1ZHOA

The structure of a ribosomal protein l1 in complex with mrna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the interaction of ribosomal protein L1 with RNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein/rna
molecule keywords mRNA
total genus 56
structure length 228
sequence length 228
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 1zhoA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zhoA02
4QGBA 3ZQJA 3U4MA 1AD2A 4REOA 1ZHOA 4QVIA 1CJSA 3U56A 4DFCB 3UMYA 1MZPA 1DWUA 3FPNA 5DM60 5DM70 4F9TA 2HW8A 3QOYA 4LQ4A 1I2AA 4QG3A 1U63A 3TG8A
chains in the Genus database with same CATH superfamily
3BILA 3DCYA 4AZ0A 4F45A 5CAEB 3TBKA 1DKMA 1KZ1A 3QG1A 1JFFA 1RT9A 3GRKA 2GD2A 4DIFA 2CB0A 1JIXA 4MSUA 2YXBA 2AJ8A 2ISQA 1RKBA 4NE7A 5CGQB 1SCBA 3SM3A 3EPJA 2R4UA 1NE2A 2PD6A 3D7LA 3KR9A 3ZY4A 1CT9A 2NV2B 3I23A 2CBZA 3AONB 2RSLA 3TLJA 1YZKA 1C29B 1TM5E 1E2GA 1LLUA 3BUSA 4LY3A 5LSAA 1UXIA 1YQGA 5K0ZA 5L53A 1HNXB 2Q5OA 3IAS6 1VGVA 4QXMA 3ZV7A 1NURA 5FI3A 5HFNA 4HQRA 3UTCA 1K88A 3O9VA 4NBWA 1ULTA 1G9XA 2G5PA 2WJIA 3UTDA 2P1RA 3UMSA 5FAKA 1L1QA 4RSHA 1X92A 4C9BA 1FRNA 1UIRA 4O2RA 3TVYA 3ZR4B 2JJQA 4PF1A 3TL6A 1YGPA 2DH6A 2QQFA 4G1UC 1ZMTA 2AN9A 3L0BA 4FWBA 4PC1A 4UC0A 1QHYA 1XCJA 2IOFK 3JYLA 3ZDEA 4D3FA 2XZOA 3N2EA 1E5QA 3CONA 1VLVA 1K92A 3LWBA 1D1SA 1R37A 4WJKB 4MV7A 2NGRA 1QIKA 1T2AA 1ZICA 4CM1A 2PRKA 2ZUCA 1MQ8B 1F06A 2NADA 2OB1A 5IK2D 1LNSA 2A67A 3PLRA 3PUIA 3B82A 3FPSA 1I7NA 3PU6A 4R1QA 5F2EA 4MUFA 5DEIA 2Q5HA 3DJYA 3DNMA 4IV0A 3O7MA 2PRYA 5DP2A 4NV0A 5F2KA 3NKLA 4Z3DA 1J4AA 1VFNA 5ALEA 2W70A 4EITA 3KHKA 3NKVA 2B1GA 3UVEA 2ZPTX 4BO8A 3THYB 1GLGA 2OXFA 4DRYA 4DUGD 1XA4A 3PWTA 2Y9MB 4ZJPA 4RK1A 1AF7A 1H9AA 4YIHA 1PS8A 1U2DC 4WBNF 4PLGA 4B4VA 1PNVA 1E0KA 2MINA 4GGOA 1ZIYA 3AL0C 1CJVC 1XTTA 4IDGA 4QBIA 2BFAA 3K5PA 3O4JA 3Q41A 4O1HA 1NQUA 2CHEA 1O7JA 2H1IA 2PT5A 4FZ3A 1SQ6A 4HBZA 5IVDA 3HBFA 4B3RB 5KDOA 3WVNA 3VR5D 3T52A 3U3ZA 1E5LA 2FGJA 4BV9A 4OHFA 4J0HA 5DWVA 4XWAA 1U6IA 3KOWA 3QU9A 4ZEVA 2BGGA 4CF4A 3T1OA 2V0NA 5FV4A 4DR1B 6ADHA 3HR8A 3UOWA 1QVAA 2B82A 2QL6A 2ZR0A 2JA2A 2PBFA 3HVUA 5K0SA 2QUKA 2XE6A 3IAHA 3MTIA 2V5VA 2VG8A 1T5BA 3TKAA 1QE5A 3EVCA 3UG7A 5KYGA 1LWNA 1XDDA 2MYTA 2OHJA 2I4IA 3B7GA 1MX5A 3EISA 3TUJC 1GL9B 2KPOA 5FO1A 2JCXA 3K0KA 5BQ3A 4K28A 2FFRA 3AEZA 2XH8A 2VYFA 3A27A 3CGGA 3NTLA 4RJ2A 1VLHA 2W6JA 4YACA 3UH1A 3MK31 5TGDA 4MKFA 1A9XB 5JD4A 4CDRA 4NAUA 1E1KA 1EWKA 1QONA 1Q3TA 3J7TA 4EW1A 1CG6A 1TW2A 4MQ6A 5KQLA 4RF4A 5AVVA 1M6WA 1V95A 1EA5A 3STYA 1E3LA 1N1MA 2HYDA 5FUQA 2O2HA 3I5XA 1F0YA 1YR7A 3SC2B 1AGRA 4CLRB 2V5UA 3G85A 2GNOA 2H1FA 3ILSA 4Z9BA 2OESA 3CQ9A 5DTRA 5TARA 2IC5A 2NQ2C 4URWR 4JUBA 3W5UA 4DLLA 4RFVA 5IBPA 4RNDB 4UFPA 3ZY6A 3UMYA 5IJWA 1QKIA 2IF0A 3KAQA 3Q8LA 3L8DA 1YRYE 3T5MA 1S4MA 2VC2B 4LRQA 4W6QA 1BD3A 3VV2A 1LPOA 1OA1A 5B2EA 1TU4A 1JB9A 3DP9A 2CDRA 3NYWA 1I6MA 2IW3A 3DGEC 3EBOA 3OZUA 4IM7A 5HKLA 5BUCA 5FFNA 1KETA 2RHTA 2NPIA 4QASA 1DIOB 1J5EB 1UFKA 1TAHA 1C8LA 3IPXA 3P4XA 3U40A 2L17A 2RHOA 4PNZA 4MV0A 2P5TB 4QT0A 5ALQA 1XF1A 5K8IA 4FJ0A 4O6VA 2JD0A 4HQNA 4UBOA 2DLDA 4FSXA 2P6MA 3WNQA 2I3ZA 3OCUA 5FOVA 2JAXA 4RETA 3GGGA 2D74A 1J9GA 4G1EB 1P5FA 1N3IA 5IF9A 3PDHA 4AY2A 4GR9A 2W93A 3KE8A 5KYKA 2PZJA 4S04A 3V2GA 1WO8A 1MXFA 3A1TA 1G9SA 4KXYA 1S0UA 3AXTA 3HWWA 3L5KA 2AG6A 1QK3A 2IEGA 3E7WA 1I3LA 2I6QA 4L6CA 2C78A 2E87A 1P1HA 4GP6A 1N6PA 5DV9A 5J2TF 2O3TA 3RS3A 2PL5A 2PANA 4HMPA 4HZUB 3K6KA 4L16A 1H5NA 2VPXA 1OCEA 3KR2A 1EESA 1D6JA 3QFFA 2X1HA 5LYJF 4D0GA 1U0NA 3QIAA 1BS1A 2EFCB 5FUWA 2REQB 3DB1A 3EVBA 4GVXA 3ZYCA 4ASUA 5A0TA 2AEJA 3RYCA 2O8FA 2QVBA 1UCFA 4MWOA 2F3QA 2FW6A 2RAFA 4B47A 1G20A 4O2BF 5CNIA 1CJCA 3IHWA 3DLHA 4O29A 3T5DA 5LBIA 3IQEA 4QLBA 1AO0A 3GJZA 1A4UA 2QQ5A 2EQBA 3JQGB 1M2HA 1OPXA 4HI0E 4LDJA 2COKA 2PG3A 3PUXA 2E49A 3TLZA 5JAUA 4NYMR 1R1DA 5AIAA 2OCXA 5BNWA 2PR2A 2DPYA 4M53A 4EK9A 3A4TA 1UZNA 3EZ6A 2IS2A 2P2YA 1PR5A 2APJA 3ZOKA 4C0HA 2DY0A 1XPRA 4MW5A 2XMSA 1P44A 1GQOA 4FYIA 3QPWA 1JP7A 1EFTA 1NQXA 1E4EB 3ZHQA 4EG4A 4OMFG 1UPPI 3BK1A 4NOLA 1XF9A 2HA2A 2VCEA 3A1DA 4DLPA 3N0VA 4KOAA 4FFBA 4JBGA 5TMDA 3ETLA 3TZCA 1V26A 3IESA 1PQWA 4F6CA 3UMMA 1U99A 3C3DA 2XIJA 4TT3D 1Z08A 3CS3A 1BDJA 4GXTA 4RVOA 1QIJA 1ZLYA 3S6JA 1FYEA 3B1FA 4EY8A 4RXMA 1UQTA 5BW6B 3ADKA 2IELA 1NSFA 4J0IA 5KQGA 4DJDC 1G63A 3VRHA 5IXJA 4N9QA 5LXTB 2EYQA 4LBWA 2VEDA 2FZWA 3DWIA 4BOYA 5ICFA 1H8HD 3LX8A 1Z0IA 2JHCA 4JNCA 3L6CA 2AQ8A 1QAMA 3D4LA 4BO4A 1Q77A 4BVLA 1FZTA 4QGBA 2WHEA 1T4GA 1O95C 5C1DA 1PK8A 2EJVA 4GT1A 4O02B 1W19A 3PQ6A 4YN3A 1NDHA 1G20E 3LJKA 4ZPJA 4M1EA 3DEIA 4IQ4A 2IUFA 1JL3A 1KHTA 1RQRA 2F17A 2L69A 3CRW1 3A4YA 3ZUPA 1OLXA 1VB5A 3GMSA 4RVHA 5FWNA 3MTEA 4OQQA 4YYZA 3GVXA 3KAJA 3TMAA 5AOVA 5BRNA 3UWOA 2BH2A 4Q05A 3QYFA 4YH1A 1P2GA 1T6ZA 2EAUA 1CE8A 3NFRA 3VNBA 3MMPA 4L5CA 1XAGA 2JJYA 1OWPA 3RU9A 4UHFA 4EKNB 1G2PA 1BE1A 1SUDA 5CNKA 2ZRKA 3KZCA 3R0JA 3MOSA 4FMCB 1OH8A 1RJ9B 2GF0A 4NBSA 5BMVF 1U1DA 4G3XA 3HO1A 1Q5PA 1XZCA 2I33A 1NUPA 2PZAA 3TM4A 5JDIA 3VOAA 3S0JA 3HBAA 4P58A 5JWOA 3ZDRA 2PMBA 3RHTA 3VNQA 1KJ9A 1TC1A 2OGZA 2XA2A 5GV8A 4YDSA 1CETA 3TQFA 4QAJA 1PD0A 3RHZA 3WLPA 2GPBA 1HQCA 2YHAA 3A58B 4JUCA 2XTZA 4LN1A 4LZZA 3RTGA 3T7SA 3T9CA 2M32A 3TD9A 3VR5H 2X5JO 4DHWA 2ZCJA 2PBLA 5B55A 1GTSA 4ENWA 5JISA 1FFYA 3PGA1 1CDOA 2CMDA 4KN6A 2G0NA 1AO3A 4D5GA 1J8VA 2X0IA 3UMJA 3WA7A 5ER9A 1E69A 4D92A 3BWBA 2QRNA 3OQPA 3W78A 1QH8B 4KH1A 1XP8A 2X6RA 4OP2A 3AM5A 1MOZA 2HRQA 3SZLA 2PX6A 1SUAA 2G8LA 2ZSUA 3FNQA 4LMRA 4AZ0B 1MCZA 3W2EA 1O87A 3DZHA 3TR6A 1M2WA 4JHXA 2WWXA 1GG8A 3D6JA 3FRHA 3FDZB 3CX3A 1J0EA 3AOEA 5I45A 2ZYUX 5T4HA 4DCJA 1TJ5A 3N0XA 3NHBA 1KP3A 1MT0A 1U1CA 3TINA 2C8KA 1VE6A 4TRNA 5HRCA 2YV5A 3KQKA 4HH4A 1U8UA 3KIPA 1GRNA 5H70A 4WESB 3RJZA 2ZBPA 4KQKA 2DTXA 3VXKA 3I64A 3AUXA 2VHTA 2FN9A 3R4VA 1YRHA 2VAPA 1GFSA 2XX3A 3B9BA 1T1RA 2AK3A 5ECDA 3PQ2A 4KODA 2HXGA 3D8SA 4JV5B 1RACA 2I54A 3JW8A 3LF1A 4IJVA 4HEJA 4OLFA 1RCTE 4KR9A 1G66A 1MW8X 3CPJB 3ZHRA 2WJ6A 5JI3E 4TYWA 1E1MA 5JU6A 5CW2A 1U2TA 1ECBA 5J2TA 1V0JA 2ZLBA 2DPMA 2W2VA 3P94A 3C1OA 3RRBA 4CM3A 5MN6A 2UZ1A 2V3VA 1EINA 4E2XA 3LT0A 5CLIA 3H2BA 1W5BA 1CQIA 1CNFA 3I8OA 2GDJA 3KB8A 4PV7A 4TZTA 3GQBB 5ALHA 5FRDA 3WLKX 4HDMA 1N6OA 1SO8A 1NBEA 1YFZA 4LHWA 5KAMA 4NYJQ 5HNKA 1I4OA 3LNTA 3TNFA 1HNNA 1JA1A 4KBYA 4J3JA 1HGXA 2Y76A 1N2GA 3P2KA 5ECWA 1XRLA 3WDSA 2UZ4A 4OGFA 2QTLA 3S2IA 3SFZA 3A3KA 3FUWA 5PGMA 1XMIA 3CRZA 4CIYA 4U5QA 1P4SA 3SC6A 2V9CA 1A3CA 1FNNA 3BIXA 1Z0FA 1KOGA 3H19A 3EGDA 2FPGB 5BNIA 1AA1C 1DV1A 2XSZA 4HXGA 1ML4A 3DDZX 3OZXA 4L6IA 4TV8A 3DZCA 2FR8A 3PRHA 3DAOA 1HQDA 1H0RA 1H0HA 3TJRA 2D0IA 2HLPA 4OSPA 3E5RA 3QA3E 5E7IA 4JELA 5ALTA 1H1LA 3W4IA 3VJMA 5LN1A 3KTDA 4FDAA 2H5LA 3JD1A 1P0IA 1WXEA 1RPTA 1ICIA 3B53X 3LT4A 4BNTA 2Z04A 3GNTA 1PHRA 1QK5A 4EYEA 1NJSA 1W49A 5I8WA 4MQEA 1P0CA 9GPBA 3IH5A 1U0TA 1F8GA 1WDTA 5IXSA 5CJPA 4MDFA 1X8KA 4P53A 5EMNA 4O5OA 3GT3A 3WK9A 4KYVA 2NQTA 4KUGA 2IW1A 1BAPA 1IEQA 2J5KA 4M0DA 1XMOB 4ENSA 1QIIA 5KCMA 3JXEA 1HYGA 4GP9A 5LUAA 3CW8X 6REQB 1XEXA 5KHLB 4J1SA 4AYXA 2XOKA 2GLXA 2AZ4A 5C4GB 5GVSA 3KD3A 2RE8A 3U60B 1P7VA 1Z8NA 4NI5A 5F7OA 1DBQA 2V7UA 1DAFA 2YY7A 3RFFA 5JO0A 2GN1A 1RBMA 4K9SA 4YFVA 3U81A 4TGLA 2FOIA 5K05A 1AHIA 1JR3D 4JSYA 2VJLA 3L1UA 3MBKA 4L78A 2EJBA 4S1VA 4TXNA 4ZOAA 5FNVA 3RVNA 1O6BA 3TKLA 4ZDIA 1BDBA 2P40A 2VTEA 2ZTLA 5TXGA 2PMWB 3KPVA 1U1EA 1L5NA 5IZ4A 1D6SA 3H9EO 1ZN9A 1KZ9A 4HR7A 1XO1A 4PO1A 4DCSA 4KO1S 1OKKD 1JFSA 2R8XA 3AKEA 4HN2A 3ADDA 1G8FA 2CVQA 1WJGA 3HB0A 4J7XA 4EKEA 3QHQA 1AY0A 1NJ2A 1J23A 2X4GA 4G5HA 4YRTA 3FZEA 4INZA 4OO3A 1QGAA 1PJ8A 1PNQA 3QUCA 5FLEX 5L4LA 5AYVA 4B31A 1BCSA 3ESBA 2WA1A 3RS5A 1AKRA 3COJA 3U56A 3QU7A 4X3OA 3OKAA 2Y1EA 4H60A 5K6RA 1UBUS 1FQJA 2DZDA 2AC7A 2PWYA 2WE7A 1PZXA 4OQYA 1CPYA 3A28A 4JT9A 4ZCRA 2XHZA 3L1HA 2IPAB 4R16A 3I52A 1F8YA 2A5DA 1ZRMA 4MVJP 3HP4A 2XGGA 1HBJA 1NGSA 4DYVA 2HWKA 2NXJA 3M6WA 4AG5A 4Z3KA 5FLYA 1T4DA 3CLRC 3F46A 1QE3A 2VS1A 3QENA 4MUGA 5IVPA 4XRRA 3SVLA 1Y7PA 1NYTA 4J0KA 4B74A 3CVYA 4V3BA 3QRWA 1H3NA 4MS1A 3RSOA 4BZPA 3OZGA 5EE1A 3OQMA 3UFXB 5EWJA 1BHQ1 4W82A 1QG2A 4EFNA 1RJFA 5BW5A 1M0EA 2IS6A 5G4LA 4I46A 2AFHB 2FZVA 3UQZA 5AVWA 2C2MA 1CIJA 1FNDA 1W76A 1JQKA 3DKPA 3LUAA 3I05A 1WDLA 2EEZA 1RHQA 5DIFA 2PQ0A 1GAEO 2NZJA 3BGIA 2C7OA 2LE0A 3ZLUA 4EPYA 3UOGA 3AEUB 5IJZA 4F0MB 3KETA 4P4UA 2X42A 5JQGF 3ANXA 2H9AA 5AJXA 1CFJA 1GSOA 2FKAA 1RZ3A 2WIBA 5AICA 1MTZA 3TNJA 2C2ZA 3DFFA 5JRJA 4XD2A 1AKEA 4DHEA 1GWNA 5U1PA 1YDGA 2R8BA 2JLSA 1KI7A 2Y3IA 2Q0SA 2QTVA 3AUFA 1TVMA 4NYIR 1VHTA 4G97A 2ZE5A 4FNOA 4F46A 4WFKA 1ZC3A 2CCJA 3SLKA 4TKUB 3EF1A 2BTQA 2JK1A 4OP1A 3LSTA 4U6NA 4HX2A 1F7UA 4ZJZA 2QRQA 5JJIA 1TM2A 4CNBA 2ET6A 4A6XA 1TT7A 2G0AA 5DF1A 2WHPA 4K6MA 5CCBA 2W2MA 4DXHA 1THMA 2IHKA 3EQ7A 3G82C 4XSHA 4WN3A 1CSEE 2MYNA 3OTGA 3IBFA 4ISBA 4IOKA 4LIPD 1OAKA 2CLLB 2WVJA 4FYXA 4IZHA 4R05A 3C7TA 3VFDA 3AHFA 1WXDA 2VA8A 2ZULA 2WUFA 3C87A 1NF3A 5LDHA 2L2QA 1P0QA 2FN3A 1E3EA 3N0WA 4ZHQB 4C4OA 1OASA 2X14A 1JH9A 1MAAA 2X5OA 3Q10A 1NVMB 4YJ3A 5B36A 1QP4A 5TR9A 1NBHA 1UZLA 1IZ9A 1CJBA 4GPEA 3BG5A 2O8DB 4GSKA 1ZRSA 2FCAA 3K70D 4MI1A 3K0AB 4V3CA 3CKLA 1CUZA 1ZZEA 4ILKA 4FQ7A 4ZRMA 4AWAA 3CRVA 5AW3A 1CUWA 1JA9A 1Z74A 4EY6A 5KTOA 3HR7A 2B8WA 1QGOA 4IV5A 5BT9A 4JI4B 3I30X 2GF2A 2P67A 4RK6A 4C4PA 1E1DA 4NDNE 4QU5A 3WGNA 1HPLA 5DHQA 4TMYA 3U4HA 3C3AA 2ZPUA 1M2VA 2VYND 4L75A 2YXDA 3MSCA 2AL7A 1IMJA 3AL2A 4ALMA 2B94A 1GTVA 3PDCA 1SHLA 5F1KA 3SBDA 4EYQA 1G98A 3PGLA 2BGMA 4DC9A 2BCGY 4XVRA 2EKBA 1E3IA 1G60A 3OJWA 2D00A 2IWRA 3NPMA 2R48A 4R2KA 3ABRB 4WZZA 1UF9A 5JCOC 2GMWA 3U3RA 4DLRA 5A9SA 4ITRC 1YVUA 4OKIA 1RRGA 1XWWA 3WIEA 2HHAA 4CCSA 4JK3A 4FI3C 4U7FA 2ZJZA 2R751 3N05A 1S8AA 2WTMA 3FSEA 2EP7A 1K3FA 2ZQ5A 1E1CA 1Y98A 2D2VA 3N5KA 1ZOPA 2DOKA 3HUFA 4GLFA 4B3GA 4BWVA 4B40A 4CTJA 4N5IX 4ZK6A 1TT5A 4B73A 4H3VA 3HR4A 2LPMA 3ORFA 3WGVA 1MEEA 2LDXA 4OSEA 4AICA 1C4WA 4WXYB 1V3UA 5CM9C 5DTMA 1GNPA 4E6EA 4EA7A 2I65A 1SU6A 1N25A 1W96A 1J09A 1R0WA 2PJZA 1GOTA 1UJCA 4YVFA 4JHLA 1W36D 2G72A 2GCIA 5MN5A 1Q7CA 3OJEA 5TVGA 1E58A 4IIUA 4HH0A 2PEYA 4KLAA 5TT1A 3IEXA 3QLJA 3L7DA 1HWYA 1KS2A 3SHFA 2IVFA 2ZAOA 3OOJA 1K8YB 3LWZA 1L4GA 4ONEA 1CZRA 5KNLA 2VDLB 3LUKA 5EEHA 2W22A 4IR7A 3S8YA 2H4WA 5BR1A 3DCIA 1T2UA 2OO3A 3IAUA 3WRVA 3BGDA 3X2EA 2V9PA 3V4VB 1M2NA 2QP4A 3VH1A 2OCPA 4R9SA 1T0BA 2UXBB 2ZR7A 1JU4A 2PUCA 1DB3A 4HL6A 3HEBA 1CY6A 4D9JA 3FMGA 3P26A 1C1DB 2FX3A 2ZSJA 4DBZA 1U3GA 3ELDA 4R41A 1JLLB 4DVGA 2I67A 4CF7A 4EI9A 1C8KA 1SKQA 3SC4A 5TEVA 5A3QA 1P4JA 1BKSB 5BW8A 2HCFA 1KNQA 4J9UE 4ZAWA 3O8OA 1EVJA 5CD1A 4EZIA 1HTTA 3TW4A 2YVQA 4OAPA 1TEZA 3IMCA 3IQGX 5EJIA 3CYFA 4ZV4A 5FCDA 4UOZA 5JYDA 1BJRE 2IBTA 2AX3A 4M83A 1UXOA 3GLIE 1SB9A 1F6WA 1UBLS 4NEGA 1NUUA 3NTVA 4U5XA 3I62A 5K0LA 1GZUA 1W4BA 3HJUA 3MQ2A 4UVIA 2H4YA 4PRKA 2EC5A 4FFVA 4QXPA 1MG0A 1A1SA 1V6CA 1CV2A 3JQBC 3M89A 5B37A 3F6EX 3OQNA 2HMUA 1HMYA 3KHUA 3R3XA 1P81A 1IJFA 4TLDA 2F7SA 4LJSA 3ENVA 2CHQA 5FXMA 3GP5A 2RH5A 2R7LA 3EOBI 3I6MA 3IDQA 3F6SA 3OM1A 2BONA 4FX2A 4UNQA 3IEIA 1E6UA 1DO2A 2G71A 1T5SA 1NVDA 2I6FA 3ZE9A 3PICA 2GASA 2JATA 4FGSA 2FN7A 5CFLA 2IXTA 4OMDA 2AIRA 1SKAA 3ZHVA 2GVZC 2HX1A 2OHFA 3U17A 3QLVA 1VL0A 4MVJI 4HS4A 2C5LA 3ER8A 1M8KA 2D5IA 5A06A 4NNJA 2ZCUA 4HFNA 4LC9A 2GEDA 1BWPA 1IZ8A 1GEGA 3ZJYA 3OZEA 1IZ7A 3SJUA 3DZIA 3ZXUB 4Q9JA 2XF2A 4K03A 3HYLA 4F11A 4YUYA 1W5FA 3I1IA 1Y3HA 2Z58A 4K9QA 1A97A 2PX5A 2ZE6A 3IQHX 4KOEC 4U9HS 3EN0A 3NO4A 1T5LA 4BNNA 2Q46A 3C5EA 3CLTC 1U80A 3IYLW 4MQEB 2CV0A 1PI3A 5A6SB 4BUZA 1H2EA 1IWOA 3FX2A 1X1DA 3T6KA 1CB0A 4H4EA 3LY8A 2H85A 5F1YA 4ME6A 5DYGA 3HU2A 4MYCA 4FOOA 5KYUA 1M66A 3MWKA 5KCZA 4C7OA 3PHHA 2NACA 2VHWA 1FMJA 2DPGA 1PU2A 5TQ0A 2ZAYA 3L4BA 3ZWYA 1XN4A 3IR5A 5SY6A 2YOGA 1B74A 1MVLA 1R6AA 4HY3A 4JBWA 4Y1RB 3THYA 1SCAA 3N86A 4Y6PA 3I12A 3E9MA 2FXVA 1HTWA 3VKUA 2IYEA 2GA8A 1SQGA 2VOEA 3A6DA 4PZZA 3FYHA 4UUAA 1CU1A 1NI4A 3BMOA 3JSXA 3BAFA 4L3VA 1BA3A 3L8YA 5EAIA 5EE9A 5MGNA 2J3JA 2VDHI 1K75A 2I4MA 3OEED 3EZ9A 3EBPA 2BHTA 3HI4A 4GZ6A 4M1QA 4TMTA 3ZWQA 5B7NA 3HP7A 3EGXA 4CMIB 4Q02A 4D9CA 1BJKA 4B8WA 2QYSA 3B38A 3I5MA 3SX4A 3T4PA 3GEHA 2DGDA 1L1EA 4OMUA 4ALIA 1Z6YA 4C2BA 1JHXA 1KBZA 1VKOA 4M9QA 1XZNA 1WV1A 1UWLA 2HOQA 2P5YA 1GUZA 5IP5A 4C1BA 4D42A 4CMKA 4MUEA 2I3GA 4EUFA 4IDAA 3W5SA 3H5NA 4YMSA 3E82A 2WP0A 5L40A 1NBIA 2BFBB 3LQ1A 3EASA 3HO8A 3IVRA 4WZBE 5KSZA 3OOHA 2VHZA 5UKDA 1BOOA 2P90A 2VHUA 2R7MA 1QVZA 1ZL2A 3GLGE 3ZN2A 2B3DA 2H31A 1P2VA 3IEKA 4J3FA 4HATA 3OI7A 3DFKA 4R1PA 4Q3KA 2PGAA 3RYHB 1U8XX 4J2OA 4K9OA 3S2GA 4LQ4A 1M2EA 3A06A 4LE0A 4RKEA 4KQWA 5K3AA 2PYZA 4I5FA 3QKWA 1A8PA 1IJBA 2AG5A 2BDUA 2GZDA 1TK3A 4FN4A 2QUAA 4MGEA 5EWJB 4RLFA 2EX4A 2NPFA 1KJZA 1AGXA 3SU8A 5IWCA 5KB3A 3U61B 5FEMA 4LMAA 3AYZB 3TIXB 3QVLA 1ZBQA 1TZBA 4UM9D 4DCGA 1WY7A 4ZCTA 3B9PA 3OWXA 5IVKA 4M22A 3DF7A 4GOJA 1AE1A 5HIKA 4QDZA 1G8GA 2IYVA 3OUTA 3SR0A 4UCFA 4DA0A 2FPPB 3VU3A 3Q5GA 4KXLA 1E1RD 1QYCA 3AHJA 4TLLB 5ENZA 1SVKA 2OORA 1EDEA 2OQVA 4M7RA 1D4AA 3LSYA 1UMBB 1RQNA 4YAEA 1DG9A 3HCPA 2J0QA 2HF8A 5BMOA 3DR5A 5KNDH 3KVNA 4F9EA 3IBCA 4L5AA 3WKDA 1C1HA 2X7HA 2YV3A 3CW2A 4BTEA 1N2BA 1XVUA 3GP3A 4ZYZA 3P2YA 4YXFA 4D96A 1JSCA 1QQ6A 1JR4A 1G8JA 4X6LA 2AGVA 3AEKA 3AV3A 5DH9A 4PHHA 1GADO 4MJ3A 4C6HA 3TX6A 3R5FA 4CVNA 1NQWA 3J80A 3I2FA 3QWBA 3IV7A 1E3WB 1NYRA 1TEXA 1MQ9A 2X77A 4KMSA 3UANA 5F51A 1XLWA 2P6OA 3DMTC 1TVKB 2UVPB 2IGBA 1KYXA 1UWKA 3DKIA 5IH3A 3UA4A 3EA0A 2JRLA 4EPWA 2IRWA 5I9IA 3MUNA 1E7YA 1ENYA 1L4EA 2IE8A 3JRXA 1KAGA 4I08A 1QIGA 4DSAA 1QVVA 1QYRA 1PTKA 1EFAA 1FMLA 1BWQA 1EE9A 2C94A 3JARB 1A5BB 2N0SA 3DZKA 1SBYA 1LJ8A 2ZUTA 5LQSA 1K06A 2GS9A 3T0IA 1KAHA 2HBZA 7REQA 4PHFA 2C7VA 2Y6VA 2PZEA 1VPVA 2ZU6A 4GZ5A 1VI6A 1ISRA 4K9DA 5FWXA 4QC2A 3HVRA 5ESDA 3MJVA 1BXRA 2ERYA 2G9ZA 3DZFA 3LM8A 3X1MA 4PLHA 1NLZA 1CQJA 3ZW7A 2I9KA 2FR8C 2GZ3A 2VZLA 1CB7A 2X8JA 1QIHA 1DS6A 2GZSA 3BHIA 2FI1A 4H4CA 5KNCH 3AFMA 1JDBB 3M1AA 1AQ6A 5EKXA 3L2OB 3H16A 2XTNA 1TCAA 5KTMA 2ZPAA 2HADA 2IV2X 4ZDKA 4YXWD 1J22A 2A14A 1QF7A 3FJ1A 3JZFA 4UXHA 2DSNA 1PZEA 2B34A 5B3KA 3WLMA 3L07A 4GX0A 4UDNA 3KB2A 4P4LA 2P1ZA 4EPVA 4BGEA 1F2UA 3P97A 1Z9BA 3WGUA 1E9EA 2CDCA 3R8XA 4KPGA 2M2IA 1UMDB 2IYPA 2HRRA 2CNNA 4FQ5A 4HWKA 4KLRA 3HA2A 4UQPA 1M2FA 3CISA 4ESEA 4IXWA 2WYWA 2Z4TA 5HCIA 1DJMA 2GBFA 1BJTA 1NXSA 3C6XA 2PFKA 4BP9A 4LNHA 2NZYA 5JCPA 1N2CE 2ZRCA 1T0JB 1U11A 2FKNA 3I72A 2Q5FA 2OGUA 1JHOA 2DM6A 3BE4A 1GD1O 1QZUA 2PKWA 2JIMA 3D2BA 4ZCQA 2RGXA 3FYSA 1WSBA 2FMHA 1OU4A 4OQZA 5FPYA 1OGJA 4PAGA 5IM5A 4RA9A 5K99A 3INRA 3IVCA 4RCZA 3ZCXA 1G19A 4KR6A 2BSAA 2VXCA 2ZJ0A 1HRDA 3EAQA 3AESA 4LDRA 4EA6A 4R0MA 1KTIA 1ORVA 4PC3A 4BVJA 3U2QA 3A6KA 5DBGA 4EG1A 2PXCA 4WNCA 5IU6A 4L74A 2GAOA 4NZPA 2XJ4A 5B64A 3BDAA 3QV1A 7GPBA 3R9XA 3FOEC 2FWJA 1PGQA 5AW5A 4F0HB 1IONA 4QOFA 3JATA 3W6PA 4XX1A 4CKXA 2FX2A 2WWVD 3OZAA 2KI5A 4YTEA 3HADA 4D0LB 4ZXFA 1PKXA 5I4CA 3ROPA 3C8HA 4U0KA 4YCCA 1SUBA 3JALB 1SC4A 5ES4B 3VKVA 3AF6A 3T1YB 4ZAFA 1IHUA 4TTSA 5FP0A 3EUAA 3IVXA 1P91A 4L4SA 1KDYA 1CUVA 4QECA 3UPDA 1FU8A 2VUIB 3SSNA 5F3DA 3ZJVA 1DX4A 1HL3A 1BYUA 1MZPA 1GLNA 2ZIUB 3AETB 3CWCA 1DXYA 3CEJA 4XB6B 2IYLD 4DQLA 5IFKA 5JMTA 5JROA 3UPUA 4YV2A 2IA5A 1SXJA 2Z09A 1EM6A 1RAEA 1UBJS 1IN5A 4DLWA 4ER7A 1XRRA 3AEQA 5H7XA 2RG1A 4MIYA 4PAWA 1D4FA 1S2IA 1I4DD 1ZIDA 3EC7A 3MGCA 2J3EA 2WAOA 4FX5A 1R4MA 3IUPA 4KLCA 3MGBA 3RRXA 3B3FA 3B89A 3BM5A 4Q21A 3VTKA 1AQJA 4YAGA 3BFJA 2PR7A 3AUYA 2C2XA 3ZIDA 2VFAA 3PDUA 3LC1O 4OH1A 4YRQA 1CS4C 2NN3C 5DK6A 1MOSA 4QPNA 2AFIA 3FZYA 1S8OA 2G5TA 5IABA 2ZWPA 3DUFA 4EW6A 2AMYA 1UP6A 1VA4A 4IXDA 1VJ0A 1Q6YA 3TTSA 1N7IA 3O2NA 4IVPA 1BU5A 1YQEA 2N46A 2DHRA 3IAXA 3KZOA 2Z8XA 3T7RA 4QELA 3R7NA 3VJLA 2I99A 1PJLA 4FE7A 4AKTA 4BLVA 5L7TA 5BOSA 1JIVA 4PZYA 3O1JC 1OZGA 1EH5A 1FP4A 1M9NA 3K1YA 4J6EA 2AX4A 3TG2A 2EHJA 3UA3A 4W1QA 3KOUA 4Y7DA 3VM6A 4RSRA 2W2OA 1WXQA 1E2HA 1RLJA 4GIBA 2ZYHA 1ESCA 4AQ7A 4W8GA 3G2KA 4W8HA 1FVXA 3WGYA 3RLFA 3PVZA 4HCJA 3UWSA 3ROTA 1P3DA 3PXBA 3PL1A 1K8XB 4WNAB 1U0LA 3HN6A 3MINA 3I5AA 4MWCA 1V5EA 1N5LA 1TLFA 4O25A 1E6LA 1CUEA 2OC9A 2WVAA 1XNGA 3DM9B 3HXPA 2INGX 4X94A 4ZVLA 3AEXA 3V2IA 4ML3A 1RWXA 1SBIA 3HWRA 4LUCA 3JQPA 2GLTA 2V8OA 3P2EA 4AECA 4PG8A 2LRHA 5KNBA 4RVSA 3M2TA 3AVPA 1KWKA 3HYTA 3W05A 2XT0A 2FETA 3SC3A 4CN9A 4OTZA 1LW7A 3BMCA 1G3MA 4KAAA 1RM3A 1X6VA 1Z29A 3TI7A 2FUG1 2R8ZA 4KQEA 1KDZA 5KSPA 4LBVA 2YWXA 3GB9A 1QO7A 3LVRE 5IAGA 4TYMA 5IASA 2PZKA 2QM3A 1LBIA 2WIAA 1XZLA 3NVAA 4O5AA 3V5NA 4FSDA 1L5WA 2TMDA 4JJ7A 4NOKA 1JU3A 2AFIE 4TX1A 2ZSHA 2JVIA 5COAA 4YT5A 5FAXA 1JPVA 4WZ6A 3U3XA 5LJLA 1B26A 4WCFC 5FHRA 5A4JA 5CAEA 3UGQA 4JLWA 2AYYA 4EHDA 3KRTA 4TLMB 3PUVA 1ISGA 4CQNA 4GPD1 4IGEA 4P8RA 2FPKA 2H1VA 3V48A 5I3CA 3CNBA 2XWBF 2LKCA 3SJCA 4Q1DA 4RM3A 4CEHA 3LE8A 3P2MA 3A05A 1E2UA 2YOHA 4FZJA 5I9LA 1I4WA 5AOBA 4L07A 4D26A 4EQ6B 2R00A 5JVDF 2P6RA 2B61A 2B20A 4QJ3A 5JADA 2WF8A 4OJKA 1CYDA 1FFBA 2FSPA 4PR3A 1VKRA 4UU7A 3TSZA 4M54A 1SM4A 3IGFA 3IBTA 3ESZA 1N6LA 3OT1B 1W0CA 3CNHA 3W6OA 1VP3A 5C5CA 2D2IA 3ITKA 1V47A 3KDSE 4JUFA 4P93A 3I58A 1EJ2A 1OYYA 2R6HA 4IPTA 1I1QB 3HRIA 2UZ3A 5FO0A 3W5IA 4RWZA 3G5LA 3NONA 4PNPA 1ZN7A 4DDWA 5TMBA 2W11A 1YZGA 3IP5A 1WMEA 3LWNA 1G0OA 4FQ8A 3AILA 2WQZA 1BVHA 2A30A 2QRGA 2Q3CA 5IH7A 2CLOB 3AJ9A 4ALLA 4BKMA 5JZBA 4KTTE 4G5YA 4HEQA 5DM4A 1XEWX 4BFLA 5AVSA 1EK6A 5JZSA 1J00A 2HSGA 4U63A 5J4YA 1WF6A 1USUA 3GYGA 2BGUA 4WEQA 2W6ID 1PT8A 3CRMA 2MSNA 1H4SA 2J85A 2IHVA 3QEMB 2ZXEA 4JH0A 3BCRA 2BGJA 4UAVA 5D5HA 3LCMA 1LQ2A 3QKRB 5CK4A 4CW7A 1KC3A 5LJIA 2RARA 4KXNA 4KXXA 3ZS8A 1EPUA 2X9QA 4OUDB 1N0UA 3BZUA 1I4TD 1K8RA 3B1YA 2CCKA 3CR8A 3JD4A 3OLYA 4JASB 4NMXB 4BMDA 4F92B 2ISCA 2O20A 1MF7A 1VMEA 3ECSA 1IUOA 1WVIA 3MTDA 4QUKA 1ZI9A 3HHEA 4I8IA 4UU8A 3BSYA 5EHGA 3KQLA 1RLTA 4LECA 3SNHA 3BRQA 1RWBA 3VC1A 3I92A 3QJ5A 1PG5A 1KEKA 1EXMA 1U7HA 2OCGA 1GPKA 1X8LA 4PE5B 4TTVA 2JIBA 1D7AA 1KDRA 4C4SA 3TQOA 2CJWB 5DTJA 1FFDA 4HYTA 1C9EA 1Z83A 1P72A 3GCDA 2OE2A 3ELBA 3MT8A 3MLEA 4LJ8A 4B6QA 4O4JF 1CJTC 5HF9A 4TL6A 4FCTA 1ZIOA 2IYYA 2N47A 1RYDA 3WMXA 4HEHA 4C29A 4FE3A 4MOWA 2BD0A 3EARA 2F59A 2HZBA 3DMDA 5JSKA 3WL4A 4BLUA 4RTMA 3PG5A 5EHZA 1VKJA 3DG9A 3E4CA 4EFKA 4Q4HA 1FUEA 3DDHA 1BIFA 3L7BA 2WMDA 4R0NA 4BO1A 1NFFA 4MR7A 3L18A 2EIXA 1XD2B 4A2WA 1KAQA 3BE6A 2WM2A 1RM5A 3MGKA 1SK8A 3MJTA 1DJPA 5J59A 1GILA 2PFGA 1NXOA 3DLTA 3WRWA 4P7JA 4B09A 4Y18A 3OFNA 5ANRB 2AKEA 2VHXA 3C6MA 1NUSA 3ESRA 3G17A 1QLWA 3L7AA 1HDGO 1S3IA 1LC3A 4ZOBA 5JO9A 1PV1A 1ZVVA 4RKYA 4RD6A 3F97A 4E7OA 1K4YA 4AO6A 4EFDA 4HEA6 1KHHA 4OHUA 3SK0A 4GF5A 4RPJA 2XVZA 4E1AA 4P0PB 4X1KA 1I1OA 1YACA 3DEKA 3LGSA 1V7ZA 1X77A 1O9BA 2D5LA 1PE0A 3C6YA 1RBYA 4UU1A 2EHDA 1II8B 3RTCA 1U3CA 4UBJA 5E9JA 4LYEA 3W1WA 2I76A 2AR0A 2JGKA 3V4OA 2R6R1 4QREA 1XOIA 4ZEWA 2QKYA 5ALIA 2UYQA 3I2GA 5G4KB 5KINB 4G84A 1QCDA 1N5RA 2H1WA 3KCQA 3LA8A 3TTTA 2O3SA 4HWSA 2X4IA 1PNTA 3GUZA 3FTCA 1TPZA 1KEEA 2PUGA 4QUGA 4JCCA 3SS9X 3L7JA 5JUWA 1E64A 1RRFA 1NDQA 1KO8A 3Q4GA 4EY5A 4LJLA 1LJLA 2AK2A 3F7NA 1CZHA 3D3JA 5CEJA 4DUGA 4OYRA 3EZYA 2ZBRA 5HFJA 4AO7A 4IBOA 1I2CA 2WT8A 3R75A 3C7CB 4EARA 2QMUA 3NWJA 4PG7A 2O19A 1TLLA 4TSFA 4ETIA 2A1IA 1O95D 3IL2A 3FY4A 1O0BA 4R1TA 4AJEA 5E4TA 3CH5A 4I9FA 4RPGA 4OX9Y 2P7HA 1U2PA 2RGNC 3MM4A 3MS2A 4QTTB 3KDPA 4JXJA 1XCPA 4MR9A 1KY4A 2LCFA 3QM1A 4RY0A 4Z9XA 3OE7D 3OAAA 2B6HA 4PZDA 4A0GA 1U8EA 4E09A 1XEAA 3UUEA 4Y2XA 5EJEA 1KL7A 4LFAB 1AKVA 1Q83A 4BHTA 1A2QA 1NBOA 2I3AA 3RGGA 3WP1B 1G18A 1XNRB 3EJWA 3A31A 3N0RA 4EB6B 4EG7A 4XD7A 2FSUA 3I6BA 2EKPA 1I24A 4GZLA 3KJGA 3LBFA 4QWWA 3V8PA 5DM60 4X8LA 1VG0B 2C9BA 3H3FA 4TMKA 5KYYB 2PUAA 3CINA 3L46A 4Y1FA 1E77A 2AXEA 2O2JA 3DW1X 1ZR2A 4QOHA 4UM9B 1FP2A 3VZSA 3E2MA 4FJ2A 4GM0A 5D87A 3HPRA 1NV8A 4JVMA 4WEOA 1V35A 3FTNA 1DVRA 5DZSA 4GYJA 5EERA 2PV7A 1XA3A 1GQYA 4MEAA 5GP1A 3K9GA 2K5UA 1GA1A 1WZNA 4RO0A 4L2IB 4XA8A 1I6LA 2DU8A 1GU0A 1XDUA 1XTVA 4O3MA 5A71A 5I8ZA 3L77A 4FBLA 2BRUA 3TZ6A 4M0CA 1VI2A 3AR2A 4B87A 1CY4A 1XVTA 4Y0AA 3KV3O 1EBFA 4FEAA 4QM6A 1NLMA 1B76A 5FH9A 5KVQA 4OREX 4CN8A 2IV7A 1RI4A 4TLAA 5EKUA 2WY2D 2P8SA 3E9YA 1T36A 2PGLA 1YK0A 4AP5A 2O57A 3UGKA 5AJUA 3GLUA 1OTHA 4NFLA 3TRIA 2W8BB 2ZI7A 4CLDA 4A5SA 2QYOA 4BRSA 5BVGA 1VL2A 3VPSA 3C6ZA 2Z2KA 3IELA 3AL3A 4RHXA 4LOJA 3SMVA 1T5IA 4CKEA 1WTAA 5B3AA 2H3EA 3NHRA 4H35A 3B2EA 3U4AA 2NV6A 1NX9A 1FDSA 3KOZA 2C07A 5JXJA 5F1PA 4G1FA 3WFZA 4MKIA 3B70A 3AERA 1E1QA 4QDJA 4WCFB 1KDOA 3CY6A 1NRJB 1BX1A 3ZQ4A 1U8CB 1QH8A 5F9FA 1EMDA 1BROA 4KWEA 2QSZA 4KK3A 3DQQA 4RMNA 1JAYA 2J9YB 4L9RA 4O4HF 1DP4A 5A62A 4QUHA 4C0LA 5A02A 1G5IA 3BX1A 2ALJA 4KV7A 1L5VA 4B6OA 4DLSA 4CTOA 4AUNA 3ZE2B 4L3WA 1ZGAA 1G1MA 4OIFA 1P9LA 5JIBA 2VIIA 2FFJA 1GU1A 5MFZA 1TM3E 5E6RB 1CQZA 3PUWA 4FLEA 3VHLB 1NQOA 3ADPA 1P19A 2JFVA 1Q3KA 2VNHA 4H3KB 3I0ZA 2YV4A 4DM7A 2NSLA 5FWAA 3OM0A 1ZW1A 4HAUA 5BMVB 3TE7A 4B6PA 5LU8A 1PSDA 4LS3A 1U0SY 4BKOA 5CB0A 2J9XB 3I0NA 2YV2A 4UTZA 3FM9A 1KERA 3W9SA 4E1VA 4XJTA 2A88A 1CUFA 1U3TA 2HF2A 3CB2A 3IE2A 3R7BA 2XUQA 1VIDA 1GTG1 2HLDA 2UDPA 3IIJA 5THQA 5CXXA 4MV9A 1U0EA 1RM0A 2HU5A 4ZOQI 2W4QA 1KK0A 2PYDA 3PLAE 1SUCA 1HURA 1ZK0A 1GT91 2R7KA 2ZSDA 2YMMA 3HKDA 3NM5A 1A76A 4WK6A 2XB2A 1QM5A 1YONA 1JI0A 1ADGA 3OQ6A 3AIOA 4C4RA 4YCLA 4CHTA 4W5TA 3R20A 4M1SA 5DN6D 1RFGE 4DV6B 2PSSA 4TTQA 2WJGA 1CHNA 4UVHA 4UMVA 4B83A 3K8ZA 4IHJA 5AR1A 1OGIA 2VBIA 2MYUA 4HG2A 4ASUD 3U4DA 4LGCA 3SVTA 1NNLA 3IP6A 3N8IA 5EP2A 1E7RA 3SJBA 3R2JA 1GRCA 1KAEA 1RPAA 2G36A 2J5BA 3TQSA 3OIWA 2FA9A 2B1IA 4OOFA 1KEZA 4QD3A 3R5KA 1ZD8A 1H66A 2AUMA 2Q5CA 3H2SA 3RUIA 3ISTA 3HABA 1RMTA 3C5HA 3A3YA 3EXEA 4DABA 2R7NA 1BC5A 3FPHA 4X85A 3R6DA 5FJIA 5C1IA 2BBSA 4J0FA 4AZ3B 5AIBA 1OY1A 1BEEA 4Q9DA 1ODSA 1C0IA 2FUCA 4H7IA 2HK8A 1V5IA 2GAJA 1PKEA 3HK2A 2XUDA 3B6KA 4G25A 4YCMA 1JYFA 3MRTA 4E11A 4KXMA 5D7BA 5A2QA 2VZ8A 2AQKA 3MCUA 2PUDA 3B7PA 1N3YA 3PNOA 5F7ZA 3WMFA 5C9ZA 1SU7A 1AC5A 1S9HA 4FILA 3KSUA 4AROA 3AYXB 3U48A 1E3JA 4BVGA 4HN9A 2Q3HA 4YAFA 4DBLE 3B3AA 2QMZA 1QC5A 1ZEJA 3EXIA 2HEGA 4BMXA 2WHYA 1UFOA 2H51A 1CBUA 4F97A 4JJ4A 4KRGA 2FPGA 4IWXA 2PK3A 4LK2A 4ECAA 4ITUA 4WOBA 3WAJA 2I91A 2IUYA 4B2PA 3INYA 4RHFA 5F78A 4YXWA 2P2GA 3VH4A 2WP8J 3MOGA 1DKUA 5F4ZA 3CLVA 4MLPA 3WNDA 3BWDD 2G9QA 2ZYAA 1E2JA 2X76A 3PV0A 4HDKB 5TT0A 1RVV1 3M5CA 2DY1A 2ZJOA 4R8RA 2IYFA 1XAJA 4MS4B 4AUEA 3DBRA 2BISA 2J1LA 1OH7A 1OYOA 2E37A 3DAHA 3FUVA 3DUWA 3H4IA 3O1HB 3QF4B 3HY6A 5LDGA 3R6GA 1Y6GA 3OHSX 3NLLA 3AB3A 4URFA 2PV0A 2R5FA 4G86A 5EQJB 2YBVB 2E3JA 3EF3A 5KZMB 1Q17A 3EQ8A 5TE9A 4C1NA 2CXXA 3RVKA 2CUKA 2A94A 3P20A 1F2VA 4KZKA 3WWCA 5BYKA 1IVYA 4OFBA 4XDYA 5ED0A 3RJTA 3G2IA 1UT6A 1XJWA 2NZXA 2QX7A 3A6ZA 3LYUA 4HQ6A 2CHGA 4IF6A 1K3TA 2VRWA 4QTUB 2R1VB 4W7HA 3O73A 3O3MB 4V02A 3MJRA 4OU5A 3M81A 1JV2B 3T4UA 3UHFA 3VZBA 2NZ8A 2Z57A 4EF4A 1WB9A 3T3OA 2I0FA 1V1MB 3KKQA 3HUEA 3LBNA 4C5BA 2HLDD 4CKWB 5I7FA 2CD9A 2YN0A 3ORQA 3ELWA 5EZYA 3ZS9A 2QRKA 4DG9A 1HDZA 2PUFA 4L0CA 3B51X 2AD5A 5MFPA 1XQVA 4DDVA 1MO3A 5AJHA 3A9WA 4PRLA 4DUPA 4PN7A 1XMQB 4MLZA 2NO7A 5K2MA 1EUYA 1F14A 5ALPA 4GPTA 5CUQA 5FA8A 3RVBA 3JTEA 4V0MA 4P3KA 2JH9A 3OZTA 4TM7A 3SZGA 3ZQUA 2YL2A 1PFUA 4KW7A 3TUZC 3EWNA 3E58A 2NUTA 3KZXA 1M0WA 3GJ7A 4P38A 3NDBB 2DP4E 3HJNA 4Z0TA 2J0UA 3FRJA 2RGGA 2G09A 3K71B 3ISJA 4F5WA 1FDWA 1RCUA 2XBUA 4F86A 4S05A 2HA0A 1YTUA 1KXZA 4NU6A 5ITSA 3SC2A 3DKRA 2QVYX 3DE6X 4GLOA 3STXA 1HZZA 3W5VA 1H9CA 2Q2NA 1Z8HA 2V1XA 4FFLA 3EIEA 1CJUC 3S1AB 2FW0A 3KFVA 4KE6A 2F3UA 2VKTA 4KQHA 1LLFA 1SBCA 3K70C 1WSWA 5JSYA 5CIYA 1YQ9A 4JXXA 1JXAA 3W34A 3QU4A 2OV2A 4NAVA 3U4CA 3HG7A 2QD1A 1M6VB 4CM6A 5JH7F 1IOWA 4RKFA 3LUPA 4L8VA 5G3YA 5I4KA 1YTLA 2QAGB 4Z1MD 3KQNA 2J33A 2RCNA 4KO4S 1RBLI 1NW3A 4V38A 3EMVA 1ZM9A 2FVYA 5CLGA 1WSDA 5T6BA 2XE8A 3TIFA 4KQJA 3IJPA 2OCYC 5CJJA 5IKXA 2QENA 2BLNA 2ID7A 3KWFA 3AH8A 4OL9A 4ND6A 1N4AA 3GMTA 1VPLA 1HSZA 2B35A 2I4RA 3IIKA 4OLJA 4A0SA 1FPMA 1ZW6A 2GPYA 4B6RA 4DMHA 1TGVA 4N3NA 721PA 3GLKA 2OV4A 4MO2A 2JZCA 2XWSA 5HRUA 5A6SA 4KFSA 2Z6QA 1E0AA 4QYXA 2BTOA 1NI3A 3G7UA 2YHIA 3D7SA 3M8KA 4L9WA 2ABWA 5DI3B 2BKVA 2G70A 1UIMA 3HBNA 5FL3A 4OBWA 1L5HA 3HL0A 4WV3A 3T3DA 1RBQA 3QXJA 1YJCA 1H23A 2QT9A 3ST7A 3H17A 3W2GA 4RU1A 3MJCA 4ALJA 1C0PA 1SXJD 2EG9A 3UK7A 1JF8A 3WIBA 2FF5A 3ACBA 1J21A 3CH6A 3OSUA 1KMHA 3I9LA 4HLNA 4QFMA 1RRVA 3GFVA 2XV1A 4YRIA 3H1FA 1J0CA 4XRGA 4ES6A 4J91A 4L8YA 1ORIA 3KLMX 2OUIA 1UPAA 2V6BA 1XPUA 4AZWA 5C4MA 1L4LA 3GEGA 2MR5A 2NYRA 3FVWA 3HV0A 4I4LA 3NETA 4HXFB 4MPTA 3AC0A 3RUDA 2VPZA 1B2RA 2G1PA 4WQMA 1XRJA 4WKNA 4DMMA 2B78A 4S1TA 5JJKA 1ETHA 3EWAA 3SQNA 1KP9A 3TB6A 4YUAA 3L4EA 4LVCA 3FPFA 4F96A 1MO5A 1G5QA 4M0UA 1TDJA 3HNPA 1ACLA 1JG2A 3T1QA 4NAHA 4QDUA 2QS9A 4HSGA 4MUKA 1U0HC 4KYTA 1N36B 5EWMA 3SDSA 4XJSA 5L51A 3VJRA 1RWQA 1ZH2A 1ZA2A 1BVRA 4CEIB 1WV0A 3MRXA 2ZT6A 5HUJA 1G8HA 1Y0BA 1GFZA 3E70C 2VJNA 3P9IA 2VWHA 3RVOA 3MIIA 4RK5A 2QG4A 3RTDA 1XCBA 4F91B 4FDUA 4DAOA 4OQLA 4IDNA 3A3PA 2W8BA 4J16C 3RKRA 5EI5A 5HIMA 4H6VA 5KNBD 3KQUA 3UAVA 1VG9B 3EZFA 3F3SA 1YIDA 5H1YA 3NHFA 4OQPA 2X0EA 4GQIA 3RANA 1JNYA 4IIJB 3RWMB 4A5OA 5BP7A 3QY0A 2H54A 1L7AA 1TADA 3OESA 4LPSA 1YJ8A 3JCZA 4EVQA 2YWBA 3QEAZ 2CV1A 1JWBB 1K86A 1UFRA 1NXVA 1FDOA 1N5DA 2ZR9A 3DHNA 4G5XA 2I1LA 4FMCF 4GM1A 1MJFA 3GF4A 3V2UA 3ZXIA 4HDSB 2Y1KA 3VR2A 3GFTA 1KY5A 5AK6A 1CNEA 5AM1A 5KWJA 1PTJC 3HCRA 2F4NA 1QVRA 4K6KA 2IY9A 2X0JA 1QV6A 4L4ZA 3RYFA 2HXSA 1D2AA 1FYXA 2EJCA 2WUWE 4O33A 4ZAZA 4AWBA 4K05A 3K9BA 1TM4E 2B5VA 2UYYA 3GPDG 1SOUA 4JU9A 1D2CA 4LJ9A 2P41A 3KB6A 2W43A 2WTNA 3SX0A 1DG1G 1YT5A 1V3TA 5HILA 2Z6AA 2XMZA 1OLXB 3IXMA 3OIFA 3ND7A 3SIWA 1UZHC 5EWLA 4URVR 1XCMA 3R3SA 1ZU5A 1FSPA 1N0HA 3QVOA 1MV5A 4P5PA 3PIIA 2AEEA 4REMA 2WG2A 1P5RA 1GYPA 2YWDA 2GJ8A 4N3GA 3MAAC 3FGNA 5COBA 1I94B 4LZNA 3G9QA 4WZAA 5LL6P 3E35A 3GQVA 2D4HA 3N9IA 4KQMA 3LA6A 4HP8A 4UJ5A 3VHXA 4EF6A 2JHPA 4EW2A 3LTNC 2WV9A 1RADA 3SXUA 7ADHA 3IAAA 5GMOA 2CT8A 3QWFA 1Y7HA 2WWHA 2VXOA 3KSAC 3LUHA 4W7IA 3K8QA 2Q6LA 3LPCA 3HUDA 2OXRA 4R98A 5BSHA 1B8OA 1H5QA 2PTGA 3NUZA 5KX5A 5LD2B 3BD9A 2XUFA 2B1JA 3O3CA 4HLUC 1M73E 1UKVY 1UBRS 3BGSA 3AY6A 3UMRA 4F5EA 3NORA 1K2VN 1ORRA 2YCLA 2WAAA 5B53A 5JPIA 2G83A 3T7EA 3W77A 1YS9A 2QP3A 5HM6A 4A36A 3GG9A 4FR5A 3VPCA 2OGSA 3VSAA 2NZ2A 3NHJA 1QU3A 4QQRA 4HGQA 2BF7A 2VVTA 2QI9F 5LQDA 2CDNA 2XITA 3KJEA 4DYDA 2MSWA 3MJHA 1JDNA 1XXLA 1BX0A 1I1NA 1YB6A 3PQCA 4IHQA 4KXQA 1J97A 2JLCA 1NY5A 1DXHA 2HNAA 2ZVPX 3LIIA 3ANNA 4IS2A 2JASA 4JOQA 1W8IA 4LXUA 2F8SA 1D6NA 3LQFA 4LDQA 3WAGA 4CQLB 3ANTA 4GOMD 1WPRA 3G0BA 3NU1A 2NAFA 4I4CA 4PIVA 4WBXC 4ER6A 3AF5A 4LFBB 1UBKS 1OJLA 3M4XA 4BFZA 4HNQA 1OBOA 1XPOA 2D5CA 3NBZC 3Q3CA 1BGVA 5IYZF 1KBOA 2AKYA 3TS1A 1DFIA 1UKZA 3VZCA 2YJ6A 3NTQA 2W6IA 2ADFA 2UUPA 2W0SA 5C31A 3TSOA 4C0QC 2ATVA 1UDBA 4MIEA 3HA3A 2NNWB 1LDMA 3SYNA 3Q2KA 1WVMA 4QXQA 1X1TA 2J41A 1XZFA 1P73A 2O0HA 3HKCB 2F48A 2Y0BA 4QOEA 4BU0A 1EP9A 4MHTA 1I3OA 3RBXA 1BG6A 2YWJA 1I3KA 1USIA 2BGTA 3G2PA 1PAUA 3MTJA 2CVFA 4BFVA 3FOBA 1TO1E 4LWZA 4U3JB 3RKUA 1YQTA 3FWYA 3NRBA 4HLUA 3V9PA 4OKSA 4I2NA 4JAVC 5FI0B 1AHNA 3BDVA 3GXBA 2JGEA 1X7XB 1FMCA 1AUPA 4F8EA 2G25A 4R40A 1E6CA 5ITWA 4MKVS 5DJ5A 1FXUA 4YB8A 2ZRAA 1OKKA 1ZEMA 2MHCA 2AE1A 3N2KA 3BREA 1JVSA 3DAPA 3PYXA 4TL9A 4KG7A 2Y67A 5ESWA 3CTPA 3HB9A 2ONCA 2A5YB 2I4NA 4BLWA 4OMCA 1H1LB 3U31A 3PEUA 2ZDQA 4FHFA 3H4TA 2FVXA 3UAXA 2BFMA 4WY5A 1K7XB 1NVUQ 1RXIA 3AI2A 3HQ4O 3KYJB 4G5RA 5C1BA 4NYIQ 1P1BA 2JJ1D 4GUDA 2JVKA 1FMTA 4B6EA 1EFVB 4EWLA 4DV4B 4ETMA 2GYUA 4HWGA 1YBHA 2R6CA 2WJ4A 3NR2A 2L19A 4X45A 5FPHA 3VBEA 1UWCA 3VPAA 5JH7B 4JJZA 1QG4A 5D5QA 4DMCA 5KWEA 1R6TA 3FBTA 1P7PA 4DA9A 1PJAA 1TC2A 3D6AA 3OU2A 5D3ZA 2FRXA 3THOA 5GQSA 2HNBA 4IFBA 2VPPA 2EGGA 2O8BB 5E2IA 1PNOA 1R5JA 3K73O 1G7CA 1GN9A 2FWMX 2EFHB 1MT3A 1B1AA 1X9GA 4GD3Q 4JR2A 5JS2A 4EJ0A 4GEGA 5F4BA 1UK6A 5JMPA 2PZLA 3A1SA 1Y8AA 3F4LA 4J75A 3OZ7A 4M99A 2XWJI 2NWQA 5IT5A 3UWMA 2BEUB 3EVDA 3WYBA 2E21A 1C3OB 1WMSA 3LQKA 4ZZ1A 3UMCA 1A88A 3MMSA 1U28C 2K4MA 3D6NB 1P75A 1Y8CA 2IKSA 2DUMA 4R5HA 1ULAA 1XYYA 5FB3A 5BN3A 3CH7A 1K6IA 1KVUA 1NIPA 2D1TA 1P18A 2HQBA 3USZA 3KLBA 4JI3B 2O50A 1ZKDA 1Z0KA 3WK7A 4LJYA 4JSRA 1LW6E 4YJDA 4ENRA 4AKHA 2GEFA 4CEIA 3PXGA 1IQRA 5CM8B 4KQGA 2LGJA 5KJEA 1IY9A 1CE8B 1ZUNB 2FSGA 2V8BA 4FCCA 4U2GA 1XROA 2VDNB 2JFFA 4HQ0A 1TIKA 2W42A 2ATIA 4F4JA 3ZDYB 1ATIA 3W9BA 3GEEA 4OBBA 1MJNA 1Q7GA 3T3PB 3SQWA 1ZIXA 3AEKB 3HDTA 4HBGA 3UT0A 1TVCA 2OLKA 1ISMA 4V0NA 3RJMA 2JIQA 5LWHA 2IYXA 4M8LA 5B3JC 1JKFA 2WNHA 3IERA 2F55A 1XKTA 3WSWA 4YCSA 2BFDB 3NBXX 4AUKA 1FA9A 3W8FA 1B8UA 4QRIA 3ZXYA 4BFYA 3W2IA 1LSUA 1GAXA 4TKMA 4EG0A 4RJKA 4B6JA 5FADA 4PINA 2FPPA 1RZVA 2R8YA 3PVSA 3L7LA 1L7BA 3ROKA 4Y9SA 2JIDA 3JYQA 5G0UA 2QPTA 1ZQ1A 1XJ5A 1HE3A 1PWYE 2OORC 3MEQA 1IJKA 3O4VA 4LKRA 3VPXA 1KA9H 3K0FA 4M88A 2EFJA 2YFHA 3GFSA 2P68A 1OLOA 2AZMA 1D0SA 3MCAA 5TGTA 4H0FA 4Q47A 5K7SA 2GHQA 1J8YF 2J9GA 3C43A 1KGDA 4DDTA 3JQFA 1SHUX 2Q9UA 3OX3A 4ID3A 4BNMA 5LQCA 4Z4QA 2XT6A 1H4VB 4ZZ2A 1M1YA 2D1FA 4U7PB 5EXTA 1XTJA 1L4MA 3FFTA 3NOXA 1NBWB 2W6ZA 4BLQA 4JLPA 3GLGA 1YFLA 3FPLA 2QRJA 3NYRA 2V7PA 5ALWA 2UYGA 3HCOA 5K3EA 4PSAA 1RWMA 3KJNA 4HVLA 1GARA 1QLHA 3FOZA 4MQFA 3SHWA 1NNEA 4RXUA 4EJMA 1WF3A 2IEZA 3N07A 1D03A 4LSZA 4LZPA 4NH4A 1UMCB 4YO7A 4FFSA 5DRTA 1T5TA 3L7NA 4GRIA 3O5AA 4XTRA 5CVUA 5KX5B 1DQRA 4X00A 1R10A 1RAGA 6CHYA 1VKNA 4AS2A 4AY6A 2ODNA 1H0SA 5CDHA 1TCCA 3M49A 4Q9KA 1P9WA 3O03A 4LXQA 1L7EA 4ZK2A 3EW7A 2ECFA 3QHPA 4GSYA 3GMIA 2WIJA 4YECA 1Z28A 5HGXA 5LNK1 1RKXA 3QX9A 2W2TA 5G02A 5JZOA 3RVSA 4ZAGA 3VTAA 1QB7A 1HK7A 1N92A 1JAZA 3T7KA 4CKCA 4ENQA 2OV1A 3BD8A 3RH0A 3ADOA 2HSZA 3PEWA 2HTEA 5DMHA 1XEWY 1XT6A 4P3OA 3L3BA 3BHJA 4PFQA 4Q7LA 2UVPA 3CCFA 3D7NA 2D62A 3MUEA 1KQOA 4RBNA 3RVLA 3RU3A 2A5LA 5GONB 5CG2A 1EVLA 3U4GA 4D8WA 1QTQA 1FTGA 1UEXC 1X7DA 5EN4A 1I6WA 3R3VA 4NBLA 3TOZA 1XMSA 3A4MA 5FFFA 2LIVA 1CY8A 1L5QA 4BC0A 2XUHA 5HP4A 2X6TA 3PTZA 4YGXB 1YUMA 2Q6KA 4H77A 4P1ZA 2RHCA 2ZJ2A 3PR1A 1E7QA 1PT5A 1VCMA 3GGSA 3IMKA 1EB8A 4INPA 5GGYA 2AS0A 1BRMA 2CNBA 1W8DA 2OM6A 5CA1A 2FSIA 1QMPA 1GKLA 3W79A 3WJ2A 3FNGA 3F73A 3Q1LA 4BTLA 4TQGA 4YUWA 3V8VA 1SVLA 1A50B 2YZ2A 1UK8A 2XYQA 2VBGA 3HCWA 3DBVO 1T13A 3H05A 1TCUA 4O63O 1JHMA 5K0JA 2C2WA 2IOYA 2BGIA 2AB0A 1NLUA 4M1YA 1NL3A 4KQCA 3PXCX 4TSKA 5AJTA 4B5LA 4Q24A 4WGGA 5C8YB 1CUGA 2ZYRA 4O4IF 4QM7A 2IHBA 2YN4A 1V7QA 5CDYA 4OP3A 1ACMA 3P0RA 1L7DA 1SVNA 2WWGA 2F90A 4A2QA 1A2BA 4ZWNA 1CDZA 4ZZIA 4JDPA 2EDAA 4NENA 3FCYA 2ENWA 5A1JA 2IYZA 3CNQS 2X86A 3LHSA 1ZHHA 4EGQA 1RTTA 2LNDA 3EY4A 3OY7A 5EYPA 1C3XA 3I39X 2OV3A 4DDKA 2DQZA 3I04M 4NBTA 1T35A 1ESZA 1N1GA 2VDRB 3C6QA 3G5UA 3NTUA 1H42A 4X6XA 3ZGOA 2WTAA 4DT1B 1J6UA 1UJ4A 2O2IA 2P9BA 2X5XA 2YY5A 3JQBA 2R66A 3GD5A 2R1TB 1E1RA 4ZCPA 1F9EA 4FZ5A 2C1ZA 4KGVA 2NU8A 4DJFC 1B15A 1YR9A 3LQ2A 1E2NA 3S7TA 5K3BA 4IJQA 3TBHA 4BQOA 521PA 2CLMB 2O5EA 4JC0A 3I04A 1SOWA 5ESRA 2PSJA 1I0IA 4U2FA 4BZWA 2HAEA 2PKQO 1T2FA 2PZFA 2OZPA 3JRNA 4B46A 2Z4SA 5A4AA 3ZY5A 5A5DA 1FPQA 2QAGC 3PYMA 2ZIZA 4F4CA 3V6MA 1XKQA 1Q0QA 3OCZA 4MCHA 4UTRA 3NC0C 3Q1KA 2ZDHA 5A5FA 1QZZA 4LF6B 3PWSA 1GPAA 4RJLA 3UENA 4E4RA 1Z7BA 4PTLA 1VG1A 3WLIA 2C9YA 1CJSA 1GV0A 2QNBA 3T99A 5CDTA 2X15A 1JDZA 1K8QA 2EF1A 4YWJA 2PCLA 1Q7EA 3WRXC 4G0QA 2ZITA 4XGRA 4I1UA 3ZNNA 1NDUA 2X2FA 3FDFA 3R8FA 2IPLA 1QH9A 3EYWA 2XGJA 2ZRQA 4BQSA 2HJGA 2O4CA 5HM8A 2HW8A 3D6HA 3NVMB 1Z38A 3HS3A 3K1AB 3RARA 3ZXSA 5BR4A 1W6UA 4FGLA 3T4XA 3GCZA 5DNUA 3CSSA 5HWSA 1E3QA 2PLFA 3PFKA 4AY4A 1HR0B 4H1HA 4Z9AA 5DVZA 3UK2A 4ZYXA 1OSNA 3TXYA 3SDBA 3QXXA 1KYYA 4NU5A 1Q1BA 3UGJA 5AKXA 4K81B 1X7YB 1WZ2A 1XHEA 4KHPB 1YRBA 2JKVA 3I8XA 4YP9A 3M70A 2HDOA 2J6IA 1TL7C 3T3NA 5JASA 2B0JA 2FG5A 4QDOA 1QB8A 4HMOA 1E9AA 2JLZA 2UKDA 2ORWA 2HA4A 1ECLA 2PXHA 3A4IA 3UFXA 2C97A 5AT1A 4CIVA 4EBFA 2GBCA 3MRSA 3PWKA 3ESYA 4BN5A 3R40A 5CT6A 3L0ZA 2VJBA 4PYMA 1DI0A 3BXFA 5IJXA 1D4ZA 2ZE8A 3IP3A 2AKAB 3AB8A 2YY6A 2ZBFA 4HDCA 5LKRA 1I2AA 3PF9A 3OO1A 3C3WA 5AKKA 4CLOB 1RZRA 1R3UA 2WHXA 3CEHA 1X19A 2DAPA 2OVBA 4LZAA 4RIGA 3PIRA 2FMKA 3U0BA 3HCEA 4JZYA 1M2JA 3RS9A 2NW6A 2HLHA 2RHDA 3K05A 1DCTA 1W2HA 3UT6A 1GA6A 2D2EA 2OCLA 3O82A 3ZTTA 1CFZA 1TO2E 1A8IA 1L8QA 4FHZA 4DM4A 4YRRA 4OJMX 4NL4H 1T5HX 1B6RA 5CT9A 1ONPA 2B6NA 1NPDA 2RHRA 5DM70 1VLZA 3KPYA 5E4YA 2HU8A 4P6VF 4HOYA 3QE4A 2WQ7A 4BNJA 3WB1A 2OECA 1SVOA 2PGJA 4PCLA 4AB1A 3L6RA 4C0XA 4BECA 1ABBA 3ASVA 2OL4A 4I9UA 5LWQA 1N9ZA 4NPCA 1KE1A 1XTSA 2P65A 4MVCA 3DLBA 2CXOA 5FPQA 2FFHA 2JFZA 3L05A 4E6PA 1BZYA 1ZISA 4LF8B 4DLZA 4B4WA 5HR5A 3U44A 3EULA 3OIGA 1FYDA 1YI1A 2B36A 2IZOA 4KACA 4HUJA 4M4SA 2WPDD 3KJIA 3K2IA 1IH8A 2JBAA 2GEVA 1KU6A 2IP1A 2II6A 4XPIB 5FA6A 1HX7A 1NN0A 4WLUA 2BFOA 2VF4X 2XKJE 4G37A 1MX3A 1DJOA 3KC2A 4P22A 1DEOA 5AMXA 1II9A 1Y48E 5KQSA 3NMUF 2QN2A 2QX9A 4YRNA 1GUYA 1YIOA 2GBIA 2OBBA 2ZRBA 3DVAB 4IKPA 3BWXA 1PSZA 4UATA 2Y4NA 3RQIA 1U5BB 2WT4A 2Q6VA 3UEOA 5IEBA 4CM9A 4X66B 2QWXA 1ZUNA 4RHYA 1INLA 4LZJA 3RYTC 4KUHA 2QTVB 4MGZR 1ADYA 1E1YA 2I1VB 5CLLA 3OM9A 2GILA 2Y1XA 3ZZNA 2BL4A 3JQ7B 4PBRA 2W4MA 4MRPA 3EG9B 5H02A 3WRXA 2ODEA 2Y0PA 2B69A 3DWGA 2OY0A 4TV9A 3A4VA 2OBNA 3BXHA 5I47A 4YBRA 4DNPA 1MC4A 3GPIA 2XVMA 3A3NA 1I0LA 1VA5A 2Y93A 1ZMOA 4IFTA 3RT1A 3I61A 4B3CA 1IBLB 1OI3A 2IYTA 1WULS 5DTQA 4DIMA 3QMPA 5EPEA 2D8MA 5ALZA 1TRKA 1WY5A 3LT2A 3ET5A 2QJRA 3K09C 4LCEA 1BH2A 2C58A 2R79A 2ZE7A 3D5EA 3K2EA 3ROGA 5C7OO 5KVSA 2VDUE 1WCIB 1EJBA 1Z5WA 2ZIEA 4XFDA 2C8LA 5G40A 1T0UA 1K98A 1LI7A 4MP3A 4DXAA 2PUHA 2XYVA 4Z54A 5CX4A 2EIHA 3OX2A 3PWZA 4MIOA 3LZDA 2FCRA 4U7HA 2I7XA 5L8VA 1NKSA 4PZEA 2DB3A 2VOJA 3TW0A 1EA7A 5DBEX 4NE2A 4OXQA 3BJEA 2DC1A 1C30B 3LUFA 4NSNA 2PGDA 4ZJYA 4O1MA 4EHFA 5GWXA 5U4XA 4M55A 2XXAB 3H18A 3VKHA 2GTIA 2C92A 2OMEA 7MHTA 1DKPA 2NSYA 3ONWA 4OEHA 2D1QA 1ZJ6A 3WA6A 1HNZB 2A9JA 4HWTA 4UVGA 4I4NA 2G1KA 4DZRA 5ADHA 1RQPA 4LOAA 4J1TA 1ZINA 2DWPA 4QOJA 1GL7A 1A77A 5JNUA 4FP9A 4W5WA 1JKXA 2A84A 4LXGA 4C30A 2X2EA 3F1KA 2XOXA 5B6PA 1HFEL 4BMYA 2CLIB 3VSEA 1O0CA 1W34A 1Y37A 1Z16A 3DT6A 4MV6A 4NENB 4X24A 3Q9LA 4AAYA 5EJ4A 5FF9A 2IYAA 2FLVA 2VPTA 3CVUA 4EG5A 1JEDA 2Q5JA 1BXZA 1CP2A 2H16A 1BMDA 1CNMA 2XTAA 3O95A 4NIMA 1V8ZA 3LXUX 1UXGA 4UOQA 4CTKA 3P0EA 3I6QA 1AMNA 1OI2A 1N9KA 1V5GA 5KYXA 1GT6A 3NJRA 4OK6A 3FTFA 2XCOA 4G9GA 1KO4A 5DBOA 2QL7A 1NNI1 1YB7A 4G1VA 2HSWA 1Q21A 2C5FA 2MJLA 4Q3DA 2ZRPA 2XF8A 3U5ZB 1F51E 2XB9A 1AHHA 3GAAA 3PSAA 2HPAA 2OAP1 3WMWA 2ZKLA 4QSMA 4ZT6A 4R2LA 3ZHZA 2XUOA 1AXEA 3JY6A 1GPDG 2WG1A 4N3CA 3M33A 5T41A 1C5KA 4GU5A 1OZ0A 2YCBA 5HUQA 4R84A 1NMSA 3L40A 4XASA 4GQBA 3OCXA 1GAJA 3NTXA 4IEFB 2BBOA 1DBRA 3LL4A 4JLMA 1B3RA 3W3AA 5JI2E 4POAA 2QMOA 3V4LA 5ED4A 1M1NB 1VSTA 1CUYA 2QMQA 1E0SA 4KXFB 1GFIA 3KKZA 4QYIB 1JLRA 2EF0A 4LTMA 4NJOA 3UH0A 3I0MA 4F1JA 4YLYA 1E7SA 2LD4A 1RXCA 4M1WA 4ND1A 3ZJ4A 2NT4A 2I34A 4GI3A 2P77A 4R83A 2ZJAA 4KIJA 5H4GA 5CDFE 1O94A 4ZI3A 4XSVA 1RU3A 4EB8A 3V4RA 1MRNA 1O6CA 2Z83A 3ENQA 5EZSA 2X9VA 1CEQA 2H8GA 3VMFA 3KVVA 3FOWA 3ESDA 3ANLA 2P6PA 3O7WA 4WWHA 1UM9B 3H84A 1XJCA 3AY3A 3IA2A 1ML3A 3JR7A 3EW9A 2DSTA 3RS4A 3FTPA 1K08A 3FMPB 3CBQA 4ZT2A 2AXNA 1NF2A 3ILXA 4DUZB 2VQ3A 3CPSA 3DBLA 4K2HA 4MV8A 1C4KA 3IIMA 3ORHA 1GNSA 4RZSA 2PFSA 2X6QA 3KOMA 3U3OA 3H83A 3R3UA 1P60A 1Z6AA 2AUNA 1SPXA 2VHYA 3BFKA 2GK6A 5JRDS 1IIRA 4BMOB 3ZEAA 4XM1A 2WDPA 2O3UA 3NGMA 4RIFA 1U04A 4HNTA 2ACEA 3QUQA 4Y9DA 2CCGA 1E6EA 5AVOA 3FLEA 3DVRX 1E2FA 4UHHA 1KZGB 1VSBA 1AMOA 4UVDA 3K4PA 4IGAA 2O7SA 1NE7A 2YR0A 2KX7A 3DHVA 3WBBA 5CT8A 2V58A 5JFOA 3A9RA 5EP3A 3AVYA 3FZGA 4P54A 4MHSA 1FFXA 2CLSA 2BUCA 4BVHA 1E89A 4DQ0A 3GA0A 4C7OB 4FT2A 1IXRC 1IHYA 4FFOA 4XCVA 5TQ0B 1R4MB 3TSWA 3KTAB 4J07A 1QFZA 2BEKA 4PAQA 3FF4A 2YUTA 3IDZA 3KTOA 5EIEA 3HXQA 4NCBA 2F8TA 1CRZA 1B41A 1OF1A 3BJRA 4JITA 1GQQA 2BF4A 2CKMA 3HGTA 2H2IA 4DRZA 4FIDA 3U4QB 2OHOA 3JZMA 4L4YA 3V7FA 1W0JD 4YRZA 5EXSA 5EJMA 2DQSA 1T3HA 1PVDA 3SS7X 4DA6A 2VDWA 4IUYA 1ODIA 3LFHA 4RNCA 3QOWA 3ZWPA 4CDNA 4YT8A 1B43A 4RTQA 1NW7A 2ZOSA 3CPHA 3VNVA 3KPJA 4Q4DA 1LQUA 3KT6A 2PCJA 4JOCA 3JQ9C 2QTRA 1A7JA 1Z62A 3VSBA 4D4LA 4ZCMA 4ZU1X 3SZ3A 1ZDMA 3TAXA 5EUCA 2P30A 1GSIA 3HCDA 3OX1A 4G8JA 2O6HA 3MW8A 2QSUA 3NBUA 4RQTA 4BV8A 5JC1A 1GPH1 5IX8A 4MGKR 2DHQA 1XEFA 2VYVD 1KQFA 4F9TA 2WMOB 1PZGA 5AI8A 5DASA 2QQ0A 2C7PA 5JQGB 4IHJB 1J1UA 3UC5A 1OFIA 2FP4B 3OD1A 3WR5A 3BCUA 3VYVA 4MVJF 2D7CA 1V7PC 3JAWB 3NFYA 2P75A 2XMQA 3PB3A 3H5RA 1L7OA 4XWKA 1XU9A 1F2TB 1PUIA 1UDAA 2O7RA 2XQFA 4I9NA 1WDMA 2GUWA 1KRHA 4LVNA 3UJ8A 5KOIA 3BMOB 3GGCA 1GVHA 1UOOA 2J7KA 2GPJA 3OX4A 5FA5A 4DMRA 3ZXWB 1TKCA 4CKEB 4IIFA 1MB4A 4R9RA 4NFHA 3C0KA 1E2PA 4IQ0A 1NZDA 5AHRA 1JMVA 1WQ3A 2QM8A 5JFGA 4G4SO 2C5GA 2DBQA 1SURA 2F8LA 3JRWA 4PEVA 2WLTA 4RAOA 3UT5A 3NWEA 4OBEA 4RD0A 1GPBA 1XZMA 1HDOA 3NCHA 4P0QB 1RLMA 2UZ0A 2ZTMA 4ZOEA 3T5BA 4ARSA 3M1YA 2QBYA 1J8DA 3PKJA 5DNAA 5AI5A 3T3GA 2GJAA 1DXQA 1YMQA 821PA 3BSFA 1RC0A 1MTOA 1NQAO 1TA9A 2V6JA 4QODA 2MYPA 4N6NA 1EQ2A 1XTIA 4BXOB 3HBLA 3RCBA 1YZYA 4HNHA 5HJEA 1GPUA 1S2DA 1RPJA 1YMVA 1GG9A 2G4VA 5KTTA 2C4UA 2PGOA 1PBNA 3KT0A 3ZWDA 4D79A 4TV9F 3CNEA 1Q7TA 1U0OC 1S3FA 2BGKA 3H4MA 3V3KA 3BD6A 4JYZA 1W29A 3M3PA 4KJXA 4N0QA 1DADA 3TQIA 4FYVA 3WGOA 3GR6A 1L3IA 5KNDA 5K4GA 1ZK2A 4NH0A 3EEBA 4U2BA 3UAZA 1Z82A 2Z1MA 3V8RA 2Q62A 2B8EA 4IH4A 4UTXA 2H08A 3HXLA 4ZP1A 4JP1A 5BYAA 2QTBA 4KTVE 4DB4A 4M1OA 1A04A 2WKSA 4MKRA 4EUSA 3MIZA 4LOHA 1E7WA 4IRXA 2C4WA 3COVA 4BB6A 5NULA 1QX4A 2DYKA 2ZRFA 1MHPA 3W9YA 4B6FA 5ELLA 3AJAA 4D74A 2O6LA 5BQPA 3NEJA 5E8JA 1VBKA 1LZKA 3K9LA 3E05A 4J0DA 5J47A 2C77A 5ICEA 2I80A 1SOVA 621PA 3P2OA 3TN7A 4RTSA 3STTA 1C81A 1LRKA 5KVAA 1W4LA 3D3NA 2C2HA 4WLEA 5I9MA 2PXXA 4Q9AA 1XMJA 4BLOA 5LC1A 3QWAA 3G2NA 1P7WA 1LC0A 2EFYA 2W37A 2YZMA 4BJ5A 1TQ8A 4GGPA 3EXEB 4M8NE 4ADSG 1QG6A 3FSGD 1QUEA 2ZIFA 2RG7A 1J5PA 1Y5RA 2BE9A 2GHTA 1X8XA 3ESCA 4JEHA 3RB8A 2GO1A 1R6VA 1U9CA 2C9DA 3A9TA 3UXHA 2R2GA 1J70A 2ODPA 2ZWIA 4GGMX 2VT3A 5JD6A 1SVWA 1YKGA 3GP8A 2OFOA 2B1RA 2Q45A 5DULA 2V7QD 5SZIA 2CNDA 3M1IA 1HA3A 3IDFA 1CUAA 2GD0A 1KAOA 1PYDA 2G1AA 2WJZB 2YQ5A 1OTYA 4N8EA 3FSRA 3Q85A 4XGIA 1KYTA 1E9BA 3ONFA 2BFPA 4M0LA 1KZ4A 3NB0A 3IQDB 4CLRA 2QU8A 4HB0A 3V8BA 2B37A 3PC3A 4N6OA 5HKBA 4H3HB 3BC1A 4G24A 3A3OA 2C1XA 1O3YA 2WNSA 3EE6A 3HB7A 4Y30A 5BURA 2A0XA 3WLAA 1D1QA 1X9IA 3SAJA 1Z26A 2LCQA 1SEVA 1ECPA 1CZLA 2G77B 2WIDA 2BI4A 1U0RA 2R6AA 1CQPA 2GN4A 3CCBA 5CURA 5D6OA 4JQYA 5LP6A 3OJXA 2DR0A 1Z5NA 3OP1A 5F52A 4CYMA 1Z5OA 5I51A 5JY6A 1PQ4A 1H4QA 4B75A 3JWJA 3GJ0A 3UGTA 2IUEA 2WT9A 1O6ZA 5ENVA 4I4TB 3FSJX 2X2PA 3KQSA 4C89A 4DUYB 2VNSA 3KEFA 5D7NA 5DRYA 3O6VA 2ZUFA 2QAGA 1TD9A 3PJFA 4EHHA 1RE0A 3PA6A 6YASA 1NTOA 2DX7A 4R01A 4LV6A 4E5MA 2BAGA 4Q6BA 3MCZA 2FK7A 3HJTA 3I4FA 3IB3A 3KR1A 3PNVA 4BEVA 3K53A 4C2AA 2WKRA 5DISB 1BMQA 1YFJA 3MXTA 3H5AA 4I50F 4QLAA 4UDOA 8AT1A 4BGVA 4BX8A 4DWOA 4NC9A 2F9MA 2E4VA 4LTNA 4D56A 3UXYA 3BJZA 3CPEA 1UPMC 2G3YA 5L6MB 2B4AA 2QEQA 3UXEA 3EXAA 1LLQA 3WO1A 1HTBA 1YZNA 3RREA 1JA0A 3KELA 3OZIA 2P0EA 4FGJA 2XZDA 5SV2A 4ZALA 1WU7A 3TPZA 3KJXA 5L3QA 1EIWA 3D3EA 4TV8B 4LJRA 3V46A 5IN4A 2Q29A 5J5AA 4BUCA 4PZUA 4QDKA 3L0IB 5C1PA 2IQ5A 3K09A 3KKLA 4BNHA 2AQIA 3HZRA 2ZRMA 2E5WA 2ZZMA 3SE7A 1K6JA 2DEUA 3GJ6A 3MQ4A 4BX3A 1PR3A 3KZVA 3ISVA 3M6FA 1J7KA 4PHGA 5LLSA 2YC4C 1J2EA 4AKSA 3AVQA 4CT0A 2I2XB 1R0SA 4CV3A 1DCKA 3F6BX 2B8TA 1XP5A 1YU9A 3LCUA 5JQWA 3ZVKA 2DG2A 3EXG2 2YRFA 4EMUA 4H08A 4QQNA 1TTHA 3LV8A 2Q27A 1TJ4A 2WJVA 3QTTA 2XRMA 5KJ1A 3DVSX 3LF2A 1XTPA 1J8MF 4FMDB 1Z34A 3HB1A 4MW9A 3CZ9A 3HDVA 2IZ6A 4TXJA 4TVBA 1S2GA 1L9XA 4S0ZA 3QFRA 3M6XA 3TGPA 2FUG6 4RV5A 2F8MA 3TJZA 1SCIA 2HJ9A 5AVXA 2YZ7A 4EEXA 4DAEA 3IMFA 3MG9A 4Y2TA 5JCZA 1UC4B 3W06A 4ESHA 3MNFA 2PQ6A 3LRXA 4RQUA 1V3VA 2IIBA 3KYDB 3DUFB 2V97A 4L9AA 1SUIA 1FFEA 4HS9A 1KVQA 2EARA 3CCCA 2C4KA 4XQ0A 1DCFA 3CN9A 5AM0A 3ZYZA 3E81A 3REGA 4IDPA 3T38A 4YRMA 5JSUA 2ESRA 4M1KA 4PYIA 2Y92A 1IOVA 5BY2A 1Z5ZA 1MIHA 1WZEA 3CM0A 3QTLA 2X23A 2OYCA 3RSFA 4NOJA 4PYJA 3ZDDA 1X7GA 4S1OA 5C8YF 4M3NA 4HUQA 1V9SA 2MDTA 1EFPA 4PPGA 2AG1A 5G1OA 1BGWA 1G7RA 2IDJA 5EJ9A 3UN1A 2C2YA 4IZOA 4D44A 4PQYA 4D9IA 4N5HX 4L08A 2HMTA 1G21A 2YTZA 4WFQA 5CCDA 2EJTA 3MT7A 1VIMA 4ZQCB 4IVQA 4Y1RA 2R6GA 3SI7A 3WLEA 4JLUA 2RGNA 5K20A 3D7KA 3R3JA 1EK5A 2I3BA 1HYHA 2XGOA 3AZOA 4K1XA 4MVJA 3C8DA 1QDUA 2W48A 3GLVA 2LZ0A 4PYKA 4EHAA 3GLIB 1WG8A 4KQ2A 1Q20A 1VYTA 5EQFA 2G06A 4MMYB 1LI4A 5A4IS 4Q82A 1QHEA 4QJ4A 5D85A 5T4EA 2DR3A 3KUCA 3PENA 1HSOA 3UAYA 3NI2A 2GEUA 4MW1A 3RBZA 1L4BA 3QFCA 3CLSD 4TTAA 3QWHA 1M1XB 3H6HA 3SN6A 3W2HA 5KTSA 3W5BA 4TTRA 2QTTA 2QXYA 4GC9A 3ZY2A 2PA3A 5AW6A 2NU6B 4ZDWA 5K8CA 2G04A 2QTGA 5K1ZA 3KKKA 1IBCA 1KXJA 4INJA 4ZRNA 3RRZA 3TZHA 1T8RA 3QJYA 1IEXA 1UFVA 3D9QX 5K0GA 1FLAA 2XDQB 4D1YA 2JGNA 2QPAA 1YE8A 5EC8A 3X1DA 2OLJA 4MQMA 5ABPA 1UZUA 4TV8F 3QUTA 1DDGA 1EZ4A 1JIUA 5E0OA 3NBYC 5DX1A