I2BA 1GKIA 2HW8A 1ULAA 3PDCA 3BJZA 5KNCA 3AZOA 4YRGA 1L9KA 1EQAA 1U2DC 2EP7A 1BHSA 2EW2A 1YWGO 3HVJA 2WYOA 2XA2A 1JEOA 4TWZA 1H2FA 1JYSA 3TJZA 3EVBA 4IDDA 1QHIA 1QHEA 2QGFA 3D59A 2PRZA 3ZK7A 4F84A 4K0RA 1SC9A 1YFKA 1N5KA 2OV8A 2RHWA 3QKTA 4MKXA 5JS7A 3ESAA 3DGEC 5LFAA 3L05A 4MYSA 3E5MA 3NVDA 3R9KA 3DJYA 4H7DA 3MRSA 4EBBA 2PK3A 4BNVA 3ZJVA 4M8SA 3ZWXA 5LD2B 1KJIA 4YRFA 3O1JC 4KYUA 1UOOA 1QWSA 1U2GC 4TWBA 1I1QB 2HU7A 4WJKB 5HFNA 4B3BA 5JTUA 4JJ6A 1QLHA 2BI4A 2H0RA 2VQDA 4F3CA 1F4VA 4PNHA 4JROA 4YV2A 5KTRA 2EOAA 3E53A 5