1ZHOA

The structure of a ribosomal protein l1 in complex with mrna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/rna
molecule keywords mRNA
publication title New insights into the interaction of ribosomal protein L1 with RNA.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 56
structure length 228
sequence length 228
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 1zhoA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zhoA02
4F9TA 4REOA 4QGBA 1AD2A 5DM60 3TG8A 1MZPA 4QG3A 3FPNA 3QOYA 1I2AA 1CJSA 3U56A 5DM70 3U4MA 4QVIA 3UMYA 4DFCB 2HW8A 1ZHOA 1DWUA 4LQ4A 3ZQJA 1U63A
chains in the Genus database with same CATH superfamily
1G55A 3E6AA 5IF9A 1V9SA 4ER3A 3RC9A 4CUKA 3LIPA 3DW1X 4GDMA 3M1YA 1EJ2A 2Q4EA 3SBXA 4B3GA 4GKKB 4CMEA 1CQIB 2CUTA 5DI3A 3WFIA 3HL4A 2O48X 4IJKA 4M8SA 3INRA 3GZNA 1S7CA 3OQNA 5EEHA 3LUHA 3KKKA 5EJ4A 4AKSA 4RPCA 1DKPA 1U8FO 1P0CA 5JDCA 2Q2OA 3GP5A 2GKOA 3HB9A 2YJGA 3RWMB 2CLMB 2HF9A 3TN7A 1WBDA 4I4LA 1P2SA 5E7JA 1VBKA 2IJGX 3R5FA 1XL1A 3DOJA 2P90A 1PQUA 4EOGA 1TKAA 4WFKA 1L7DA 1LVHA 3H5AA 4R2XA 3LQKA 4LSZA 1GG9A 4GUAA 1H22A 2IIVA 4I5FA 1Z88A 5IPFA 4UUMA 4UOQA 5KS2A 1FY2A 2VUTA 2YWGA 3LCMA 4F12A 1PJ8A 1ZEMA 4DNPA 4MITA 3SEZA 2NXEA 3PD1A 4DDKA 1U2DC 1XQ9A 2JJQA 4V02A 5TLSA 2YL2A 2PKEA 2AOWA 4D98A 2HQOA 3PE3A 1OGIA 2R4UA 3ONNA 3G1WA 5TPZD 4OAOA 1BWVS 2X3YA 3ZD8A 4C3ZA 2QLTA 1G20E 4X5OA 1F9EA 4IDPA 3WFZA 3X1MA 2IYXA 4M1KA 4HRYA 3IRVA 2XAAA 3T41A 1KETA 3M6IA 4HEJA 1W93A 3ER6A 5AVUA 5KNDA 4Z7NB 1ZVVA 3K0AA 1XN1A 2Y1KA 2DF8A 5CEJA 1QP0A 4BV3A 1COZA 5LQAA 4H7EA 2RBEA 5C5DA 3TQOA 2RGEA 5BSWA 3AKZA 3LVFO 1V45E 4CMCA 5AKYA 2QZPA 3KV1A 3V46A 4MDEA 1O9GA 2PO7A 4LI0A 2EWWA 1CIJA 4AKIA 5CFQA 1QFMA 1P1RA 3D0RA 2X8JB 4RIEA 2G1UA 2HJSA 3S2YA 1EYZA 1K2VN 1N5JA 2WIKA 4B34A 4F2HA 1LWOA 4B87A 3CLSD 3GHYA 4PLHA 1R00A 3TOSA 3VOAA 3W8DA 2RH8A 3IXQA 3DO6A 4TV8A 2AZDA 4GQBA 4C20A 3OZCA 4DB2A 1KSGA 4UBNA 4E2YA 1JVBA 2XNJA 1E5DA 3DOFA 2O0KA 4FHDA 5BSTA 2HR1A 2R6CA 2BUBA 1GDDA 2JAUA 2AC7A 3E3LA 3FNFA 1FTYA 1SPBS 3TRDA 2Y0DA 1L5VA 3O82A 1D2MA 4O4HF 1ODTC 3N3BC 5IXJA 2WUGA 3C1UA 4G8CA 5EIAA 6REQA 5KU1A 1W52X 2JANA 5C8DA 5CLFA 3S81A 1V41E 2FWNA 3ICCA 3M4ZA 5K3AA 4FKZA 2VPXA 4Y1GA 4BVJA 3EF1A 4MX8A 2A7XA 2QRLA 1XIVA 3B51X 3ZTYA 4Z7QB 2V5VA 4OM7A 3TLXA 1IH8A 4E33A 2WWYA 1XTSA 1QAOA 1G6HA 1RYMA 1VBMA 3I9MA 3DEZA 4MQ4A 4Q7KA 3PGA1 4YRMA 1PUIA 1UMDB 2PFGA 5HKKD 4XARA 1OLSB 1I7NA 2VWQA 4M0FA 4JROA 5JBNA 2J9RA 4FT4A 3V8RA 3UMYA 4Q47A 2DBRA 1Q20A 3RYTC 5IASA 2JLVA 1O9HA 1A8SA 2AMJA 4ZD6A 5JTTA 1BXNI 3EMKA 4DSZA 1GL6A 4Q4HB 1TC1A 2HU7A 1OX6A 3PYXA 3L82B 3OQOA 1DARA 3OSZA 3GFSA 3PNQA 1EK1A 4AULA 2XUZA 2D54A 3NEAA 1VFNA 3ZCTA 3D6NB 3B3AA 3MFYA 3F6RA 1H2RS 4GXQA 2D1SA 1ZCBA 1STOA 1N77A 3T3GA 1H9CA 3D3KA 1RR6A 1OI7A 4GL2A 1AZSC 2O4UX 4FDUA 5DOVA 2EL9A 1VDMA 2FP4A 1PJBA 4FINA 5EIFA 1U02A 1CR2A 3UM9A 4XFKA 3DL4A 2R65A 3R3UA 4RGBA 4PC2A 2BGLA 2O5VA 4MKRA 3K72B 4B7AA 3GRCA 3IO5A 7REQA 3W7AA 2BE7A 3KHUA 1PKXA 1AUOA 3EVZA 3GBSA 5K8UA 5DBIA 4PEVA 5EZYA 2P2ZA 2KSQA 4HNHA 3WO0A 3SM9A 1EHCA 1QIMA 3IOCA 4XQGA 4HFRA 4LPSA 1SUSA 5AKKA 1Y1LA 1YE8A 3ANNA 4DBVO 5J47A 1R6TA 3Q5GA 2WJ3A 4KBFA 1G2OA 2JJ1A 3ZKAA 1M3SA 2OD9A 3MBKA 2X9VA 2B8NA 1FNSA 2ZK7A 1J1IA 3K73O 2WUEA 3GJ6A 1RRCA 2RKWA 4UNSA 4MUJA 4PZDA 3V34A 1NXOA 4RDCA 1ZLXA 3IR6A 4MQ6A 3E9MA 8ADHA 3KU1A 4RSHA 5KTKA 4KNYA 1NKVA 4BXOB 1NW7A 1S9HA 2FG5A 2Y93A 1NF2A 2YYAA 1OIWA 4Q3NA 4B5KA 3CW8X 4XVCA 3F5DA 4EP1A 2G7MC 2CHFA 4FNOA 1VHDA 3I9V6 1ORHA 1JIUA 1CS0B 1Q50A 3GLGB 1P17A 4B6FA 2VNIA 3HB1A 5KVCA 3D43A 4WESB 4FFWA 4F7WA 1VSBA 3OCCA 3RJ9A 5C8VA 1V96A 1M34E 1M6VA 2WF9A 5CXUA 1IN5A 2PX4A 3AR5A 1J23A 1WCXA 2C2GA 3EJ6A 4NV1A 3UN1A 3SNKA 1NFQA 2CFTA 3KT8A 4FCCA 1P3Y1 1YO6A 3LECA 3PDIA 3LXXA 3ROFA 2X2FA 3HKEA 4TTSA 1NE2A 1QGOA 2TMDA 3G6WA 2JCXA 4HAXA 1XDWA 4R3WA 4TYWA 3E1KA 4F2GA 3F9IA 4JLBA 1WCYA 2ONYA 2YHIA 3CO5A 5EIBC 4HG2A 3OZUA 3JQAB 2WW8A 5CD1A 2W2NA 1OVMA 2NT3A 4HZUB 4FFVA 5EQTA 1FSSA 2NUPA 3TTUA 1ZK0A 4NRDA 2FRDC 3LGAA 1NRJB 2BF4A 4W7HA 3R5XA 3V00A 3WL6A 4FEGA 3OQ6A 2DT5A 3NH6A 4J2HA 3KZMA 4ARSA 4BQSA 4I1PA 3ET4A 4DJ5X 2ZJAA 1G9XA 5B1SA 1IG0A 1R6XA 2H1FA 3O2SB 4RK6A 1ZCJA 4URWR 4K8OA 2QMZA 3RAPR 3N07A 2ZUSA 3T3DA 3VPFA 3W34A 1MVLA 3U62A 4N12A 1PZNA 3PLRA 3V1UA 2XWPA 2YJNA 5ALMA 4CI9A 5KYWA 1FBNA 4PHGA 4BQIA 1E0AA 2PKRA 4L0CA 2G72A 4F3KA 4FFNA 3RS5A 5E0OA 3ZBQA 4E0BA 2MJLA 2N1BA 2Y9PB 1YC2A 3V1TC 1CF9A 1MABB 3O4IA 2CBGA 3C5HA 2QLFA 4Z8YA 5ALJA 2ZRNA 2NYVA 3HGMA 4E11A 3EC7A 5K2OA 2MYNA 4EYKA 1P4AA 2PLWA 4DIDA 4LXUA 5BR4A 5BOSB 3HN2A 5JNWA 1KQFA 4HS9A 3RYCA 1PD1A 4BNDA 1SBCA 4HAZA 1NMZA 1A9RA 1CY7A 2AFHA 1GPWB 2ZUBA 3PI7A 5L53A 4C08A 4A6XA 3DC2A 2ZYTX 1S8FA 3LPMA 3PSHA 1I2AA 2COKA 3NBQA 4BFZA 2Z43A 1X38A 3KIPA 2LD4A 2ZAMA 4A8JC 3RUAA 3LW7A 3F78A 2PWPA 1Z26A 2QG9A 1OLXA 4EG8A 2DLCX 1UJNA 2FPIB 4M9UA 4EVRA 1IBKB 4ZICA 4LF5B 1ONBA 4YBZA 1C7FA 1ZN9A 3QVOA 3EQ2A 1JI3A 5JCZA 1CRQA 1TT5A 4QGHA 4QWMA 2ZRLA 3GH3A 5F35A 3JASB 5JAMA 3B3GA 1R6UA 3WV4A 5CAEA 2CFRA 3HNPA 4IHJB 5AVTA 3IXMA 4IGEA 1YKSA 4CM9D 2FLVA 4QVKA 1GUZA 3G0OA 4LJAA 1EX6A 3HWWA 5L3SB 2I76A 1P1JA 2QRNA 4FYVA 1FC0A 4WGGA 4Z9BA 5DLQC 3AVWA 2VDII 1A1SA 3ABRB 4XVRA 1D9XA 3PR1A 4WL0A 1MO4A 5HHTA 3DJFA 3S1LA 1K86A 4WZAE 4E13A 1V7PC 4Y9SA 1L5GB 3OTQA 2DFVA 2CJXA 4BX0A 1AQNA 5JMOA 3ZIAD 1BXGB 5BT9A 3I2YX 1Z8FA 4C4RA 2XMDA 5JROA 5L4NA 2H1WA 3BGVA 3D4PA 2G1AA 4GKBA 2WZDA 3NWBA 1NN5A 2HADA 1THTA 1OYYA 1K5PA 1NXTA 1E3JA 2A9VA 3GMSA 5IG2A 5J59A 3RVKA 3U81A 3OU6A 2WWXA 3MTDA 1HE4A 3SLRA 5KX5A 2AD5A 2FF5A 3MJVA 3LP8A 2CB0A 2FE4A 1TEHA 5TQVA 4A03A 4DWOA 1G20B 4F3TA 3WLOA 1OI2A 3H5IA 4RADA 1ARZA 3QLUA 2ZVJA 4IXWA 1E7QA 3DNMA 2V6AI 1CUIA 1GAJA 3ILXA 3ZJUA 3M6MD 1KFCB 1GNLA 4P8RA 2VATA 2H7YA 4HDMB 1LLUA 4RHYA 5LA6A 4NZPA 1GAQA 4DV7B 3I04A 3CR7A 5DEIA 4A6DA 3PE6A 3RS8A 3FG9A 1LBIA 3QVJA 5UKDA 1YZGA 3C7CB 3E03A 4TS3A 4UBMA 1UC4B 4P84A 5DBEX 3CZ9A 4EW6A 2CGEA 2IBSA 1MXHA 2QI9F 3NNDA 4C0HA 1CF4A 4YMVA 1M7HA 1L4EA 3DFFA 4NCHA 3EOBI 1C4WA 5DN9A 3W2GA 5G0VA 4JXZA 2OECA 3ETDA 3O0TA 1NBMD 3P4XA 4AWBA 1HOXA 1T2CA 1CG6A 3R6GA 4KEAA 4V3CA 4X1IA 1W36B 1VC2A 1R0XA 1Y7HA 2FU5C 4EEKA 4JJAA 1XAHA 2XNCA 1AOXA 1B0UA 1N6HA 1ZW6A 1UPCA 1JHZA 3HO6A 3GHHA 3T94A 4D9HA 2FN4A 1A8IA 2PFKA 2Z5LA 2G17A 2Z08A 3MTIA 2Q9AA 1RPTA 3O8QA 4EY7A 5JVDF 3ZY4A 1C9DB 1DNPA 3CEPB 5EMJA 2VI5A 4JX8A 3PPWA 4MARA 4PBTA 1IOVA 4BFXA 1LJUA 1QGED 4OBBA 4Y1RB 4Q00A 2VPIA 1GGNA 1N8SA 4NEQA 4AJ4A 4ZQBA 5JSZA 5AW9A 1VCHA 3JAKA 3NOQA 3RFVA 5KJFA 5KPJA 1FSZA 3I9OA 3ZWAA 1GNTA 2P5YA 5HFNA 1ITZA 3D8BA 4JLKA 4OI0A 1IG3A 3LBHA 1KYZA 2F3TA 1KR2A 1EEHA 4GP6A 1J0AA 3QGMA 1ZY2A 3R6LA 3GZTB 4UJ5A 2YWXA 4Z51A 1VDZA 3CTMA 3ED1A 5EWMB 4PSVA 1ZGAA 1M54A 2ZPUA 3CUVA 3CPHA 4ES6A 1QBKC 4F4FA 2VA8A 2UZ4A 3NTOA 1OFIA 4XYBA 1I51A 4IMIB 3K8ZA 2BIFA 1IULA 4G1UC 4ZEXA 4HL6A 1FDSA 3NNSA 1OWPA 3OFND 4AO8A 4EITA 2RAPA 3H5NA 4EG1A 2XTNA 2YXBA 3SZMA 2BGNA 4QPCA 3DEHA 1NVVR 2PEZA 3ICVA 3VSBA 4BRSA 1ILEA 1EIZA 4NNOA 3MQFA 3RRYA 4BLWA 5CG2A 1IUOA 4G89A 4GI7A 4NNPA 1Z6XA 5CHYA 3WWPA 1Y6GA 3UWDA 3OJLA 5AJZA 1EIWA 4IR7A 3IQXA 3GV0A 4GPEA 4OSEA 4NATA 5CM2Z 4Q4AB 1ONPA 4IOKA 1ZD3A 2ENWA 2QB5A 3KXPA 2JJ2D 3HY4A 3QVWA 1N0VC 2PSSA 1A04A 3E7PA 4I66A 4HR7A 4TS1A 5BN4B 5TJ9A 4ESVA 1J22A 4F56A 5T6BA 3TB6A 3NC1C 2CDAA 4Y9RA 4PZCA 5AOVA 5B53A 1JDUA 3E4DA 2QJTA 3JVVA 3L43A 3BK2A 4BJHB 3EA5A 5B2EA 1FJHA 1ZJJA 4FW9A 1QYWA 2YBVB 4JLDA 5KDOA 4GYYA 4GH5A 1T34A 1BWSA 4UNRA 3P96A 4CN8A 2QPTA 1PL0A 3C3JA 1E3SA 5EJ2A 2Z3VA 3O9ZA 3E05A 4YAIA 2WKPA 3PZRA 4A26A 4AJEA 4Q4JB 4YCDA 3CC8A 3JWPA 4WZ6A 4C05A 4RTKA 2MSLA 1GQRA 2IXTA 2IYUA 4OMUA 4KXVA 1SCUB 3RC3A 3QTLA 4JUIA 2ARKA 2GI4A 2FW7A 3IUMA 3F90A 3K32A 4KLNA 5T8KC 4EH1A 2AW5A 5ICSA 4BB6A 1P0MA 4ND1A 3IILA 1OZHA 1RADA 1FLAA 3EIQA 3TCXB 1N6RA 4GLLA 4RD6A 4LDJA 3PEUA 3EH1A 3VR6D 5HBRA 5DM70 3EDRA 1DRKA 1JQBA 3L6RA 3VR4D 4MQLA 4ZP1A 5DWVA 5FQOA 4KO4S 2ENUA 3H0CA 3QUCA 4XD7A 5IC6A 3FCXA 1TZKA 5JLAA 1RYEA 1ZO8A 4GNRA 3BGOS 1Z2PX 4X71A 2AFIE 3GCXA 3TZCA 2PGJA 4QYTA 3M9WA 1W0JD 2O0JA 4DSAA 2SHKA 1COWD 1NP7A 2PRZA 4LY0A 1EM6A 4BFCA 1RZRA 4S24A 3KQHA 1WUYA 1Z0FA 2VPQA 4O4HA 4YMSA 4BB0A 1T1JA 2GHTA 2VQ3A 4DM4A 2Q1XA 4UVGA 3JWEA 4X54A 2ONCA 2BGKA 4OQZA 3C5VA 4GEGA 2IYFA 4QULA 2PYDA 1VYVA 4E5DA 1JIKA 5K05A 2I4RA 1WKCA 3DFKA 1YK0A 4FK8A 1UR5A 4XLZA 4AZ0B 4E22A 4UOZA 5DCYA 1NG9A 3VNSA 2AV6A 1F4LA 4JJEA 3DE7X 3TDNA 4B6QA 1F7UA 1GSAA 2E4UA 1II8A 1DC6A 4LKRA 4UAJA 2ZUWA 4MR9A 4CTOA 2VOEA 1OZ0A 2WU1A 3PU6A 1OXMA 1S1CA 2J3LA 1C9EA 2XYQA 4ZO9A 4M46A 2GBLC 3FMGA 2H8KA 4MW6A 4B79A 4TN1A 1ISIA 3ZE7A 2QE6A 2DY1A 4YCBA 2FZCA 5T67A 3LZCA 4C03A 1SXHA 4NJOA 5JD5A 1BVHA 2XITA 1K8ZB 2PIAA 1XDGA 2HTEA 4PQRA 1HT3A 3KJFA 4RZ2A 3SHVA 1L4GA 1MTOA 5C0OE 4RJ2A 5FI5A 1WWKA 2VJDA 4C06A 1FB5A 4ZOEA 3U4DA 4EKYA 3AIMA 1E6UA 3E5NA 5LUAA 5TT1A 3IDQA 2DBZA 2XTMA 3GDGA 1KJZA 4WDRA 3ZCSA 2P65A 4TWAA 3SR4A 4AVYA 3ZW7A 4C4PA 1GPUA 3LYUA 5A5GA 3M9XA 3PPIA 1BVUA 3EIOA 1D04A 2JH8A 1U3GA 5KYUA 5I3ZA 1XZKA 1RPNA 5BYBA 1KRHA 2FUKA 3WP0A 1JFFB 3PHCA 4B3JA 5ILOA 5M04A 4B43A 5JNVA 2CEKA 2P27A 1QP8A 2Z9DA 4JB0A 5EWLB 4DGSA 2O8DA 4IQGA 1Z74A 4DYHA 2AWOA 4QUHA 3U1VA 1KZ9A 1PDVA 1H6CA 3JSAA 3LQ4A 3E70C 2WTBA 4RYDA 5DYYA 2QMOA 1Q77A 2IYOA 3COPA 4DLNA 1VKHA 2ZXUA 4WD3A 4EX6A 1LLQA 3NWEA 4P4SB 4YR9A 2VNAA 3F6CA 1YBVA 3R0XA 4A10A 1B00A 4LSGA 3FYTA 3P9ZA 3W5JA 1Q91A 3LP5A 2CJYA 4Y6OA 5DNAA 5LZ4A 2GS9A 5IAEA 4TZTA 1YUBA 3OC6A 4MTLA 1NTRA 5KYTA 1RXWA 2WFLB 1L4NA 1X7YA 5J2TF 3DWGA 1Y8QB 3P27A 3H42B 2O20A 4JJ4A 4Z0NA 1GILA 2OYSA 1AV7A 1NJ6A 2D7CA 2NO1A 2ZBFA 4XLTA 3IUJA 4BX2A 2OLEA 2R1TA 2OZLA 1RACA 3IURA 1SQGA 1SWVA 3H4TA 2B1JA 1ZHFA 2L82A 4IM7A 1GTRA 4D57A 1E4OA 1Z5PA 3HR4A 4PLTA 1YHYA 4GPZA 4IQ8A 4EI2A 4F11A 3H8VA 5AMXA 2Y1OA 5G1PA 3D8RA 4MIEA 4G9EA 5F3WB 1CNMA 4G8DA 4PYQA 5JYBA 2DT8A 5DTIA 3BK7A 1JBQA 1M2HA 1JQEA 5KJ1A 2JEYA 5LFAA 1F0NA 3KSBC 3U7HB 1IHXA 2HLHA 5JFGA 2PD4A 1FVOA 3WJAA 1UK9A 3UJAA 1BQEA 3O2QB 3RLIA 4GX1A 4PONA 2AR9A 3COJA 3X1YA 4KR2A 2IDMA 3WV5A 1J9GA 5DNVA 2PKCA 4JI1B 3G0IA 4CPDA 3K0FB 1J2YA 4G1CA 1Z4OA 3LWNA 2AK2A 3HK2A 3GP3A 3H1PA 5CYFA 3SI7A 1OYWA 3A32A 1LRKA 1GXSB 4CHTA 1G6KA 1E9EA 2H1IA 2M98A 1LU9A 1PWHA 4RH0A 2B5VA 3V1MA 1KS9A 1HDGO 2BSXA 5ALFA 2HQBA 5C1BA 1BVRA 1J1ZA 5FUVA 1JR2A 4ERXA 3SZ3A 1KPGA 3FPSA 2JLWA 2QXUA 2H4ZA 1XGKA 2CVOA 3P9PA 5FB3A 1JIJA 2Q50A 5JY6A 4G41A 4NMWA 2IHYA 2FYTA 1CUVA 1XCGB 3MGKA 4HGZA 3EUEA 4GOJA 4KXNA 3WSVA 5KNBD 1D5WA 3BXFA 2IXBA 2JIBA 2ZPTX 4PSCA 4BQRA 7ABPA 2DPXA 3M5PA 2QV0A 3FH0A 4LV8B 4RKYA 4COOA 2C9ZA 4JMLA 3SS9X 1RTKA 1VLMA 2K4MA 2X86A 4Q03A 4DIEA 5BV8A 2EYUA 1V16A 1Z68A 3L8MA 4YRTA 4R1SA 4I2NA 4JYBA 4YACA 4DCTA 5KC9A 3JQAD 1SIUA 2FPOA 4KSYA 4B73A 3ZJVA 2W98A 1NAHA 3A04A 4Q19A 4D9GA 3BCSA 1C1DB 2YV5A 1RKQA 1UBUS 3C1AA 5TARA 5CLJA 4UHCA 4JYPA 1L4BA 5HJEA 5JXJA 3MW8A 3AVUA 2EZUA 5IEBA 1PVOA 4QRIA 4CU5A 1UOOA 1Y4AE 3GBPA 3N8DA 2NIPA 4OM8A 2J0UB 4YREA 5HRAA 2PUAA 2N47A 3HJCA 1X9HA 2AX4A 4BZZA 2HT1A 3KUXA 1IZ7A 2R1UA 5KTMA 1HE5A 3ZDDA 2YVAA 4IQ4A 3A6LA 2ORVA 3REFA 5C80A 2OKGA 3I6MA 4IQFA 3KSMA 3SZOA 2QL6A 1YBMA 4TQAA 4WACA 3PEFA 3QMWA 1JPNA 1KMMA 1XTVA 1XL0A 1KMQA 3ZZUA 4BNNA 3BORA 4XYEA 4BP8A 4CMIA 1G5PA 3QFFA 4YX9A 2AG1A 3LUBA 3FYSA 5BSEA 3TFQA 1QOQB 3C8ZA 3JATA 1D2CA 2POQX 3PBKA 5ALLA 3AIIA 4XQ9A 1NKTA 1ZR2A 3WBKA 3RSZA 3WKCA 4MR8B 1G3RA 2CNKA 1ZK4A 1O4WA 1T9CA 2AE1A 3A26A 3CMCO 3GEPA 4MHOA 4HNAB 4XIGS 5FA8A 5JBQA 2DUUA 4BO9A 4KQHA 4CFSA 1O95D 4OQMA 4L07A 1XD2A 4Q1FA 1Z2CA 3WKAA 3DLHA 5C8XA 2B5WA 2QBYB 4FSDA 2F00A 3KE8A 4YP7A 4DUGA 3DMHA 5ICCA 3AHGA 1Z2AA 2NU7A 1R3DA 3EQ7A 1RYYA 2V65A 1K89A 5CR9A 4Q24A 3GU3A 5DH9A 1K63A 1E2HA 2HL6A 3I6YA 1R0CA 1NLFA 1XV5A 3FJOA 3KZVA 5SV2A 4UARA 4D9NA 4L5CA 1Z2EA 1EFRA 2QG4A 4Z4FA 2KBEA 4BL5A 1A2OA 3ROTA 2AEEA 3V7WA 1WQ1R 4X00A 4B4DA 5AP9A 2E4WA 5EHNA 1OAOA 2I71A 5JNTA 4H6VA 4JUCA 3ZIAA 4LBVA 1Z07A 4Z7OB 5BNWA 1QX3A 1ULTA 2WMNB 1F51E 2QRGA 3IMKA 3Q72A 2O7RA 4OXNA 1KL7A 4PCAA 3LM8A 4PICA 3GK3A 3G0BA 2W37A 3EIHA 4LF9B 4HOYA 3ML1A 1B76A 4YTEA 4NJEB 3HXQA 1I3KA 2JW5A 1XF9A 2PX2A 4GLOA 4R6WA 1MB0A 2RGGA 3ZI0A 3MJEA 4KACA 4GPBA 3AV3A 4QXQA 2ZRKA 4YUWA 1BQ4A 1A50B 2Z57A 1NOJA 4I4CA 1W4CA 2ZT8A 2OOSA 2J9XB 2FSPA 3KDAA 4MW5A 4KO3S 1EZ4A 1ZCFA 4D8UA 3EGXA 3GG9A 4QNRA 3SHFA 2QTZA 4EEZA 4R41A 2WKRA 3PQCA 4K1LA 5AJVB 1YBFA 3EEQA 1OF1A 4ER6A 1S2NA 3ZZTA 2TMGA 1YQDA 3L1KA 5TGDA 2H59A 5AW5A 2X1HA 1C3JA 1GGFA 2CN1A 1U4NA 4J0HA 2ZFUA 4BY9E 3UAOA 3A2LA 5F5NA 1UWAC 2ZUUA 4FD3A 4YT8A 1CR6A 3D02A 4UU1A 1KEVA 5LZ9A 3DZCA 3WK8A 4WV3A 2YYZA 2HAEA 1CUCA 3AFIA 1LV7A 4RVDA 4JSTA 3C6QA 1DTWB 4MI6A 2XLBA 3R8CA 3EVDA 4J0JA 1CB0A 4OREX 1P0QA 5IX8A 2WIFA 3UMFA 5GZ6A 4FDTA 4AZTA 1E9AA 3JQFA 4E07A 1HT2E 2QSZA 3V1YA 1X2BA 4IVRA 2FPWA 3GEHA 4J0EA 4C1NA 3W9UA 3DUFB 4XJTA 1HO3A 2ZJOA 3DD1A 3T5PA 4J7CA 4L5YA 2O8BB 1PW5A 1JLHA 4L0QA 1JMVA 5COAA 4Z6KA 3PVCA 1IEVA 1YTLA 2FPKA 3OLXA 2D8MA 4DYVA 4IVNA 1C9YA 4H77A 4EAQA 2YS7A 2C82A 1OBCA 2GXQA 1C4KA 1YZQA 4IJVA 4O6VA 2G6TA 3I73A 1R3UA 1V9CA 1OROA 3EZLA 4DCMA 3G1TA 4WUVA 3KPVA 2O19A 5JU6A 4MW1A 4R2JA 4ZALA 1KI3A 4C14A 3ORRA 1W29A 3TGWA 4E5KA 1YB1A 3K05A 4JI5B 1XMSA 5KAPA 4BVGA 1XWIA 1QQBA 1W94A 3B1ZA 1OC4A 3DSRA 1LDMA 5B3KA 4KXUA 3PD0A 4WNIA 3OSUA 3PA6A 1D4FA 2D2XA 3OVMA 1TW3A 3BFKA 2Z09A 5CPFA 1ZUNB 3V2GA 2C3UA 3K9HA 2H4WA 4ZCSA 1RJWA 2ZIXA 4OH1A 3LX6A 1M73E 4YCCA 4MP6A 1DXHA 3AVYA 4KN6A 1TF5A 2QL9A 4Z2YA 1XNRB 3B6KA 3W4IA 1HKHA 1XCLA 3GJ8A 5L6LB 3R4VA 3RAGA 5CVUA 1RKVA 1DAGA 3QFSA 4OQLA 2B8EA 3I52A 2P9EA 4NFLA 1KI7A 1XX6A 3PT5A 3K2BA 3T15A 4Z4GA 5INTA 5KHLB 2UZ1A 2EC5A 3MXOA 1VSUA 4LJ5A 4M0DA 2O1WA 1JWAB 3EXEB 1DG9A 3WTBA 1MJNA 3R5HA 1XTJA 4EF4A 1U9ZA 3TSAA 5HE8A 7YASA 5JUWA 4HXFB 4GX5A 1MW9X 2LTAA 4DM3A 2BHNA 3MMSA 4OYRA 2HO5A 4MRVA 3REQB 1L1FA 1I94B 2C57A 3B6JA 2JFNA 2AF3C 3CHYA 4RKWA 3OY2A 2WIBA 4G36A 2FX5A 1YI8A 4EUSA 1EINA 2Y92A 3O4HA 3IMFA 4M88A 4RA6B 2B6NA 5LNK6 1IZ0A 4FS8A 3BTUA 1Z2NX 1NT4A 1Z28A 5GPBA 3GI1A 4DQUA 4PX5A 1ZUHA 2ECOA 2PK3A 3IO3A 1PFUA 2XTZA 1GJRA 3DBRB 3ENNA 3PENA 4BQPA 3ZD6A 5FHRA 4WGFA 3CVOA 5AUOB 2O8CB 3RVBA 2ZQ5A 2LE0A 4F2WA 1ZBQA 2Z6VA 1FNMA 2EF0A 1WY5A 3LQFA 1T1GA 1WB5A 1LFAA 3IP8A 4HI0E 1X1TA 1PJCA 4NBUA 1MJHA 3C8DA 4PQEA 4DA7A 4XJXA 5EMKA 1R37A 1NV8A 1PS0A 4RJLA 4CEJA 3SQOA 4A8JB 4LS3A 6AT1A 5KYYB 1I33A 4WKGA 3LA8A 4JVNA 3VU8A 5DWQA 3NHMA 5ED0A 4I3FA 2O7QA 3WDKA 5FA5A 3G82C 3H9JA 1PJ4A 1QVWA 3FPJA 3Q12A 4CLRA 3IP9A 2EJCA 4D8XA 3BQMB 3Q88A 3HKDA 3H9QA 3R3YA 9LDTA 4OATA 4A15A 3AW8A 1AJEA 2YHAA 1Y42X 2XB4A 3LKVA 3WHIA 4S2UA 5BUQA 3M9LA 1HQKA 1FDIA 1X7XA 1JYEA 1DJLA 1TK2A 4MP3A 4P4NA 4F5DA 3KLNA 5CVDA 4YI3A 3TTSA 4P7BA 4TKUA 4LY9A 1H2BA 1HF3A 1KZ4A 2HMSA 3AFMA 4U8HA 1IXSB 2CLFB 3F2IA 3KQTA 3VR6A 4LE0A 1GZHB 3KZKA 3LBAA 3DE5X 3LFTA 3NHYA 4Y1EA 1NXXA 4OLJA 1CUJA 4B8WA 4OA8A 3U6BA 4OD0A 4NZMA 1YCGA 1EMDA 1L5OA 1U94A 3BZWA 3DMFA 1MN6A 3VHRA 1NUUA 3HUTA 5THQA 3T61A 4YMLA 1S01A 3P2YA 1UOPA 3LKZA 1N9KA 4KVAA 3FKSA 2J4CA 2ZATA 3RB8A 4NU0A 4K6FA 1MJ5A 5AESA 1GM5A 4GI1A 4GXRA 1QTQA 1BD3A 3HE3A 5EUMA 4LK2A 2JBHA 2HU8A 3M81A 1JEDA 4IGKA 3WJ2A 5M29A 4DY6A 1CVRA 1E1CA 2C4TA 2O3QA 3DPUA 5FBVB 1MRNA 2BC9A 4AN0A 4W99A 4AZ3B 2XECA 2Z9BA 3MUOA 4E5SA 4FHZA 1T9HA 4MW2A 2QY9A 1AD2A 5CVJA 1SCQA 3OZEA 2AMYA 4RPJA 2NU9A 4BVFA 4D3YA 4G5GA 3K4HA 1OZFA 4P82A 4I8IA 3UG6A 5CNKA 2IOFA 4NDAA 1JLSA 1DIRA 3SLGA 1OD6A 3Q3VA 3CB4A 1VYTA 2ZQZA 4ZRDA 3D1VA 5CXSA 3B1XA 3AR4A 3AJRA 3FTFA 1VJGA 2ZBRA 3O3CA 1KO5A 3NBKA 1SUFA 2FZGA 1D03A 3OOHA 5FULA 2ZE8A 4OXQA 3RVSA 1P2TA 2PAAA 4AKGA 2O2HA 3NEPX 3CSSA 1XKTA 1GNSA 1TYEB 4HDRA 3JRNA 5FT9A 1D6SA 5GM2A 4M9CA 5IWCA 2E1RA 2C99A 1P7YA 4PGAA 1WXDA 3UOAB 3L6OO 1KMHB 1DKQA 2VKTA 4XGRA 1V8OA 4AMZA 4KPUB 4CIDA 2PCJA 4ZV7A 2C4HA 2VFAA 3FYCA 3ANSA 3AZPA 4UHJA 1ZUIA 2G07A 4U9HS 4FFBA 1JFVA 3I01M 2ODWA 4ZOLB 4DCJA 4YGYA 1G291 1IE3A 1IC6A 1CUWA 2GM4A 4MHTA 5IF3A 1HY3A 4GOKA 4TKVB 1HYEA 1R1DA 4BPBA 4FWIB 5F7XA 2P69A 2GPWA 2PMWB 4QBTA 3H2GA 3K31A 3P9CA 4HYTA 4W8OA 4L6IA 4FE7A 1XEWX 5HBGA 2Q6IA 4MVJF 4NZZA 4NCXA 3VDQA 5J2TA 3AM1A 4MULA 3BDVA 5C4IA 4TMTA 4B31A 3AR3A 4PPFA 3EF0A 1E96A 2CBZA 3WX0A 4WOBA 3CUUA 1S5PA 4OKNA 5J5AA 4KWHA 1NIPA 3A6EA 2B92A 1XZJA 2YZ7A 16PKA 1W5AA 3CZMA 4J1TC 1E18A 5GOTA 3QV1A 5E1MA 2J5XA 2UYYA 1IAVA 4GGMX 4Q3KA 2KMLA 1ETUA 2VYVA 3GJSA 4CW7A 4F2PA 2VNSA 3OT5A 4HBZA 1Y34E 4YDQA 4J9UE 4MVJG 4F8YA 1BW9A 3WNVA 4TXMA 1XMPA 2IEYA 5D3ZA 2FK8A 3ROZA 1D2AA 3OG9A 4YV2A 4JFAA 2BH2A 4FBGA 1CRZA 4D5GA 5B7QA 2DETA 4AUNA 1YZ3A 3BMCA 3EZ7A 5CU7A 5EXEA 1NQTA 2VXYA 3AQIA 3HKCB 3U3MA 2AHOA 2H4HA 3VSAA 1GV1A 1BDMA 2NTYC 2WJWA 2BI4A 1G9SA 3NBYC 2E9SA 4MV5A 4MW9A 3U9SA 5IT0A 1D2HA 2WE7A 1P19A 3FPNA 4YJFA 4EZEA 2KWIA 1HA3A 2WSLA 2ZVQX 3MWFA 2BCEA 3ORFA 4IJUA 3DL7A 3P9QA 1ZNQO 1F0YA 4JS0A 1RE0A 4LJ6A 3ZDQA 4E2WA 1JEQB 4C4XA 3EDCA 3R7WB 1GL7A 1EM8A 2HA4A 4TTPA 5JE8A 2LXNA 1Z4KA 3B2NA 1C9MA 1PFQA 2GN4A 3H9GA 2K6GA 4U5XA 4Q0MA 3ZXWB 3VMMA 4YUZA 2QZJA 5BN3B 1VG1A 4RLQA 3HPQA 3KWLA 4MS4B 3TQHA 3PPVA 3IH5A 2J48A 2HCTA 2ZRCA 2N46A 3HJRA 4N76A 3LUGA 2KYRA 1SG0A 3PWZA 5FUYA 5BVGA 3WZMA 3AEUA 1YRYE 5IM4F 4TXJA 4D9IA 2WKWA 1Z63A 2DUWA 4WLEA 3ZU5A 4CR8A 3AF1A 4ZC8A 1YV9A 5C3MA 4ND5A 1U7UA 4PZEA 4TTVA 3H11A 5H1YA 1U6IA 1ZNZA 3S2IA 2PR2A 1OBOA 1EP9A 5GWXA 1K8XB 1Z73A 1FJGB 3TJMA 3AW9A 5DN6A 1MDFA 2Y1EA 1YZKA 2R1ZA 3MWJA 2I80A 2WI8A 3ERCA 2FX2A 4WKOA 1TOAA 2EP7A 2B30A 2NOAA 1J06A 4O2AB 2F4NA 1CZRA 2ZB8A 1KSHA 2HXGA 4IFTA 4AI6A 3UT5B 3HHEA 2BCGY 2NUAB 4H27A 4BNXA 4UEQA 3LE8A 4BOYA 1FMCA 3ZBUA 4EFLA 3V1LA 4W1QA 3UWSA 1T2NA 1EP1B 1G0NA 5LVAA 2GFIA 5A3QA 2C2OA 2X42A 2MR5A 1DJOA 1EG7A 4RDIA 4DMRA 3GQBA 3KEQA 2H1SA 3K5WA 2ZJFA 2GLTA 1A9XB 1NUSA 2BTQB 2CZGA 4FR2A 3GEDA 4FQ5A 3V32A 2JHFA 2OCYC 2VP0A 2XMQA 3OY7A 4JBYA 1GA1A 1VE5A 3K0HA 4DIFA 3FMPB 1HETA 2NXNA 3HACA 4EJFA 4YRAA 8ATCA 3C7AA 1GSIA 1NRWA 2VDOB 3HXKA 5FOQA 2EATA 4NLLA 5HZHA 3AJEA 1N36B 4F0JA 2HMVA 2SBTA 3VTKA 2H31A 1Y5LA 5ELXA 3IEXA 3WKDA 1G5QA 5IBQA 2OPHA 1T4CB 5SZHB 1PN3A 3U0VA 1IQPA 1PP4A 3BMOA 2I3ZA 1YA4A 2H29A 5IUNC 5C7OO 2AJTA 1FNNA 4J0IA 4KO2S 4LMRA 2O07A 5HJ7A 5H02A 4ETNA 1YNSA 3WYDA 2PSEA 3CQ9A 3DZIA 4GM4A 4OJMX 3ZGLA 5IDXA 1NJFA 2BGUA 2XNDA 1T5HX 5DM2A 2XGMA 4JWKA 3DG9A 1XVVA 2BBOA 1RWOA 4XUCA 2RH9B 1E9CA 1PDOA 3Q7SA 3QU2A 3FOEC 1RCOC 5ED4A 3GAAA 1C0IA 4UOEA 3GGSA 3H6HA 1GUBA 3GLHB 5EINA 2FZVA 1ZVJA 2OHGA 1Q0ZA 3T7IA 3LX8A 3UYLA 4BV2A 3I6IA 4PO8A 3T5GA 2VJCA 4NJMB 3L18A 3VU1A 3AUSA 4LN1A 4P81A 5GGYA 2C8VA 3QKWA 4X97A 1NC1A 3RYHB 2X0NA 2IU0A 4QATA 1MA0A 2ZJBA 4RZXA 4C5CA 2FMUA 1YMQA 8RUCI 1XRRA 2A0XA 3GJ7A 3UAWA 5MFZA 3GEBA 3RQSA 3NM6B 2Z8YM 3WIEA 2WKSA 1TADA 1H5QA 1E5VA 1L4UA 4P4GA 4ZQCB 1ATZA 1LPBB 2P4HX 2R6GA 4WNAB 3TLBA 2P0YA 1MV5A 1XC7A 3D5QA 2I99A 5AW1A 2A0UA 2FHSA 4KBGA 4O4IB 1C2YA 1D1QA 1KH1A 4RJJA 4RH3A 4JEIA 1CR0A 5EP2A 4AF6A 2ZTMA 3NR2A 3U7QB 1E6KA 4L8GA 1ELOA 4TM8A 3J7TA 3U7FB 3MF4A 2O2ZA 3R7AA 4JZKA 1E1NA 5A62A 2OP1A 4NY1A 2PHZA 2BUAA 2WAYA 3UTCA 1KOJA 2ZGVA 3CN9A 2A0KA 2D00A 2YC2C 3V2HA 5BRJA 3QWBA 1RQNA 2VDQB 3KKPA 4M53A 1CP3A 1VHWA 4HVAA 1ZL0A 4U7WA 3X0DA 1ECGA 2IX9A 1U98A 4YN3A 4KQ1A 2YWDA 2F1KA 3AYZB 1UZAA 4WK4B 3SK0A 1SXJD 2ACVA 5D5PA 2QAJA 2YJ3A 5H9VA 2C3YA 2JFPA 4HWPA 1ZPDA 4NI5A 5IAKA 3TQRA 1ZGCA 2FW1A 4RAQA 4C7BA 2EARA 3LLMA 5DIZA 1ZNWA 3ECAA 2Y1WA 3GGJA 4YLEA 1G0OA 4DADA 1KXJA 3A70A 1QHSA 1DELA 3C1TA 4MV9A 5KHOC 3DBIA 1J1UA 5IT5A 3BMNB 1TMGE 4CNQA 1A7UA 4RKRA 4F9FA 1GPH1 1M8KA 1ODSA 2HRDA 2KW5A 2QG6A 2PXCA 3RUHA 2WT4A 2JLAA 3DOCA 5G0WA 3E3NA 3LUFA 1X86B 5A3JA 4O29A 2H92A 5JQWA 1OASA 4JFRA 5LYJF 1BMFD 3JZDA 4IQ0A 3PGLA 3PJFA 4MV7A 2EDAA 3DCJA 4FOOA 4JVOA 3W5VA 3ZDYB 2CMGA 3HADA 2GNAA 3QZUA 4FWBA 5FR1A 4WN9B 1K7FB 4N6GA 3FMVA 1AKQA 1KVTA 4KQEA 4UEWA 3ANMA 3VVLA 4DNOA 1KWGA 3HDHA 2ZKIA 2GEUA 2YHUA 4NYIR 3AHCA 2FPPA 2ECQA 3K3PA 4O1IA 3H17A 4RA9A 1DKRA 3QXSA 4WXMA 2WT8A 1QYCA 1J97A 4ID3A 2EWVA 2OHVA 2XGSA 3FHOA 3OT4A 5F33A 3G9UA 5LKRA 4DE5A 2PGDA 4G0NA 5I7AA 4LYDA 3UOWA 4IDCA 4G56A 3ZE8A 2ZSKA 4NARA 1XTIA 4AKHA 1TRHA 4NPHA 2VHYA 3NFYA 3AI1A 3G85A 4EGSA 5A02A 1Z5OA 3E1SA 1TB4A 3K1AA 4YYZA 1T8PA 5HKBA 2V6MA 4I0WB 2JJYA 2CHUA 3HVIA 1UXKA 4X7PA 4M7OA 5CH8A 2C2YA 4GT1A 2XE8A 3R3HA 3T3IA 1RLMA 1ZZGA 1OSNA 3SF8A 2RCNA 4XW2A 4OQYA 2I6UA 2WPDD 3OJXA 5EIBD 1ACLA 1AKNA 3I5YA 3NMUF 5IAJA 1EU1A 4RSMA 5K99A 1THGA 5LSAA 3N28A 5BV0A 2KBFA 1FFCA 3HRIA 3I12A 2B3DA 1Z4MA 4J03A 3X44A 2NZ2A 2C2XA 2G67A 4BGDA 1N33B 5F7ZA 3Q7QA 3B6IA 4D80A 2R85A 4CCYB 3BZUA 1Z5UA 2Q3EA 3C3CA 5CEFA 5I6DA 4XB6B 5GVRA 1Q1ZA 3A27A 3CWQA 2DULA 3A36A 3AI3A 1NVBA 4F5EA 4ZCRA 5B4UA 3E5RA 1BD4A 4S3MA 2X76A 4I4TB 3LLVA 2M6LA 3BWEA 1ORTA 2JLQA 3FFXA 1KFKB 1HFWA 4JBHA 2VK4A 4LNHA 5FBLB 2QRVB 3SN6A 1EESA 1EAYA 5CP8A 4LZWA 3KBBA 3LY8A 3MWKA 1RM0A 5KZMB 1ZRMA 5KVQA 2NYRA 3B36A 2FSUA 1CSEE 3GD5A 1RNLA 3OJEA 1B2LA 2SCUA 4TLLB 1ISSA 1N1MA 2FUEA 2BMJA 3C15C 4TVOA 4TMXA 4NV3A 3GD7A 2IUTA 3L93A 1NSTA 1ORWA 3HBNA 4LHZA 5JQGF 5DSTA 3WRYA 1YOVB 4F8EA 2XXBA 1V3UA 1YKGA 1GSOA 3DHVA 3NUQA 2DP4E 3QE2A 4ZI7F 1CP2A 2OGZA 5BN5B 4FZRA 5ALYA 1KARA 4GG1A 3D3WA 3NC4A 4IVPA 4BNIA 3HA3A 4LRQA 1ZFNA 1TEXA 2P9CA 3F3MA 3VSCA 3OQPA 1PL7A 1VIAA 1W5TA 1YZFA 3C85A 5B7PA 1JXOA 1ZD9A 3NB0A 3WIOA 4B84A 1L7BA 5C37A 4B1FA 5JSQA 3TW4A 2H8GA 4F46A 4EYEA 2XYRA 4YBRA 3E8SA 1NYLA 5K0EA 3EPHA 2CXTA 3V4PB 4ZFNA 4YHHB 1MB4A 2QN6A 1P6UA 3CVJA 1EK5A 1T1IA 1FX0A 2OG1A 2VHQA 3L4EA 1VB5A 4YQZA 1QRTA 4RQAA 1HNNA 2VHJA 4E12A 1EJ6A 1U8TA 3Q1KA 1AUVA 1U2SA 1W4AA 2K87A 4RXTA 3TO5A 2BFCB 2VPYA 1JG3A 4DANA 2C4MA 4H08A 3BRWA 2VIIA 4A5OA 2B8TA 4JBNA 3M3DA 4HQ0A 3DH0A 2Z2XA 5I4BA 2WDZA 4G84A 1K7CA 2PRSA 1I3CA 3AWDA 1XTTA 2QTMA 3PRJA 1SU4A 1UMCB 2XCOA 3Q6IA 4K28A 3CNLA 4KSCA 5TQ2A 5CDFA 2HFJA 3ZD9A 3SEQA 2O7SA 3F97A 4C0BA 1PZMA 1ABEA 1CQPA 2ZR7A 2G80A 5AI4A 4DR6B 3A4IA 2C9BA 4LVCA 3OKPA 1L3IA 3RVNA 2WTXA 5KTNA 4AY2A 2FFBA 4UUAA 4B8ZA 4WMLA 4X66B 3KKZA 2R6HA 5LDDC 4RTRA 3NT5A 3NXSA 3E2PA 1VRWA 2J9ZB 2QYOA 3EHDA 4RPHA 1MTZA 3F5FA 1CJCA 2HBZA 5HR5A 1TZ2A 1CDEA 1Y8RB 3N58A 3TTXA 3H5TA 4YMTA 3AWIA 4TUYF 4BGIA 2HLPA 1X74A 4DSUA 3HYSA 1M1NA 1Q92A 1A5TA 2JGEA 4Q15A 3RRNA 4XUDA 1OV4A 2IGTA 2W7TA 2HD4A 2ODAA 1B8OA 5K8VA 3N2IA 3E7FA 1T6ZA 2RJOA 1FSFA 2F1OA 3DAFA 4XJVA 3TIGA 1Q19A 2V3WA 4NWIA 2AGVA 3OEYA 4GX0A 1TM4E 4MRMB 3RIYA 2WAOA 1RHQA 1S9DA 2HF2A 2ZI9A 1U4SA 3PUJA 4OCZA 4YT2A 2V98A 3KZNA 1KY2A 1KSJA 2OD2A 2BFDA 3M83A 4MVJA 4GF5A 4UNNA 4UBOA 2DH5A 3RTEA 4X6LA 2GK3A 3JD0A 3GY0A 1ZOLA 3B8HA 4AZVA 1SK9A 4BO5A 5DW3A 2I8CA 5GJWC 2AI3A 2GZ2A 1XEAA 2IF0A 4GWGA 1UBOS 3A1DA 4ZC1A 1W88A 1GQFA 2BSAA 3LL4A 3UXHA 3RRXA 4Y2SA 3A06A 3A14A 2BFPA 4FKBA 4REQA 2GD0A 2IPNA 1QHIA 3QELA 3P9SA 2ZUTA 2FR1A 4DIKA 4QGSA 1HZZC 3H2YA 1Z0UA 4C6HA 1EDEA 4IRUB 3FDJA 4Q3BA 4DVGA 1GAWA 1AKUA 1H6AA 1JDTA 2FPRA 3MSCA 4K26A 4BMXA 2CJPA 4HNSA 2W2MA 2JB9A 3ROEA 4EKIA 2ZB4A 2H08A 4I1OA 5JARA 4GKJB 3WVNA 5D6NA 3VMFA 2I8LA 2QRKA 1QO0D 1RW4A 3KQSA 1XU9A 3HDYA 4R2HA 4HT3B 3NBFA 1QYDA 4C6SA 2APJA 4YA6A 2YNMA 1GDHA 1Z7WA 1Q0RA 4JDPA 4C7JA 1E5QA 1PZFA 1Q0PA 3K9NA 1M72A 4PLGA 4PO9A 5CVVA 5DE3A 5H68A 1PEDA 4PRYA 2FQQA 2REOA 1G63A 2Y67A 1CUFA 4XZ3A 3BAZA 1HDRA 3SZLA 3EVBA 4W5NA 3FNBA 3QV2A 3UFBA 4LDNA 5CPBA 5DHRA 1Y7PA 1ISPA 5EC8A 3SQNA 2VTEA 1JG4A 2QRUA 2IPLA 2G77B 2X0DA 3DV0B 4YQEA 3UPDA 1QIHA 3K30A 3DA8A 1U3VA 4L74A 2C77A 4P35A 5AHWA 3UV3A 1JB9A 2I4OA 5ALSA 1Y5MA 3ZHSA 1K4MA 4EDHA 1NVMB 4D0GA 3CRQA 1S4QA 3CE9A 2YUTA 3VU9B 4GX2A 3FIUA 5JWRA 4XD2A 1Z06A 1ZGGA 4TRMA 1NNUA 4CCAA 3F3YA 4GM0A 4ZOQI 4XYLA 3ENVA 4WH0A 5E7MA 3D7KA 1GCGA 5A03A 6ABPA 3T7KA 5HM6A 2OV2A 1YS4A 3RUBS 3ZHOA 2BGGA 1D6NA 2DERA 3BWMA 4H31A 3R09A 1ZICA 3BXEA 3UB4A 1QFYA 1XZHA 2FEAA 2Q1TA 1M1YE 1Z15A 2JI6A 3G2MA 3B6EA 2ID8A 3I1IA 2UYQA 4BGEA 5A04A 3THWA 1NI4B 1PTKA 2C58A 1VKJA 4LGCA 1JAHA 4MQUA 3VISA 1Z7YA 3COZA 4MLZA 4EFMA 2ZITA 1H2ZA 4HDAA 1RZVA 3TUJC 4BO3A 1ZOIA 1XNQB 1E0KA 3VI4B 1AN9A 3A3NA 3AM4A 3W5AA 3ZV6A 5JMWA 3K20A 1CYEA 5F1OA 1BHJA 4ZT3A 3D7NA 721PA 2WJPA 2CMFA 2VRNA 4K0RA 5JYCA 4ZO6A 4G1FA 2J0QA 4G1BA 1TVMA 4KVGA 5ALKA 4E5YA 3OCWA 2NMVA 5KYXA 1U28C 3B82A 4YT4A 2LV8A 1ZDMA 1G98A 1N0WA 3VO2A 4D41A 1E7WA 2FQWA 2B8WA 1AKTA 5FHQA 1BE6A 4B6PA 3DEAA 4DZRA 4J2OA 5CVCA 2HHAA 1H3FA 1HTBA 2BEUB 1T6NA 2XSZA 2RC6A 5IDYA 1JTFA 3D6UA 1DV2A 3RBXA 4DDTA 2X2PA 2J3KA 2R751 4BNJA 1O6GA 5DGIA 3I3OA 3VZBA 4AMYA 3OLVA 5IKXA 2VSQA 1N32B 5FX2A 1T3TA 1XDDA 4MRAA 3R74A 4C6RA 1L7VC 4Q02A 1B0PA 5AHKA 5KMGA 1H69A 2XDAA 4KX5A 1CEQA 3L0IB 4CLOB 1ZSYA 1L7AA 2Q2QA 2GM5A 2QAGC 3OT1A 2JZNA 2PVCA 2V97A 4DRXA 5HUQA 1ZJYA 3D0KA 1RQ7A 1UBCA 2D1FA 2R7LA 3OKAA 1AK9A 3AL2A 3I9KA 3USZA 2EBHX 5FPSA 1UPMC 1XZMA 3KBOA 1BFDA 4DWJA 5JANA 2YN2A 2BR3A 5EE1A 5B3JC 3MLAA 3GGGA 4GNKA 2XZTA 3TLZA 1IM2A 4S0XA 4HGRA 1IXRC 2IYQA 1UBHS 4QNMA 5ERGB 2BZ1A 3LY7A 1BNCA 5F64A 1JQKA 1P1BA 4OEHA 2XDQA 1Q74A 3DM5A 4W5WA 2GTHA 4X6UA 1XK7A 5D2CA 4CF6A 2C7QA 3W3ZB 4S05A 1T8RA 2MYUA 1YJCA 1DQYA 5B37A 3RRMA 4CIAA 2OTCA 4UM8B 5H81A 4U3JB 1XJ5A 1N2CB 1Z6AA 1F48A 1QOPB 2A0YA 1V3QE 1P3DA 2F8MA 3KYDA 5FA6A 2LCQA 1M74A 5A1JA 1YZNA 1VXRA 4PSAA 3VDMA 4F4JA 3OOSA 3KPWA 5IC5A 2Q3HA 3EVNA 1KY3A 1YASA 1XHEA 2N3ZA 4G67A 5FCDA 4RORA 4NV0A 4XIYA 1GPDG 1FK8A 3EXHA 2X0IA 3OHPA 3X1DA 2NU6B 1AKVA 3MOGA 4BLSA 5CFPA 4Q4LA 3MD0A 5E1DA 4DV2B 1Z39A 2BELA 4MB6A 4I6EA 2B1IA 4MYUA 8ABPA 4N03A 2VOJA 3IKVA 1PGPA 1X77A 3ASUA 1N8KA 1ZM9A 1XR3A 2HLDA 3L07A 4GSKA 4QSMA 2IP4A 3C45A 4KMOA 2ONKA 1GLNA 5GGXA 5J5VA 4B35A 3AG5A 4AF7A 3LZDA 4DG8A 1CHNA 4HMOA 4N0DA 5JALA 3VPAA 3AM3A 3E2MA 4GKVA 1M10A 1OPRA 3AFNA 2VCHA 2XODA 4D4JA 4H7DA 4L51A 5CNMA 5BXQC 4I2VA 5H59A 4XEUA 1RD4A 1E7YA 4AU1A 4OHUA 5K0NA 4C0JA 1FUKA 4J0GA 4GR5A 5D1NA 1L4FA 3BE4A 1BJKA 1JEYB 1WXXA 2C9MA 1AHNA 3HCBA 1IWAB 1JG1A 3MELA 2EYQA 1SXJA 1RFLA 3EE6A 1X14A 2FUG6 3GX1A 1LK0A 3LF1A 3T12A 4RVHA 3ZEAA 3IQIX 2OAQ1 4DR4B 4YJ3F 3ACCA 4IMJB 4GM1A 2PZGA 4X20A 3OLCX 1ZN8A 5CLLA 1K7EB 2X1LA 5JPDA 1CUHA 2ZBPA 1RWQA 1T3HA 1AKYA 1ZQ9A 3UV6A 3WZ2A 4BHTA 5L40A 3NTRA 4XPZA 3G79A 3K9FC 2A0WA 3EGIA 1C14A 1YDHA 2GXUA 4J43A 5LZ5A 2Q5HA 2X8LA 3ILVA 3SY8A 3TDKA 1R4MA 4BMVA 3AFGA 1NP6A 5KU7A 4LA4A 1LPOA 2H2IA 3AY3A 4H59A 3EIFA 4ISBA 4M8IA 2XWQA 4JUAA 5CFZA 3TDMA 3DFUA 4QFBA 3ZOKA 2EFYA 1OT3A 3KJXA 3OJOA 2REQA 4HGYA 2D59A 4GL4A 3G2NA 3ORYA 3D2LA 2YFYA 1SCNE 1ST3A 2Q3JA 4U2DA 1T0JB 2GAFA 4MUFA 5DYIA 5K3FB 3RFUA 4I1UA 1WCV1 2HK9A 1NSFA 4FZ5A 4U2CA 4B40A 1UPAA 2ZSJA 2CJFA 1FYXA 2IYZA 3FLMA 1ENOA 1Y3DE 2HHCA 4NZOA 4OLHA 3DXFA 1J8VA 1QRRA 4P3KA 3A0UA 1G21E 1F06A 4C6TB 1R6VA 1QIDA 3VVMA 2QP9X 4J0CA 1BEUB 2VHEA 2PXHA 4LZOA 1N6OA 4DDUA 3IV6A 5AK4A 3VZDA 2FR8C 2WILA 4RM3A 1QPZA 4FDAA 2RAFA 1QQ5A 3M89A 4TL9A 3NH9A 4DLLA 3RKRA 4HDSA 2PVSA 3SQDA 4GP7A 3KPJA 4BO6A 1QVVA 3MRXA 4B3TB 3I2FA 4IOJA 4AZWA 3CVWA 1KYTA 5D3KA 4IRMA 4Y2QA 1CD5A 1GNQA 2H6EA 1A2BA 2ACEA 2V9CA 3USCS 3U6KA 1PT6A 2J45A 3D81A 3T52A 5T4HA 3GT0A 1NVEA 3A1SA 4DABA 1TDJA 1P4HA 2W6CX 1KJNA 3ZCQA 3JALA 3PX7A 2AJ8A 4QEZA 2OCPA 1PFGA 1UC9A 1Y89A 1CNEA 2CUZA 2XE7A 3M4JA 4TTJA 3DXXA 2PBZA 4FBMA 4I5EA 2BMEA 3AYXB 2QWXA 2XBLA 4RY8A 1OXSC 4LVUA 2O5RA 5GJBA 2ZI5A 5EXDA 4BO7A 3M6AA 3OIYA 2XXJA 3H2ZA 3ACDA 4BLOA 4KPFC 1ZESA 3K8QA 2ATVA 1X13A 1UT8A 1GZVA 1HMPA 1HURA 1RM4A 2IW3A 3AI7A 1EFVB 3DOUA 3L01A 3OE4A 3WGOA 5JQGA 1MW8X 4CT0A 3ZNPA 1I6LA 2Q4RA 1P5FA 4LOKA 5DMXA 1C7IA 1Y4ZA 3B3QA 4E5NA 2V7TA 4ED9A 5BRAA 2QTVA 4BRWA 2CZCA 2VHCA 3VHXA 4DA4A 1GWNA 3IP7A 5DM0A 4G9GA 2HMUA 5JAPA 3T3NA 2DKOA 1IEQA 4WK2B 2SKDA 5E4YA 4GMFA 4B75A 2AOVA 4RESA 1ZC4A 3DHEA 4II2A 1JILA 4IDOA 4WIAA 1KMCA 2VTBA 3LKDA 4E1VA 2VNKA 3IQWA 3GAMA 1B3BA 1DX6A 4G4SO 5DGHA 2AZ4A 4REOA 3RVMA 2Z2YA 2YZ2A 3PRHA 2B69A 3P2IA 4EVSA 1YB7A 2AN1A 2FEKA 4DBLC 2H00A 1XDBA 3I9FA 3LYLA 5F4ZA 2BLLA 4FXOA 2A9PA 1XXHE 4MUIA 3MRSA 1E1DA 3C6XA 3D8NA 3O1LA 4X7RA 1J20A 1SUWA 3CJRA 3RTAA 4ARZA 3H18A 2A3RA 4A2WA 1X9GA 5LL6P 4C22A 3K0CA 4GYKA 3EHEA 3K4QA 1W6UA 3HCDA 2EKBA 3I9V1 1GPLA 1S3IA 2QSUA 3HU2A 4LOIA 3OOEA 5CH3A 3ZWDA 4LTMA 3AETA 6YASA 1WM1A 1Y0BA 4TKLA 3DKKA 5BMOA 1DX9A 3QUBA 1W85B 1P4JA 3CKMA 1I4OA 3Q0EA 3QU7A 4HRAA 3ZUPA 1K27A 3E9NA 4DPKA 4YAJA 1FF9A 2I22A 5LN1A 3BG5A 3DKIA 4HNRA 4XSGA 1I10A 3IVXA 5IC4A 3DKPA 1ZA1A 4CKEB 2A5DA 3QPVA 2GHRA 4XWAA 3B5IA 3L92A 5ES4B 1NUAA 3ADOA 1IWOA 3LDGA 3L7NA 4MPRA 5FWYA 4K6CA 1U1DA 4L8LA 2DE0X 3I6BA 4RK5A 3X1JA 1OLUB 3F74A 3E7DA 4HH3C 2ZT5A 4HB2A 3ZHUA 4AKTA 4EKNB 3DR5A 3QI7A 4KWIA 2HU2A 5D5QA 1P2BA 1KQOA 2WM8A 1TF7A 2FSIA 2HM7A 2XB6A 3SXJA 1YQXA 3DMDA 1TJYA 4IO0A 3JR3A 3DCNA 1ZIOA 1ZM7A 1DC8A 3KV3O 1UDCA 1CQJB 3IQGX 4PX3A 4U6SA 2PUBA 3WWZA 5DO9A 4J91A 4Q66C 5A5FA 2YS6A 2W93A 1FFXA 3OWXA 3BWDD 3M3PA 5CLQA 4Y2TA 3TM4A 4AS1A 4UVDA 1POWA 1U2GA 3LC2O 4AP9A 1LJ8A 1ZYUA 2PGOA 4FIZA 4MYDA 1LKZA 1M2GA 2GPTA 3QKRA 4OUKX 3UGKA 2PZAA 3ES9A 3F98A 2PZJA 4E4YA 3RYIA 3OQMA 2RHDA 2CY0A 1SC9A 1Z25A 2JGAA 4B4WA 4JELA 2V55B 3PQFA 2NQ8A 1SKUA 3RU7A 1NA5A 4A6PA 4LV6A 4CG0A 4QTXA 4LHEA 4YJ2B 1QIEA 4MVXA 1HSOA 2Z8YA 4Q1VA 3WGQA 5C8YB 3TE6A 1X7WA 1IVSA 2W43A 2LIPA 4JENA 4AIIA 4CMEC 1NFRA 2VJAA 3LUCA 3PQ8A 2G5GX 2K2WA 3LT0A 5I9SA 2V7UA 3M6XA 3GFTA 4HEA6 3RO7A 4RZQA 1RXVA 1IMJA 4CWAA 1KO4A 4DSOA 4GMDA 3ZKWB 3PWTA 3VOSA 1H93A 1U0SY 3MZ0A 5EIHA 5JDCC 5I7SA 2WSMA 5JZBA 3QEBZ 2ZVPX 1N6LA 4CM6A 5IKEA 2GWHA 2DKFA 4MYCA 3E9EA 1F6BA 1EA5A 5EI5A 2MR6A 3LLCA 4ECAA 1V48A 3A4VA 4BLUA 5JADA 3SS7X 2V6FA 2W8ZA 3GLFB 2QXYA 4KUHA 3MOSA 2RARA 1L5RA 4B5LA 2CHVA 4DAOA 3WGVA 1ACJA 5JC8A 3G2KA 2GEDA 5IK2A 1QHFA 2GD2A 2J46A 2Q29A 3EZYA 4KPGA 4R5MA 2E87A 4B71A 2HMYB 3UCXA 4FTWA 5EY5B 2RJ3A 4P5PA 2CK3D 2B9VA 4Q05A 2NZJA 4DT1A 1XZCA 4A2CA 3BD8A 1EUCA 5IJ0B 2P6RA 2XXAA 3AQ4A 1JR3A 1QO0A 4GFDA 4F5WA 4PCUA 1PQPA 2C7BA 4HAWA 3CISA 2YCLA 4JLSA 4D4KA 1O96B 2Z9CA 1HDOA 1E3IA 3JQ9A 5HGXA 3I5XA 2IQIA 3OIUA 4DCVA 2VTVA 2JEZA 3R7LA 1ULSA 3IVCA 2FSSA 4WXHA 2Q8NA 4I50B 4OQFA 2HPAA 2PO5A 3NKLA 1QHHB 2C2ZA 1SUPA 2GRUA 3KTFA 3DAYA 1UXJA 4LZNA 5ADHA 4F1JA 3OPNA 3TEFA 5CNIA 2ZS8A 4P1ZA 1VB3A 3NC0C 3KELA 3ZHZA 4PTYA 4H4EA 2QRZA 5DTQA 1WB4A 3OEHA 3ZCPA 5J58A 3FPLA 3F8SA 1T0PA 3U4GA 3A8TA 3ZGXA 1P72A 3DWEX 3G68A 3TG8A 1NX6A 3JWGA 3SM3A 5CCXA 3TTWA 2BEVA 4E6PA 5HMLA 2XF2A 3QITA 1T5IA 4HAIA 1S3GA 3L0OA 2ZIVB 2R87A 1D2NA 2E3JA 1U9IA 3WYEA 1DAEA 5AUQA 3RYFB 5FWNA 5FTLA 1R4NA 2QN1A 3ICWA 1RU3A 2H5IA 2CZQA 4IJ6A 3ZNQA 3E8MA 1NVUQ 2PWZA 1PEAA 3MT7A 5B6PA 5JSUA 3RGGA 3U4QA 1SN7A 4LOAA 3WK9A 4LRUA 1KYQA 4PAGA 1JYFA 2HJGA 4ENSA 4KWTA 1POXA 2E49A 1KNXA 3UHFA 4P0QB 1W0KA 1FFDA 1FVHA 1YJBA 4JB8A 1NE7A 4U0JA 5KYVA 1SZPA 3OZAA 1NDUA 5JJCA 4WI1A 1KF0A 4HVLA 2EKLA 2JARA 2Z3WA 3BD9A 5FV7A 5EPOA 2VJQA 3Q5EA 4I8XA 4XB1A 5DCLA 1MC8A 2VSXA 4RD2A 3G2JA 4DLVA 4EB6A 2Q1SA 5E2AA 3NVKI 1S1MA 3M1LA 4ZVLA 4DUYB 2NU8B 4D8YA 3OWHA 5HOEA 5JNSA 4AK9A 1DIGA 3W79A 3HSSA 4AJIA 2EJBA 2PUCA 2H65A 1HRKA 1FXSA 2E37A 2F1JA 5CTJA 5IBCA 4RTNA 2ZANA 3DDNA 1FYFA 3CLTD 3N3AC 4FYJA 5BNIA 2CXSA 3WL5A 1LZKA 4G5RA 1E89A 3O0DA 2R96A 3WR5A 3QE3A 3NJRA 4FMPA 2BGRA 2WINI 3DT9A 4IGFA 3H97A 2G9RA 2P3OA 2REBA 4WT7A 3GMDA 1TU0A 4FMDB 3WYCA 4KQ2A 1MX3A 4QARA 4FT2A 4GMKA 1GD1O 4YONB 2XOXA 2QR2A 5I8ZA 1FS4A 2QTFA 5BV2P 1GR1A 2CL0X 1F38A 1CPYA 3CIOA 2PS3A 2VAWA 1QG2A 3JV7A 3FOFC 2H1CA 1RAGA 2QUZA 1J70A 4QOSA 4E5MA 2D0IA 1OWMA 2DHEA 1YNOA 2Z1DA 4G0QA 5CRIA 2J7PA 3UGQA 3LHIA 3DE3X 4JIMA 3UK7A 1DAOA 3L1IA 2A2ZA 2VDMB 4EY5A 1C0KA 5DULA 1RJDA 1T3LA 3I6QA 4K3VA 1SOVA 1XHFA 3KL4A 4HLCA 3T7AA 1ECBA 1OXTA 4YH1A 3C7KA 4WBNF 3CEMA 4L78A 2CNLA 1JI0A 1ONNA 4MQEA 3H19A 5CTAA 5DNEA 4BKPA 2VH5R 5KNDH 3PUKA 1B0ZA 3O38A 4NP6A 3JQ8A 1PV2A 2QM0A 2XEXA 2HH9A 4YAFA 3IAEA 4PNEA 4YRIA 1LC0A 3U4MA 3A10A 3C41J 1NIJA 3M82A 4LPKA 4MR7A 2G1JA 1PEKE 4KLZA 3VQTA 2DWPA 4TRJA 5GONF 3T1NA 1OB2A 2D5AA 1J9EA 2VJMA 4JWTA 5JHHB 2HUNA 5KKCA 4JX9A 2MSKA 3FJYA 2GZSA 5EUCA 3T5DA 3F5QA 1DADA 1H1LA 3R76A 4XFJA 2XMPA 4KITB 5TXGA 3UXYA 2IEGA 5AVZA 2R5NA 3N0WA 3I53A 3CZ4A 4WOPA 1DHRA 3KYBA 3W8EA 3WS7A 3NBZC 2GJ9A 4B8YA 4EKGA 5LQJA 4YUAA 2TRSB 4MUAA 2GN2A 4A73A 3ZNOA 4PZUA 1ZH6A 3RNOA 4FZVA 2WWFA 3SKYA 4QYIA 1PFWA 1FX1A 2J8ZA 4XDZA 2AXQA 2O0MA 2WV7A 2FWMX 2CCGA 1E6MA 2CW5A 2FX3A 2X77A 3EEBA 1VLQA 5DYTA 5TB5A 5JYDA 5AM2A 1TQ6A 3HCOA 3L7YA 3CX4A 2SKCA 2YWFA 5DTMA 3STYA 4CMJA 1JG6A 2JFYA 5EP1A 3QEAZ 1V11B 3Q3GE 5KVVA 4BQFA 1VHJA 4TWZA 5G3YA 2GCEA 1L5KA 1VJ0A 2WJZB 2WOJA 3O8OB 4W4TA 1QRAA 4R71A 4P34A 2H0AA 3JQ7A 3TW8A 1MPXA 2Q5IA 1WS6A 2UDPA 2XWJI 1EFAA 1NVKA 1HKUA 3AHFA 3O4GA 4AN4A 3H9EO 5C31A 1XFDA 3D59A 3WB0A 1NJ2A 2HWKA 1E3WB 2RHRA 3OCJA 5CJPA 3JAWA 4WOKA 1U9CA 3LGXA 1V8ZA 5GV7A 4EM6A 1Q0TA 2H07A 1G8AA 2OYRA 1GKKA 4L95C 3W6PA 2PGNA 2WSSA 1BO6A 4IHJF 1JHQA 4L7VA 3VR2A 1ABFA 5HRUA 5A4IS 1KAOA 3L41A 3KKOA 4Q93A 4MUXA 2D4AA 2UVDA 1E58A 1QUFA 4FFPA 5ALZA 5I3CA 4H7JA 4LF8B 4Q12A 3VJRA 2ZAOA 2P1ZA 3D6HA 1E2FA 2TS1A 4FEAA 4IWNA 4XPIB 2VAPA 2O8VA 1X94A 4ZTBA 1Z83A 4U4AA 1DJNA 2YMMA 4C30A 1EBBA 1HDEA 3VNAA 2GO7A 3LBNA 3RTDA 1P1CA 1UZMA 1YJ8A 1YRBA 1ZXXA 4GPD1 5T5QA 1XDZA 3NYIA 4WJLA 1ADJA 3L3BA 4Q9LA 1GGJA 1C1YA 2K7ZA 3K53A 4N5IX 1PR2A 4OQ4A 3MRVA 4EPTA 4G3XA 2XVYA 2HNAA 1HLPA 2C0PA 3GJXC 5JSFA 3TNFA 4ZIRB 3L6DA 1P1HA 5EKDA 3FNGA 4PLFA 1U8AA 1RAAA 4JSYA 2XPCA 3IV9A 2CHEA 4ZHQB 2XH8A 3ANYB 3FA2A 3AUUA 2WP0A 1ADCA 4KHZA 1VYHA 4KXQA 1SVDM 3IAAA 2Q4BA 3DVSX 5ALRA 2J6HA 3RBVA 2NAPA 2M32A 3IVGA 4BTVA 2HREA 5IVKA 4TS9A 2ADFA 5DDIP 2B83A 3QEMA 2IDZA 1MR3F 1QGAA 2VCYA 2IOQA 1KEEA 3ZZ1A 4MI1A 5IJXA 3FJ1A 2QKYA 1XCOA 2Z04A 3HY3A 4OJKA 4ZQGA 621PA 4QXMA 3EFOA 1ZVMA 1RDFA 3PR2B 4JU9A 4V24A 3UUWA 2BGJA 3QLJA 3I09A 3JY6A 4BLTA 1PVVA 2BMAA 2GAIA 3OPQA 4Q1CA 4PLCA 3U3ZA 1KYXA 3ZNNA 4DQKA 5A5EA 3WYBA 4AUKA 4QUJA 3ZQKA 1GUFA 1DIBA 1F9AA 3GLIE 3BT7A 1JMKC 3CXUA 2H18A 1E9BA 4MAMA 1RQXA 4UNIA 3ROPA 3EIXA 1PJZA 1NP3A 1ZKMA 1Z6PA 2ES4A 1W19A 3I8OA 4J0FA 1Z18A 3ZLVA 1KK2A 3GAFA 3PQ4A 1QIIA 4YDHB 3SKVA 3SSMA 3TR6A 4U7DA 1ORVA 3N2YA 1N9GA 3BIFA 3FIJA 1JU9A 4R8MA 1JPVA 1PNTA 2CNBA 1NURA 2QQEA 1W73A 5ANRB 1ULZA 3QLUC 2ONJA 1WMSA 4N40A 1O58A 1YZYA 1Z5WA 2R7KA 3N0VA 4XRRA 1AGYA 2GJSA 2V03A 3HEMA 4HDNA 4DFDA 1TUEA 5HZKA 2R4QA 4RK0A 4BLVA 5F98A 2W6IA 3E7XA 2O2YA 5AM1A 3UICA 5ALWA 2EU8A 1D6JA 3KD2A 2QAGB 4IKEA 2PIDA 4J4BA 3CFYA 4V1CB 1UC8A 1R66A 4JA0A 4Y67A 1FA9A 3FXAA 1YOBA 5F77A 1NQVA 1CUAA 4M36A 4FC7A 3ZVKA 3FTEA 4K88A 4ZQIA 5ECWA 2B4YA 1PLLA 4KGDA 1W25A 1CERA 1JKIA 4MPDA 2LNDA 3U31A 3UC5A 4DREA 4F6CA 2VQEB 3HJNA 2VHVA 1GQOA 5TMDA 1J4AA 5CHEA 4ZGGA 1WSBA 2EEPA 4BX8A 4BKUA 4DV4B 1GKUB 4PV7A 1NVWQ 3A7DA 3FFTA 1I4LD 2IU3A 4JYCA 4RQUA 4LW8A 2WHEA 1WRBA 3PQDA 2I78A 1QORA 1W96A 3ETEA 4QUIA 3OLYA 5G0TA 3LVBA 1XHLA 3T1VA 2BVNA 3TE7A 4EHFA 2QN8A 1LA2A 4OO3A 3LT4A 1JKJA 2NZYA 3BTOA 4UUNA 4YEDA 3ZHTA 2FDCA 4HNTA 3JVDA 1W2GA 2WHPA 1T4MA 1FFAA 3G7SA 4I4IA 1P31A 3RS3A 2YZKA 1R0WA 3KEFA 4LQDA 1JB1A 2HUPA 2R8OA 4UBKA 4DNFA 1AN0A 3N2KB 3C4VA 2CV2A 4LRWA 2BHTA 3FOCA 2WQZA 1KKLA 1N2EA 1C4OA 1OWNA 3O4JA 3OPYB 1S0UA 1U3UA 2ZRMA 3E1GA 3EYWA 3MCUA 3MCVA 1TYZA 1OTHA 4AMBA 3WWYA 5IJ9A 2QQGA 1GL9B 5MN6A 4L57A 3VYTB 3G0HA 1SU6A 5K3SA 4ALJA 3LAWA 3KKQA 5FOSA 1PE0A 3LA6A 1E1QD 1O57A 4I14A 4WCVA 4D0SA 1MPTA 3M2TA 2W2LA 1Y98A 3TSZA 3IUEA 2MSEB 1JEAA 4R2MA 1L5YA 1FMFA 3HVHA 3KOUA 5CURA 2C5EA 2B78A 1GV0A 1F14A 3AB3A 5DXJA 3HN6A 2DMRA 1TQHA 3TSOA 5HIMA 4KXXA 1XZDA 4CV3A 4NU5A 5CBKA 3OCZA 4TM7A 2C59A 2MSDB 2YHSA 4M0KA 1K4YA 3GO4A 4MGHA 3OHSX 3PF9A 3U49A 4BP3A 1H0SA 4KXWA 5JAQA 4AB1A 4F93B 4KR9A 3C74A 1Z6TA 2Y0BA 3QY9A 2FI1A 2EQAA 3FE2A 4B17A 4B74A 5COQA 3TAUA 1A7AA 3H84A 2IKSA 4BECA 1DAKA 4J2TA 1RLDS 1E77A 3EIUA 4Y2VA 3NTQA 2O3JA 3IDZA 4OAPA 1M6HA 3KT6A 4QOHA 4KR7A 4MEJA 2GN6A 1UBSB 4P31A 3BS4A 2HDNB 4DLPA 3QPAA 1IHUA 4II3A 4J6EA 2Z8ZA 5EMLA 2A84A 1SR8A 1QSGA 1ULBA 2ASEA 1E1MA 3TD9A 4E4TA 5AHRA 2J9YB 2X8JA 3AEQB 3EPKA 4E5VA 4QXPA 3S7ZA 1HE1C 1XRLA 4WFIA 5CT4A 5JO0A 2VN8A 1MAWA 1Z5GA 4ECEA 2CSUA 4J75A 3TZEA 1BDIA 1U3CA 4AJ2A 4JSRA 1Z4JA 1JXMA 3FCEA 1IWPB 2QP4A 2J3MA 1L7QA 4ZZ2A 1HBJA 3U7GA 2QVBA 4JOBA 1DT3A 2Y1GA 4ZOCA 3U7EB 1R5OA 1VKZA 2BGIA 2L18A 2RGWA 5ADWA 5I01A 5ETJA 3RFFA 2V7PA 2WOOA 1YFKA 3LPNA 4MI3A 4C29A 2DXIA 3IMCA 2CF5A 3NG1A 3PQ5A 4O25A 3A6HA 4Z86A 3HN7A 5T3YA 2CK3A 4RVSA 1K6IA 2KI5A 2A94A 1MD9A 2Q1UA 3VDRA 4I1IA 4OPMA 2A3NA 3WK4A 4EQZA 3T9FA 1XZNA 1YS6A 2RFLA 1QZTA 2H2AA 4Q1EA 1S2GA 4Q9NA 3A2KA 2IFTA 1CRPA 1G4AE 2VF5X 1E4EB 2ZI6A 4QYWA 3BILA 2FPSA 2VYCA 4FOTA 4WWHA 4Q7LA 3TLEA 1XF1A 1OGYA 1PDWA 4RXMA 3I34X 3VGPA 1KI2A 4L9WA 3ADDA 1GFZA 1RXEA 1E9DA 1HDZA 3AOEA 3FPHA 4M1SA 4CKBB 4DVJA 4WKCA 4M49A 2ALJA 1QCYA 1XSEA 3INTA 4KODA 5ILQA 4R2KA 3DAPA 5TVKA 3Q5DA 1PLJA 3LQ2A 4TMYA 3K9GA 1FFSA 2PQ2A 2IS6A 2VP3A 4PQYA 2OM6A 1KQ3A 4KZPA 1AF4A 3DHYA 4QDZA 2XUHA 1P77A 3MA0A 2LUOA 1WR8A 3PXDA 4CQLB 3RFXA 2Q3BA 2CXQA 2VRCD 4DPMA 3KCQA 1FP4B 4YUVA 1ND5A 2MYPA 3PE4A 4H1TA 3PIDA 3RE1A 4F0HB 2OPBA 4LXGA 4MIKA 2JKZA 2CXUA 2ZRQA 1P81A 1AB6A 2GAAA 2NYAA 3KTAB 4UXHA 4OMCA 4Y6PA 3REGA 3I4CA 3L02A 4IJWA 3NDIA 5REQB 2NPOA 3N6XA 1WBJB 1WDWB 3QWAA 1YQEA 1TKCA 4HNQA 4D1YA 2B7CA 4KWEA 1GU0A 3DAHA 1ZOSA 2IBMA 3AEKB 4M8KA 3BOSA 5A4FS 4UTNA 3B3FA 3LF2A 2VP2A 3B78A 3I76A 1X39A 1A98A 1UPUA 4NOMA 2GCNA 3PZBA 1L7MA 1QP7A 4Y2PA 3E5MA 1SGWA 2Y4NA 3BXHA 4FILA 4BWYA 5AVYA 3L7AA 2OLJA 4CI0B 2XCRB 1MF7A 3DLIA 4ONEA 4CKCA 3ID6C 4EYGA 1TYCA 1U1FA 1SBTA 5EOVA 3W9BA 3LG2A 3PUXA 5KNLA 3QNUA 3JARA 3KFXA 5E2IA 1SA0B 4OHVA 4YAGA 3CNNA 1NR1A 3W05A 1AS0A 5A1TA 5CB4F 2FPMA 5EZ5A 1OKKD 2HQ1A 1DTSA 3EY9A 3MGCA 3CNQS 4UDOA 4J7UA 2LDXA 1GVHA 1NL3A 5KI6A 1GCUA 1HL3A 2GMWA 5HJ2A 4B0PA 3PB3A 1R9NA 2OC9A 2PWBA 1JW9B 3WHKA 4DDHA 4UCQA 5ITWA 3UV7A 3F7TA 4RNCA 4IFEA 3ZYCA 1GKIA 1J39A 3M1AA 3RHTA 1VA4A 5E1BA 1P18A 4BVEA 3GLFE 2GZ3A 2YMPA 1MXFA 1N0IA 1C30B 1UJ4A 1N5OX 2V58A 3O95A 2VR1A 4LYYA 4DMLA 3IJRA 3LY5A 4FLEA 3KAJA 3QIVA 3AI2A 1N7JA 3V9AA 1MIOB 1CDOA 1YL5A 2QX4A 2OAP1 2DQSA 2GYYA 4JY7A 1ZJZA 3AMVA 3EDMA 3OE1A 3E7WA 4X0EA 4DAEA 2P9QA 2Y05A 3DDOA 2KLHA 3UH0A 4UC0A 1KVQA 3NRBA 5A6SA 4DLUA 4WBNA 1ZCAA 2WK1A 1K8YB 1I7PA 3WA6A 4AQYB 1VCOA 2JBWA 3N0TA 4IDDA 4QDTA 4AM8A 4B3DA 1J2UA 1BXZA 1YZVA 3UMGA 1SRRA 1U3TA 1XRQA 1YDEA 4TLEA 2OAEA 1WHTB 2A4MA 3G5TA 5TMEA 4Z2AA 1JGTA 1J7KA 1WD5A 3IDAA 5GONA 3RADC 2IP2A 3TI7A 5JISA 1EA7A 4Q3LA 4HPXB 2UVPA 4HX2A 3W2FA 2G0NA 3UATA 4K8RB 2ODEA 1JKFA 4PGMA 2M2IA 1JIQA 4TL7A 5C46F 2ORIA 3NVMB 3OFJA 4TT3A 4MGEA 3KLBA 3L2OB 3NTLA 1Y6RA 1OX4B 2ZJ7A 3S28A 3HB7A 4E88A 1R4AA 3K5PA 1Q2UA 4XUEA 4ITUA 4XOUA 3OAAD 3AY6A 1OXUA 1TYDE 1KGSA 1QNFA 1TAQA 4WZBA 9ATCA 4LSWA 1FMLA 4QDOA 4CM4A 5GMOA 1LI5A 4CYMA 3PL1A 4LFBB 2CLSA 3A9RA 1LH0A 2G71A 1PR5A 1ZMTA 5LNK1 1HTWA 5LMZA 1G41A 2I9PA 2HA3A 5DI3B 1UBLS 1O2DA 4PZLA 4N5HX 2IH5A 2R11A 1KYWA 2CNNA 3DV9A 3GZNB 1RWPA 2DSTA 5G1NA 1NULA 4PS0A 3FPEA 3WNCA 1UBRS 3CBGA 1G64A 4P7FA 3R5KA 3TX6A 2WWRA 4KQ9A 2Q3FA 1QP4A 1BX0A 4ZT4A 4HNUA 4YASA 5AUPB 3DT8A 4QTZA 3SQMA 5DLPA 4TMWA 5GVSA 2B34A 4CMBA 4N48A 1FYVA 4CV2A 2AB0A 2ZI4A 1P9NA 1NXVA 3L7BA 3B1WA 3DW3X 2ONZA 4ASUD 4I4NA 4CDNA 1B41A 1VLLA 5ENDA 4LKOA 1NVAA 121PA 4X63A 2CMDA 3BB3A 4IDNA 1L9KA 3AUAA 5I7WA 4MVJP 2D1YA 3IPLA 3CGWA 4R1UA 3KOYA 1VIVA 4WCFA 4JT8A 4KUEA 2C1ZA 2P5TB 10MHA 3M70A 3QJYA 3VYUB 2JAOA 2EBWA 3JQGA 3U7JA 3DVLA 1XYVA 5BWCA 3TZQA 1KRXA 1DG1G 3GAZA 3PHBE 3R24A 4JDUA 3EEFA 3BIJA 1Y37A 3OOJA 1E3TA 3K0AB 2OVBA 4E08A 1BCRA 1TM5E 3QXGA 4R05A 4DC1A 3FRHA 3AKDA 4OL0A 4F97A 5I48A 2Q5FA 4QT0A 4UE2A 3FZNA 3WDSA 3I92A 2AK3A 1LDNA 4YIHA 1IN8A 2OHOA 3RJMA 1JHDA 1DKOA 4TMKA 4HYQA 3KZ1E 4JMPA 2WB4A 3P0JA 4JUFA 1A27A 3GVXA 1IXYA 3LP6A 4M1YA 4RYLA 2B1GA 3I9LA 3HJFA 3LKBA 3AESA 3NHKA 3RRZA 1UM9A 3P9RA 3PFIA 3WBBA 1H2XA 1MOQA 2W2QA 1MOZA 2CXOA 3HSYA 4K6OA 4NVRA 3SYKA 1P7ZA 3HXOA 4JOSA 4H7IA 1VE7A 4DHWA 5KPDA 1UDBA 3QVSA 3EBPA 4B32A 2D0OB 4NMMA 5J63A 1UKCA 2P1DA 4ZV4A 4OSOA 3ZK8A 3O5AA 2QNBA 4G1EB 4MQBA 4WXRA 4U2GA 3QOFA 3V4FA 2OZKA 3L4KA 1L2TA 3L8DA 4O0LA 2R66A 2BRUC 3LUJA 4I1YA 4U7HA 1Y81A 1ZR4A 1YZTA 1R10A 4GICA 4POAA 2NNLD 3LJKA 3X1XA 1PZHA 2BFBA 1MVNA 4YMUA 3QA9A 3HXPA 2DEUA 2WABA 3D7LA 2PYIA 1FP6A 1KVRA 4UBJA 3N2GA 1OAOC 2QU8A 4BFWA 4C4YA 1K4KA 3H04A 2QSYA 3BQNB 4ZU3A 1BH2A 5EP4A 1PF7E 2C8KA 4Y6SA 3SR3A 3COVA 3A28A 1T6YA 2QQ5A 3WGNA 2V3VA 1PYOA 3R5TA 2IYSA 3K7EA 1NBHA 1Q1GA 2N42A 1JIVA 4FE3A 4EDFA 3U13A 3WHLA 1UANA 1EWTA 6CHYA 2PM8A 5LBUA 5I45A 3B9RA 3ZN2A 3TKYA 3D1JA 1K2WA 4BPRA 4W5OA 2FP4B 2ZBUA 3HJTA 2I7TA 1A8QA 3GEEA 3HCNA 4REMA 2F67A 3FPFA 3VR5A 4OHRA 4DLXA 1IBCA 5JYEA 1GA6A 2FKNA 1K06A 1E9VA 1KC1A 2EKZA 4Y0AA 3SU8A 2RJNA 3PKIA 1LRJA 1E5LA 4PO1A 7REQB 1WPXA 1JJBA 2ZWMA 1RQ2A 4MMXB 1NMEA 2EP8A 4IZOA 4MKVS 2BJWA 2V7QD 3BN3A 2W6JA 3K96A 2VJBA 4HQ6A 4UJ3A 5EZYB 3UIEA 1BG6A 3C97A 5T57A 4BMCA 1JTEA 4WBXC 3AEXA 4AURA 3RWOA 2IYYA 1SU8A 4KFSA 5CDTA 4L4ZA 3BGDA 3W8NA 3EDQA 4KMSA 2V5AA 3G3EA 2PNJA 1IL0A 2ATCA 3NVAA 4ZEWA