1ZHOA

The structure of a ribosomal protein l1 in complex with mrna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
228
structure length
228
Chain Sequence
b'PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA
publication title New insights into the interaction of ribosomal protein L1 with RNA.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural protein/rna
total genus 56
structure length 228
sequence length 228
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 1zhoA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zhoA02
3QOYA 2HW8A 3ZQJA 1I2AA 3UMYA 5DM70 1DWUA 1U63A 3U4MA 4REOA 4F9TA 4QVIA 3U56A 1AD2A 1ZHOA 4QGBA 3FPNA 4LQ4A 3TG8A 4DFCB 5DM60 1MZPA 1CJSA 4QG3A
chains in the Genus database with same CATH superfamily
3CM0A 1NUUA 3IVXA 1OXTA 2OGZA 2Q3BA 4Z4IA 1MRSA 2CNDA 4ZO4A 3CB4A 3K0CA 5F33A 2Y0BA 4HXGA 1OYOA 4Q9JA 3W8NA 5A4JA 3KR0A 4U2DA 5JEDA 4DCJA 2PH1A 1U65A 3DFMA 5FPQA 4N76A 4I55A 3LX6A 1QCYA 3R74A 3SU8A 4XEHA 4DKJA 3N8HA 3NWBA 1RMYA 4DMMA 1PNVA 4AYXA 5BR8B 2XD4A 3K6SA 1PWYE 4BNLA 4CL3A 2O0KA 1MKYA 4LRQA 1HDOA 1HWYA 1OFUX 3SM9A 4HDQB 5HZMA 2QRVB 4O0MA 1QIEA 3DYIA 1QQTA 2Z57A 1BEUB 4L72A 3UK6A 4CLEA 3AFNA 3BN3A 3F73A 1LJ8A 5DHAA 1WXHA 4RD1A 3ZJ5A 2VF8A 1EUQA 2AR9A 3DPIA 3PUHA 4TTJA 1XAIA 3O6VA 1CVLA 4QOGA 3JZAA 1KOGA 3IQDB 1KK2A 1V1MB 3LUHA 3SI7A 3Q9LA 3SF8A 4A5OA 1DZ3A 4R8VA 2A1TR 1GTG1 1U9CA 1OYYA 5CH8A 1F12A 3U56A 2Z2IA 2JVKA 3T7RA 3R0VA 3TRKA 4PPYA 4QGBA 1RM5A 1VI5A 1W6UA 2QY9A 1TM2A 1NX9A 2R7KA 2ZBGA 3WNVA 2AJ8A 1O9GA 1GZVA 1FSPA 2V4ZA 2XKAA 3VM6A 5KC9A 4R40A 3G0HA 1IMOA 1AOXA 3F6CA 4LJ6A 1ACJA 1NQTA 1UKAA 4FBLA 2A7XA 4NCJA 3I64A 3H9UA 3IAUA 4FFSA 1UMDA 2D0IA 4MUGA 5J4HA 1NSFA 2D1RA 1A3CA 1C3LA 5DZSA 3HVJA 1P2SA 3IVMA 3N2KB 4MZXA 4WOPA 4X1OA 4E09A 3BWVA 1PDWA 3QU4A 4MWZA 4ZOAA 3S7ZA 1O97D 9ABPA 3TFOA 2DEUA 3EAGA 4BRSA 1F38A 4EW6A 3PUJA 1M1YE 3D2AA 1KJIA 2ORIA 1UXIA 2XI4A 3BK2A 3K0KA 3OKFA 1W75A 3KR9A 1ZN7A 3OZEA 1F2UB 3FSGD 1IQRA 3GG2A 4DIMA 1F6WA 1F5NA 4GOOD 1VHWA 1LFAA 4IIGA 1BWRA 3DZBA 3BM5A 1JYFA 1FYXA 5AJXA 4POOA 4WNYA 5ADHA 1OZAA 1GN9A 1XG5A 2ICAA 5DF1A 5AM2A 3D43A 4NR0A 1HX7A 3LX4A 3A37A 1OA0A 3Q11A 2I91A 4MV3A 2G4CA 5IFLA 2XOKD 1QK3A 1SZJG 2FEMA 1WUKS 5KNLA 4WCDA 3KYJB 3QPVA 2Z2JA 3FPLA 3INTA 5JVDB 3I5XA 3KWFA 2WSBA 2GHQA 4X7PA 1NSYA 3OEED 3E9DA 4Y98A 5FBVB 2ZRCA 2V3CC 3SJ7A 4D9NA 2RHJA 1K4YA 2BEUB 5E7IA 5TS3A 1LX7A 3FPSA 3QA9A 4GXQA 2XE7A 4E03A 2X8WA 4AP6A 2AEJA 4KDEA 1S01A 5BW8A 3DO8A 3U6KA 3NTQA 4EPTA 3LTNC 2FHPA 3CE9A 3IB6A 4MLPA 2E4WA 3BYZA 4M88A 5TIIA 5A0VA 2BGGA 4GM0A 2WVHA 1ZSVA 3R7LA 5JISA 2RGDA 3KVVA 4GPD1 4HGOA 2PQ6A 4NE7A 3K5PA 3DAYA 4R31A 1QUEA 5HOQA 4CLHA 5I9NA 2YUTA 4IH9A 5MFZA 1FB5A 3RUHA 1XZDA 1XTJA 2ADOA 4OK3A 4RSMA 3STTA 4MV0A 1MEJA 1RYZA 1LV7A 2CF5A 3LLSA 4WGGA 4N54A 5IAEA 4JUAA 2E85A 2PMEA 3TKLA 1ZAYA 2ZJ6A 2O6LA 3DKRA 5I7FA 1II8B 5KQRA 2CXXA 4HRXA 1IRIA 1GZ5A 1MIOB 3L07A 4PLPA 2XCRB 3TQTA 2O3QA 1QH9A 5EIHA 2C2WA 1MDFA 1XTRA 1RPZA 1V7QA 2JJYA 1XE3A 2FY8A 2PN1A 2V96A 4PSVA 2EQ5A 3AIKA 1CFJA 2R87A 4O4HA 4YDRA 1G18A 1Z8FA 3PD7A 2RH5A 2QRJA 4BLPA 2QY6A 2P68A 5HF8A 4TV9F 3OA0A 3DT9A 2FPLA 1DRWA 4HX2A 5FI5A 4N82A 2XH8A 2GCIA 1O5OA 2OV2A 5J5CA 4JI7B 2Z1MA 1L7VC 3CLRD 5KNBA 2H1HA 4RGQA 3QXSA 1X2EA 2QP4A 4YH1A 4RD0A 1KO7A 4YT8A 1LPSA 1RP7A 2CMDA 2HC9A 3ZZUA 1X1EA 5AOVA 1I7QB 5EIOA 3HUUA 2VYVD 2FX2A 2D1QA 3D02A 3G5AA 4HDOB 2WG2A 5C37A 1EP1B 2GF2A 4EZEA 3RSGA 4GKAA 4NYIQ 5BN4B 1H05A 2VJYA 2BL4A 4HKTA 5IBCA 3HV0A 3OJWA 4R8KA 5KVVA 2CWDA 2FK8A 2Q5IA 2QG9A 3PBKA 2VQFB 2RB5A 1BKYA 2FZGA 3IT0A 1JEYA 1BXZA 2DBZA 3GP5A 4IRUB 5FUQA 5L7TA 4Z4FA 2H5IA 3CSSA 4MRVA 5DRTA 2C9ZA 2Z83A 4IEIA 3ZDZB 3AB3A 3CEMA 4FCTA 2KB0A 3ZZMA 3TIFA 5HM8A 3WA7A 1CBUA 2J7KA 4GZLA 1YHZA 3DV0A 5FFNA 4E7OA 1UBHS 4LGMA 4ZV9A 1XTPA 3RO7A 2I9PA 3DVAA 3ZDBA 3U44B 3WK8A 4EG7A 3Q5DA 5KHLB 5A3SA 5ALXA 3TNFA 1D6MA 2IYNA 4Z5XA 2PS3A 3VZQA 5EJ9A 1DUIA 1WXQA 1DIGA 5TEWA 1GRQA 3U3OA 2RG7A 1PZGA 2XXBA 1T2VA 4KQCA 4RACA 1GITA 1VLQA 1ZZEA 4QBHA 3RFUA 1RBOC 2PT5A 4M9XA 4YJ2F 3AFOA 2F1IA 4QFCA 3EXEA 4D2IA 3TJMA 4N0PA 2PGOA 4OO3A 4G6ZA 2F9FA 2QZSA 2J0QA 3HYTA 1CT9A 1B00A 1WLYA 2EWVA 4H27A 3NIDB 3R0IA 1ZOPA 3OLVA 3SC6A 3K05A 1T10A 3ILSA 5AVQA 5LWQA 1YHNA 2WIGA 3CGWA 4Q7QA 3FN4A 1Y4AE 1G5IA 1G3QA 4HS9A 1N25A 5EZ6B 4X64B 1QJCA 3C1TA 3WYGA 1SIWA 3AX6A 1FS4A 3A6FA 3Q5EA 4RVUA 4IJKA 2Z9DA 3JV7A 3I3OA 5C1PA 4Q16A 1Q0UA 5EAIA 3T3OA 4M0PA 2BRUC 1NM5C 3OKPA 5EKSA 3QV1A 5AVRA 4J0EA 1FDSA 4IAOA 3E22A 4PIVA 2FFQA 2V4UA 2FKNA 5KDOA 1G2PA 1T5LA 1ZW6A 2PSFA 5JIBA 2O5EA 3EQ2A 4Q9IA 4ITRC 1YRAA 2WUVA 3H5NA 5JE8A 3RVKA 3V3TA 2I65A 4WZZA 4EPWA 5C8ZA 1Y82A 4Q5IA 4EHAA 1IPEA 2V5AA 3C3BA 3CY6A 1E3JA 2BJHA 4ZWNA 1IK6A 3OT1A 5TQ0B 3MS2A 4L3OA 5CCDA 5AUNB 5EUCA 2I76A 3WYFA 4UQLA 4Z51A 2WA2A 3QV2A 5K99A 1YA6A 3BGOS 4R3NA 2GNOA 2K87A 3D8UA 3HR4A 3PL1A 1V2HE 2AE1A 3WMWA 5H81A 4BV8A 3M1LA 2QHXA 3IC5A 5HX7A 1MTZA 3BFPA 4R2KA 4CIBA 4ALMA 3VR0A 4R9NA 1QG2A 1I6MA 3PXGA 2NO5A 2Z43A 4HRYA 4HUJA 4W1RA 1UBUS 5LBTA 1ZISA 3CPEA 4HPXB 2D1TA 2QK4A 2Z95A 1GSOA 4QUBA 4E5UA 1OB2A 3ORSA 3U4QB 3TFQA 3UMFA 1M33A 1AB5A 3AKCA 2FRDA 4OBEA 1HYQA 3ICEA 1J9GA 1MIHA 3PE4A 1ZYUA 3KKOA 2ZE5A 4H18A 1BMFA 1MXFA 5CYOA 2RCYA 3DO5A 3ZV5A 3BICA 4FQ7A 2VDOB 2JBHA 2ODPA 4NYJQ 3FX2A 1OREA 4WOBA 2MHCA 2WT4A 4HSGA 2F4VB 1RRGA 3H2IA 3PQ8A 2POQX 3GNSA 2O3UA 1WXGA 3WLSA 2FWMX 2ZAOA 3GZ4A 5EERA 3FWZA 4IQ0A 1ZL2A 2VF5X 2YZ7A 2H2IA 1WWKA 1GDTA 3I58A 1Z8HA 1Q7CA 2NYVA 1E2MA 3BMCB 2IHBA 3D0QA 3D1LA 4BNDB 2ZRJA 3FPBA 5AHWA 4CKCA 1KBQA 3KIPA 3ZD8A 3UJCA 3ZE2B 1RSCI 4MS1A 4OBBA 4RKQA 3EY4A 1IHUA 3PWZA 4TYYA 4DSUA 2P2DA 4WOCA 4US1R 2H0AA 4EFKA 5EQJB 3T0FA 5JJCA 2D7CA 4BLWA 2Q1YA 4XX0A 3WGMA 1SAYA 1I36A 2BKEA 2HZBA 3KYBA 4NAHA 3RAFC 2OQIA 3FVVA 3FR8A 4U0JA 3IEVA 3RH0A 1B3RA 2P9BA 2PGLA 2D2EA 2PKCA 2ZJBA 4FHDA 3EMKA 2HRRA 5IP5A 1IEXA 4HFNA 5KTSA 2V7UA 4IQFA 1EK6A 4Q21A 2PKWA 2WD7A 1X3SA 5MN4A 2UZ1A 4NDNE 2RK4A 1QFSA 1GTSA 4IYJA 2W93A 3JWHA 1TTHA 3INRA 3I6YA 4AULA 4PN3A 2MINB 1QZTA 2CVPA 3OFJA 2B8JA 3DNPA 4MKGA 3VTFA 5BSGA 2ZT7A 4R1QA 4TL8A 1EG2A 2QN7A 2A9OA 1ZVMA 2B8EA 4CR7A 1U7OA 1EJ6A 1ZP6A 3B1FA 4IMPA 5LQMA 2W37A 3BDIA 1HQKA 4Z54A 1UWKA 2F1HA 1VBNA 3ZWDA 1PK8A 4LE1A 1BFKA 3H19A 5HCIA 4D41A 2G63A 3CXRA 3KV1A 4INAA 4CXMA 3NHJA 1WMEA 1UBOS 3H8JA 2FPPB 4LWQA 1IHDA 2QU8A 4OHPA 4YRPA 1ZHOA 2ACEA 1T0JB 1T5DX 1RZUA 2FEKA 3MINB 3FB1A 5DXJA 1DC8A 5BOSA 3GC6A 5I5GA 1HDIA 1L3CA 3INYA 4NOJA 3UCXA 3BCHA 3R5TA 3IIMA 4GICA 1RW4A 5FLYA 4KZKA 2PUEA 2XUAA 3O3MB 3UOGA 3NEAA 5AKEA 4X0EA 2X7HA 4PX3A 1C9JA 2R00A 3UFXA 1ZG3A 1GM5A 3TSZA 1QF6A 5LJIA 4OL0A 4PRLA 1XVTA 3JAWA 2JJ1A 1HRKA 4O2BF 5DSTA 1N6RA 1SBTA 1QYWA 2R6ZA 1FDIA 2CD9A 3F49S 1TO1E 3GJXC 5EIFA 4B9AA 1QE3A 1A88A 4J0QA 1OAOA 1XEXA 3BX1A 1DX6A 1DIAA 3ZWXA 3AQIA 4DIEA 1ICIA 4FHCA 3ZWOA 1FFSA 1XPJA 4C4OA 2RIRA 4TV9A 4ETMA 1ADYA 4G0ZA 4DG5A 1QRDA 3V8EA 4HO1X 1SA0A 1TCBA 1EA5A 3OETA 5SZIA 5DX8A 2C9MA 3MF4A 3H2ZA 4Y1RB 2X2OA 3B89A 2PU5A 4PU0A 1PJCA 5DN6A 2BM1A 2G0NA 2FDXA 2Y92A 2ZYTX 1Z6TA 3GG9A 3GRFA 4KNWA 5ECGC 5TF4A 2AC7A 2PANA 4U0KA 3PT5A 4Z9YA 4FB4A 1H4VB 1YF3A 4YP1A 1EK1A 2J4FA 4KVGA 2RHTA 3DBLA 5DNAA 4A0RA 5LPNA 1JDUA 1UMCA 1N2ZA 2PIDA 1QM5A 1UFOA 1Z7YA 3ZI0A 2QR2A 4IZIA 1LY1A 4LAFA 2X4GA 5DLPA 2X8JA 5B2ZA 3DEJA 1I9CA 3D0OA 5DW0A 2ARKA 2NZYA 1QVRA 1FFBA 3AM5A 4CKWA 2IS1A 3JW8A 3K2QA 1X7XA 1L7BA 1DLIA 3NAZA 4UTPA 1I3NA 2R4QA 2VHJA 3WKAA 3QUCA 3HP1A 1W0JA 2AFIE 3WWEA 2ZB8A 3QUTA 5CFLA 2EFEB 1E6UA 4GX1A 5J63A 4EMSA 2IGTA 2H7XA 4OGLA 3ZHUA 1DQNA 1XZKA 1KKMA 4RE5A 1ZJ5A 4XRRA 1K5DA 3RVQA 1ELOA 2OBYA 2BGIA 3F96A 5ALVA 4XUCA 2H17A 1ZJJA 1VCHA 1DKUA 2GFQA 2QI9C 1SZCA 1EUZA 2CEKA 4IJ6A 1L5LA 1H94A 1H0SA 2VT3A 3IQGX 3IV6A 3Q6NA 1GQFA 3WGNA 1BW9A 1Z37A 3IDQA 4O8CA 1JXAA 1IN1A 1AIPA 2ZEJA 3AL0C 1PTJC 4MEAA 4CG3A 3EVBA 4ARZB 2HJWA 3NKFA 4IDAA 2FN9A 4JJFA 2FWIA 2MYPA 4URFA 1WSBA 4FJ0A 4O4JB 3WYBA 4KH0A 2G6BA 3N05A 5ALJA 3TL2A 3B9BA 5JALA 1MO4A 1KEEB 3GFFA 3PTZA 4HN9A 4WK6A 4QHTA 3ADDA 4I1OA 1HV8A 1I2CA 5BOVA 1XCOA 5LQUA 3DH0A 3GJ3A 1I0IA 1PV2A 5HF6A 3HKDA 1K7SN 3HSSA 3KAJA 1GU1A 3SN6A 3G5MA 1GZ3A 4I5GA 4Q39A 5E3HA 4URHA 4PPFA 4EOGA 2WTBA 4O1MA 3FDJA 2ZJFA 1DB3A 4XIJA 3ZCRA 4UOZA 3F78A 1J99A 2B94A 4J7CA 1S2GA 2ZJ3A 3WP1B 5FWNA 1TZJA 1E92A 1ZGAA 2FP3A 3KSAC 3DPSA 1A9SA 1JHDA 3D3EA 3O3OB 4IHJB 1UZLA 4TV8F 3TD6A 2VEOA 1OHHD 4B7XA 3AUYA 1OYWA 1GNVA 2ECFA 2PZEA 2YINC 2YWBA 2X4IA 3R8FA 2GKGA 2WZBA 5JVDF 5AHKA 4PINA 4D8WA 3AP3A 5J4LA 2HEIA 2AC2A 4AUMA 1SD5A 2EZTA 5AKXA 5SY9A 4FM9A 5BW6B 1M2HA 1ULBA 3PX2A 4KW7A 4NU6A 3SICE 3PEVA 3K09A 3BJMA 3TOVA 1NVEA 1Y1LA 4I3GA 3WL6A 3CISA 4PZEA 4GKKB 1KZYC 4BCBA 4RNCA 3ZY3A 4HDRB 2G8NA 2OK7A 1QC5B 2VHVA 2AFVA 2KSQA 3HNOA 4R2HA 3RS7A 3N70A 1GL6A 1Z5WA 5EE1A 4U2EA 1U31A 3CH7A 4A8JA 3IS3A 4NP6A 1PR3A 4MHOA 2AKEA 1WCV1 1ZIPA 5FUYA 2XCIA 4YJ3F 2YFKA 2WILA 3FHCB 2QRNA 2RFLA 4K6CA 5HEKA 3O8DA 3NS7A 1W4BA 5TT0A 2GN4A 3LQ1A 5AOCA 5C51B 1BEEA 3ITKA 4LJRA 3TUIC 4DLSA 3LLMA 2C4VA 2EKBA 2B1GA 1CLUA 3I9LA 2DFLA 1IN6A 3HUTA 4XD7D 1JR2A 3IFSA 1ZMXA 3E9NA 2H9YA 3QKSB 2FQ1A 4W6QA 3IT3A 3DMFA 5FBLB 4IV8A 1E5LA 3K9QO 4XGNA 4D0RA 1N4AA 4B75A 5TRTA 2O7RA 3Q2IA 4HDMA 2BMAA 1TIPA 4MLDA 1Y3AA 3TIGA 2DHRA 4AMUA 3HRHA 3MK31 2BFCA 4U8GA 1JEDA 1C81A 4WIAA 2MYUA 3G5UA 5G53C 5KQPA 2JHAA 3MCAA 3RYIA 2ON6A 2G1AA 3RD5A 3HVIA 3LY9A 4FYWA 4K6KA 5H02A 5L3QB 1EINA 3O1LA 3PEFA 1KVTA 4KQWA 3EZYA 5LMCA 2RH8A 5E8JA 3IKLA 4BFXA 4R84A 3TSCA 3RHSA 1OKKD 4P5PA 3ZW7A 3T35A 4ZGBA 1K6MA 2RCNA 3GU3A 1B8VA 1M67A 2RH4A 4FHZA 4HDSA 4J2HA 3ROPA 2C98A 4ZIRA 3RRMA 2HK8A 1IYZA 1FVFA 2FZCA 3GH3A 1CR4A 1J8MF 3MXOA 3O8OB 4RYDA 1I1QB 4XIYA 5ER6A 4QL3A 4CIAA 3BD7A 4M86A 4WUTA 1A4XA 5CA0B 1RWQA 2BE7A 2FRDC 2HK7A 4GI5A 2G4VA 5FADA 2EQAA 4R1SA 5A6VA 1FA9A 2FKAA 2QTRA 3MGKA 4B5LA 4C1BA 4G0WA 1YR7A 2Q5HA 1NRIA 1B3BA 4UAJA 4C7BA 2XBMA 1X7WA 3ESDA 2Y1EA 3GXOA 3HPQA 3LFUA 1PJQA 3VKVA 2G17A 3LUKA 3FMPB 4INZA 3TTTA 1QRUA 3JTMA 3KM0A 4I6JA 1DAGA 4PTYA 1SC1A 5F35A 4DDVA 4UM8B 3R3YA 1MG5A 5BYJA 4D9MA 2CL0X 2OAP1 3GJ8A 4BE7B 2G06A 3HCWA 3LIIA 4MX8A 3UQZA 1JFVA 4H6PA 4O2BA 2XB6A 4K9SA 2VYNA 4F5DA 1U7PA 4MI9A 4I6GA 3EZ9A 2A84A 5SICE 2Z04A 3F4BA 4TYMA 3GVXA 1W48A 4FYPA 4BFLA 4EHNA 1BX3A 3WXBA 2PZ8A 1LPNA 3NGXA 4LY9A 1D09A 4PR3A 3WHKA 4AT1A 3N28A 3ZJYA 4WV3A 5LB4A 3Q7EA 4RZUA 1RZVA 4HS4A 3EG9A 2BVNA 2C04A 2ZR0A 3C5VA 3HN7A 3IAHA 3ORFA 1O87A 1H1TA 1SOMA 4RPLA 2VXOA 1MHPA 1TF2A 4V1CI 4LJ8A 3AXSA 3HA7A 3A0RB 4A8HA 4YRZA 5EZQA 4OYYA 3B9QA 1M8PA 4WW0A 2XUHA 3BBLA 4TLDA 3JRWA 4EKIA 1VJ5A 5IAJA 3RVSA 2XEDA 4Q1BA 5B1YA 2OWDA 4TM8A 4UEKA 4U1RA 2N9UA 1NJGA 4F5ZA 5IDWA 2OQRA 4TTIA 2NP7A 3EUEA 5JSHA 3M4JA 1WUYA 1J2TA 3C7TA 2Q07A 4NV1A 3ZHCA 3D8TA 2ZJAA 1QZXA 5ERGB 4N7RA 2QN1A 3LWBA 5KVSA 4B33A 2CL5A 4JBGA 3O31A 3FNHA 3I5AA 2OUIA 4II7A 3SNKA 2QRVA 2GD0A 2WFLA 3NTLA 1ZC3A 1GQSA 2EATA 1KBOA 1YU9A 3DPUA 3G9ZA 1P75A 3A4IA 5H70A 3DD5A 4INOA 1UBNA 2ID8A 5FOQA 3AF2A 4DRYA 2CHVA 3CT6A 4CMEA 1BHSA 4AUEA 4FTWA 4C01A 1FTQA 2VPYA 3GEPA 4GSLA 2PAFA 4S1TA 5KREA 4M0FA 3NGLA 2IP4A 3GELA 1WV0A 3S2ZA 4MINA 1UUFA 1GCAA 3JYQA 1U8UA 1CQZA 1JLLB 1V1MA 3GLFE 2HU5A 1M8KA 1HYBA 4MGHA 4OQXA 3TPFA 3RJ5A 1NIJA 3L8DA 4JBXA 5SYNA 2PUWA 4EG3A 4NJOA 1YDGA 3MBKA 3ZZ0A 3UXEA 3VYSB 1OAOC 2NUPA 1EXDA 1DEKA 5C1BA 4WNAB 3L4SO 2ASVA 3I01A 1NOKA 4RX1A 3WZLA 1U6JA 2UXCB 5JD4A 2VQ6A 4K9OA 3QPCA 2FUCA 4PX9A 1GZUA 3FI9A 3KEFA 2FOXA 1V7ZA 1H1LB 4JOQA 5B3KA 4ER7A 5T3UA 3OFVA 3FYHA 4BZPA 1MHTA 4P7KA 4EVSA 2SECE 4V24A 2AYXA 2WLTA 1FTGA 3N2KA 4O4LB 3SE0A 4OU4A 1DRJA 3UY4A 3W7AA 1NI5A 1T9DA 2V9PA 3Q7IA 3PI7A 2DVMA 4IJVA 4K9KA 5DBOA 5GZ6A 4ARVA 3T1TA 2O8BB 3D7SA 4MUIA 3DVRX 1F2UA 4M76B 4OL9A 2PX0A 4MQ5A 5DWDA 2WHRA 2FW1A 3FZEA 1G5FA 2BZ0A 1CJTC 4MVJG 1QBGA 2QT1A 3OQ1A 1QG6A 3D64A 4HVTA 1WMFA 3UMBA 3SYNA 4CM5A 2BDUA 4E12A 4R54A 2VF2A 1UXJA 3KBOA 3BDAA 4ENUA 2Q1TA 2OFWA 3A27A 3GLUA 1FC0A 2O0MA 2WSSA 1AZWA 3QVKA 4S2UA 4TV8A 1PJ2A 4BKRA 3A1EA 1ZM4A 4FB5A 2AJBA 2JAQA 3OO1A 5JDCC 5JVDA 1G8GA 4EGCB 2IPOA 2CMKA 2P9JA 4F9EA 1XI2A 1ZNWA 4LYHA 4Y1GA 2EFCB 5CFQA 2EBHX 1AKEA 3IUEA 3N0VA 1UL1X 2RGWA 4PONA 4BDTA 1IBLB 2BEUA 2ZSAA 3PXDA 1RSZA 1ORWA 1HE4A 2AR0A 5E9QA 1HTWA 1YR3A 3RTEA 3IBCA 3STYA 4UW9A 4J16A 4O1HA 4PGGA 1R0YA 1P6UA 2JGEA 3P94A 5AJZA 2B2CA 5ERYA 4B3GA 2YWHA 4DHWA 3RE1A 4C4AA 1VE5A 1VOTA 1X92A 5A02A 1E4YA 3OX3A 2NO9A 3CNBA 1RCOC 5C7LO 4YJ3A 3WGZA 1PAUA 2OK8A 3JQAB 2ZAYA 1MVNA 3N0XA 2CCJA 2E0IA 3K35A 2HRZA 1Y4DE 1P80A 2YICA 2ZWOA 3ICCA 4LC1A 3CF6R 1DG9A 2HCFA 1UT5A 5A5VA 2V03A 1U0FA 1Z0DA 2H2AA 1JGTA 1II8A 5CHYA 1Y80A 2JCVA 3I23A 4JITA 2IWHA 1ZL0A 2JB9A 5ECYA 1MIOA 1NUPA 2BDTA 1PL0A 2B4TO 2OG1A 3BIJA 5BP7A 5I6DA 4KXWA 3L05A 3CNLA 3TPZA 4M4SA 2YCLA 1DWPA 1GOTA 5TB5A 3G8AA 3DF7A 1L1QA 3OCJA 2B36A 3ZV4A 1QJ4A 2FW9A 1CDZA 1TPZA 3D31A 4NEGA 5CXSA 3PFNA 4K03A 2ECQA 3BZBA 3P45A 3JSAA 5AHXA 2IYXA 2XHZA 3Q6MA 2ZBQA 4PWYA 3RYCB 3IE1A 2BGNA 2J3EA 4G5YA 1BYUA 2B8WA 2F9LA 2W2VA 2NUAB 1ENZA 2ZJ1A 4ESHA 2MR5A 4L4YA 3R0XA 2YC2C 3GEBA 1SGWA 3O9MA 3AUFA 1YKSA 2GNAA 5K3DA 2XSZA 2IU3A 1GAQA 3TZEA 2GESA 2Q9BA 4KIUA 1AA9A 1XTZA 1N2IA 3NKVA 1JLKA 1ENOA 2YZGA 3PJGA 2DLCX 4IZOA 1OBHA 2BFPA 1LXCA 3K09C 2BGKA 1P1RA 1TRHA 4OSPA 1GZ4A 3UAWA 3IIIA 4KH1A 5LQSA 1GV0A 5BN4A 4M8KA 4OATA 3DAHA 3LUPA 1EDBA 5JXGA 5CLFA 3OH8A 1CERA 1ZINA 1BD3A 3A11A 4YBZA 5L53A 4G5GA 4AYWA 4A8JC 1QDEA 2Y71A 4RUBS 3FIJA 3L7YA 4L8GA 4UHDA 5HK9A 4J91A 4AKSA 2VCHA 2XJ9A 4LCBA 3L4KA 1L4UA 2PGXA 1R4NB 1N2GA 1X14A 2VPXA 2XKJE 2GEFA 2X6QA 3A2LA 3BJRA 3KQYA 5CW2A 5IDYA 3VZRA 1ESMA 1YUNA 4D9EA 3HZZA 1CK4A 3OJFA 3C16C 2ZJZA 5EXEA 4DMCA 1O7JA 1T26A 3F5MA 3VHLB 3IPAA 1WQ1R 1A8HA 4MUYA 1YB2A 2L42A 1NBAA 1Z36A 2DP4E 4ND8B 1B0ZA 1Q7GA 2I3GA 3JAMA 4I4TF 1BMFD 4UUPA 3NYQA 4XARA 4BO4A 1YQ9A 1E9AA 3DCIA 3PZRA 4IY1A 2PYIA 4AM8A 4F2HA 1B76A 2ZT8A 3DAOA 3GUHA 2XWSA 2ZDHA 2RI0A 4EJSB 1RJWA 1CRPA 4HGRA 3IQWA 5AVYA 1VI2A 3WNCA 4WA7A 5CPFA 3RAJA 4YIHA 4CV0A 3A6GA 1JQ5A 1QOQB 4KFTA 3UM9A 4PQEA 1YBFA 2J5KA 3EK2A 5D6OA 5F7OA 2Y1GA 1XZGA 2CV0A 2F3QA 2IVFA 1M2FA 3O0DA 1RAEA 4Y6OA 3I9MA 4BV2A 4E2XA 5EA2A 3NR2A 4DLTA 1EFDN 2OO3A 2V3WA 2ZPAA 1G1AA 1NASA 1FLAA 2AGVA 3PE3A 5DP2A 3UW3A 2RKWA 3QKIA 4BTEA 2P6PA 4O4JF 3T3HA 3CQ9A 1TC2A 2WMDA 2PD3A 2R47A 3HYCA 3KQPA 3IPXA 1IOZA 1N78A 2P7HA 3NM6B 1A5AB 4IZHA 1UJ6A 4CIXA 3OJEA 1QNLA 4HI0E 1KMMA 1QLHA 1ANKA 2XMZA 4Q9KA 1A7JA 4XVHA 4DLNA 4QO7A 4JEMA 5EE3A 1XV5A 4BO8A 1GTJ1 1Q91A 4ZCRA 5CW1A 2C57A 4YUXA 4EQ6B 1I4LD 2D5BA 2AT1A 1L7OA 1N6HA 2JCSA 3DCNA 3LO5A 1BDMA 1G9TA 4TT8A 4XIIA 5AVKA 2C5FA 3F6BX 3NTXA 3RS2A 4D9JA 4EHFA 4F6RB 5KYTA 4RK4A 4CKXA 1SCNE 4DGSA 3PC4A 3U5TA 1WS6A 2H48A 2ZB2A 4X20B 5TMEA 2A4KA 2FMXA 2WWRA 4MEBA 5DTQA 5IYZB 1R6DA 4XLTA 4IHJF 4BVFA 2WK1A 2P9FA 2NMVA 2REOA 4EZIA 2YY6A 1P29A 1DV1A 4RVHA 4RY0A 4BAZA 2JIZA 4DWVA 5JC8A 1AURA 4ALJA 3BMQB 2HNBA 3LC2O 1AK1A 4M7WA 4QQKA 4FFBB 3W8EA 4QVIA 1ILEA 4RVNA 5KTMA 4HNUA 3VOBA 3U4QA 1V96A 3HS3A 4BNVA 4BB9A 1X2BA 4JODA 1IWBB 3ZG6A 2MMGA 2GASA 1Z6AA 2EG5A 3CSDA 3RRNA 5AIAA 5LDHA 3D6MA 2BUAA 4Q3CA 4REQB 1IUPA 3T99A 4TXNA 4Y9TA 3BHMA 2HCRA 1SCUA 2ZUVA 3DBRB 4FYJA 4PX2A 1CZHA 1HT3A 1TJPB 4DABA 2PUCA 4KIGA 2AQHA 2QL9A 3LAWA 4FP9A 4JQOA 4JU8A 3D81A 3WFJA 5KTOA 2IJGX 4CNQA 1B2LA 1E2GA 2YDYA 2VWGA 1H2BA 1OQAA 2GJ8A 1BJKA 4KC0A 5HK8A 3FFBA 4KR2A 2GAJA 4YGYA 2HH9A 3HBLA 3ADCA 3CUUA 1G4HA 1SN7A 1M83A 2PFGA 2CHEA 3BMCA 3NTOA 1UXHA 3K30A 3QEJA 4GAEA 4NCXA 3P9ZA 5CR9A 1ETHA 1LPAB 1P39A 3PIDA 1E2KA 1GJRA 3W3AA 2EP7A 4Y6SA 5DTRA 4C89A 3AR8A 3C8ZA 2GDZA 2CBXA 2DM6A 4R5HA 2R6AA 4TVKA 5EEHA 3WWPA 3BCUA 4W5NA 4D9BA 1L8AA 4YV1A 2DERA 2H1VA 4MUNA 2CLMB 1XRLA 3G5TA 4HVLA 3VR6D 3ZX4A 4TYWA 1J1IA 1DIOB 2PJUA 1K6IA 1EVEA 4P0QB 4FOOA 4RETA 5AW9A 1B7GO 2A92A 4INJA 1H6AA 1GLNA 2BF4A 2W70A 1HR0B 1NZFA 3QU9A 3AR7A 2AN3A 4O1IA 5I3CA 2ONYA 5DHPA 3HMKA 1K0UA 1UC5B 2H16A 2P7IA 4EKGA 4BNGA 1ZN2A 4IJUA 1QAMA 2EYUA 3IEUA 4YI5A 3QG1A 1P73A 1NULA 1WCWA 2R5FA 3GN2A 2MINA 3N75A 3PLAE 1T3ZA 2WDZA 3EARA 2PZBA 3BSWA 3O1IC 4W4TA 3ZC3A 4RTLA 3ZGZA 5FYQA 3LY7A 2V6JA 4DQVA 1N0UA 2BR4A 4D6PA 3AF6A 3IPYA 3TI7A 3A06A 2HSEA 2QW1A 3OI7A 4AI6A 5CA0F 4QASA 1NF3A 1XZ8A 1JT9A 2Q1XA 4H15A 3DDZX 2VHEA 1XP5A 1FEZA 4QOSA 3V55A 4E30A 3S2EA 3LGSA 2FPPA 1QRRA 4RS4A 2YV2A 3K1ZA 1XEWY 1V8OA 1TVKA 3MINA 4HZUB 3GUYA 4UTXA 3R9IA 3S70A 4E2YA 1IWAB 3DYBA 3AILA 5CT9A 3LP6A 4PAMA 2WHXA 5D3ZA 2Y0DA 3P1JA 4YDHB 5CA1B 1J07A 4GLFA 3EZLA 2XNDD 1KIFA 4D9HA 1JG7A 2UZ0A 1DSSG 2BD0A 5ILQA 5A9SB 4YFVA 2CK3D 3IEMA 3FCUB 3PGKA 5CLIA 4HNSA 2ZQZA 3WWZA 4UEOA 2AVDA 2DH5A 3ZBUA 2H08A 3CZCA 2JGDB 5EI5A 1Q0SA 2PGNA 4PLZA 2UUCB 1Y4ZA 1D8TA 3NC1C 4CF6A 5BQ5A 5KTTA 2FOLA 2GRUA 4Q48A 4HYEA 1RYEA 2R6FA 3KQQA 2DPYA 1KSHA 3C85A 1BWQA 3L7AA 4EG6A 4PIPA 2HCJB 3AI1A 3RSOA 2BKLA 1K0FA 1P9OA 1G66A 2WI8A 3ODPA 1ESCA 4Y1RA 3HGTA 5EVJA 1XRSB 2X2FA 4TGLA 1XJ0A 5ABPA 1YVEI 3KQOA 5ESRA 1EJ7S 1YS6A 1ZM3A 4OGGA 3W78A 4AJ1A 3FPCA 3DW1X 4HG2A 4ZPXA 1ORDA 3CKLA 4YGXB 4EX6A 4PLCA 3WMXA 3HJNA 2CYCA 4S1OA 4BO6A 4D0NA 4D9CA 4DUGD 1GXSB 1QTIA 3H84A 2I6SA 4YHBA 2OBXA 1QP8A 2J9XB 3JU3A 1MEOA 1QIDA 4QJ4A 5BN1A 1VHJA 2CKDA 1CJKC 1GSIA 2HFJA 2PNJA 3UNXA 3X43A 1FPMA 1TEHA 3H75A 1RJDA 2OAQ1 5EJ8A 3GDFA 1BQ4A 3HXOA 5JCZA 3A32A 4OY3A 5AW4A 3CVOA 4E51A 1A2OA 2A5YB 2OV3A 1MC1A 3SYTA 1H2HA 1QO0D 2IUUA 3STXA 3TSWA 2P4HX 4A15A 5GPBA 1D7AA 1I6LA 3ZCXA 1IB6A 3P9IA 4LVUA 1Z7GA 3NH9A 5LSAA 4I2VA 1ONSA 1OZ0A 1B6RA 4GXTA 4WKPA 5CCEA 2DBVO 1C1XB 4I4TA 2H65A 2R1UA 1XC7A 3S2SA 2GBFA 3K1TA 4G2TA 3WHIA 4ZHQB 4J0IA 3T3DA 3RTDA 1BMTA 1UBTS 3ESYA 4IR7A 5DWQA 3TX2A 5AW8A 2AHRA 4PC6A 2H0RA 4AZSA 1KMIY 5TNXA 1CX9B 1WDDS 1KQOA 2J46A 3BSSA 2QROA 1KJQA 2GK3A 3ESXA 3H5AA 1XLWA 3O21A 4K1LA 3UTCA 5DKFA 3FRJA 2OOKA 1TCAA 2R8BA 2OSVA 3MWEB 4ARZA 5JFGA 1RQPA 2P9HA 4Y9DA 2MYTA 2Z9CA 2AB0A 2VTKA 4MCJA 1B8NA 3U13A 1RLJA 3R3HA 2AMYA 1M8GA 4AJJA 1K3FA 4O4JA 2AJCA 5JWHA 2GN2A 5CYFA 4QHYA 4O4LF 1XMQB 2WVAA 4UUMA 3O3CA 3HYNA 4MRMB 4XWTA 3R7FA 3REOA 3VMMA 4IDGA 3UUFA 2IX3A 1IATA 1KEEA 1P4JA 5BT8A 1DKOA 3VZCA 4JJ6A 3GFTA 3CVJA 2BTQB 2RI6A 2UZIR 3I2JA 3I6ZA 4LRYA 2R62A 5E1OA 4AJLA 4F2WA 2IS2A 2NLOA 3EWAA 2MTBA 3VPHA 3SQMA 1AO3A 3FTDA 4GG1A 3VXKA 3ONVA 2MR6A 3WLHA 4JKIA 1FU4A 2AN5A 3K96A 2BI4A 1LBSA 4Y9UA 5JCXA 1RCXC 1X1SA 3B9RA 3VR5H 4BB0A 3SIRA 1N3YA 1KMHB 1DDIA 3IOCA 1AVTA 1HT2E 2TRSB 2B34A 5LMUB 1XXHB 3KSMA 2W6JA 3A4LA 4WDRA 4IHJA 2X40A 3E23A 1LCIA 2BV3A 2WWXA 1SOWA 2QJFA 1A5BB 4LW8A 2PQ0A 3PNMA 3VU0A 3O8NA 4RABA 4ZZ1A 2AXNA 4OJMX 2XT6A 3ANYB 1B8PA 4CKEA 2BEJA 1U3CA 2QPOA 1W47A 4IHKA 3TLZA 1U2QA 3QJYA 2P5TB 4PYRA 3SQLA 5BYAA 5FI3A 5IKPA 2ACKA 5JS6A 4CNBA 3AB7A 4AN4A 1QE0A 2ZKLA 3KUKA 4C2UA 5HJ2A 2YZKA 4HDRA 4OP2A 1QC5A 2J59A 2OG2A 4MKIA 2QRMA 4Q9DA 2A94A 1SC4A 1C1DB 3JSXA 1T1JA 2QLBA 1XLTC 3NVMB 2A1TS 1LZLA 2X0FA 3OU7A 5AMXA 5BSMA 3KUXA 1KYZA 2XB8A 3DVQX 1VCMA 2VYND 4ZALA 1ORHA 5AKHA 4XCXA 3T6KA 1U1DA 3MJFA 2IDZA 3BXGA 2O6HA 5C18A 1EM6A 4M1QA 2ZI6A 3IA7A 4MI6A 1R0ZA 4KIWA 4YRNA 2J3HA 3QKSA 4I46A 4PO3X 4CN8A 1T5HX 1U2EA 1CS4C 3BMNB 2ZM5A 2ZCVA 3OMXA 4UJ3A 3SQWA 2PE5A 4OGWA 2C1XA 2IEAA 5CT8A 3CZ5A 3THWB 3VR2A 2DPLA 3GHHA 4A23A 3G9TA 3DDWA 3PF8A 1D03A 4JR0A 3PUVA 1ODTC 1R5BA 3QNMA 5AM0A 5B4TA 1XJWA 5L3QA 4AL4A 1X1QA 2F64A 4EHDA 3N76A 3BT7A 1PFGA 1QVAA 4BATA 1AMUA 1V9SA 1MAWA 4HC4A 3ASYA 5B3AA 4FR2A 4I4LA 5FORA 2JGAA 2PK3A 5I9LA 3EZ2A 3R75A 5LP1A 3O8OA 2N1BA 3OIYA 4KPFC 3TL3A 4Y6QA 4Q3NA 2FJ0A 5CA0A 4NFLA 1IY0A 1H8EA 1WKBA 2H6EA 3ANMA 3E3AA 2GPBA 5HKAA 3UJPA 1JLRA 2OBNA 2P27A 4EHHA 1P4GA 1J7KA 3AJ8A 3ZKWB 3BDVA 4ZZ3A 1UBLS 4JB2A 3TRDA 4MJ7A 2CDCA 2ZXEA 3GLRA 4KQEA 1QTRA 1R0RE 4XQEA 4EDFA 4F91B 4FCVA 4P53A 3ZV7A 2WSIA 2EZ4A 1RC1A 1WJGA 1XXLA 2RHBA 2HOQA 2C2XA 4XWYA 2Q4RA 2ZLBA 2ZR8A 1I80A 1V1JA 2NU7B 4YO8A 5JXJA 2F59A 5C1IA 3VR4A 4B6OA 4TT3D 4DCOA 4YLYA 1D4FA 2BH9A 2HF2A 3DZIA 3W5CA 1KDZA 4RNDB 3C3DA 1Y3IA 2AI1A 2WQZA 3O95A 4Z4CA 1KPHA 2JFOA 1B14A 2Z8YA 3OSUA 4ZT3A 3VPBA 4CQMB 3VSDA 2ZSDA 3C3MA 3GX1A 4B4VA 1XZFA 4LDQA 1Y8RA 3DXYA 4LE2A 4DJ5X 4ONEA 2ZANA 5AVZA 4DM7A 4R1UA 4YMVA 3EPLA 1B1AA 3N8DA 1G21B 1WAMA 3IAS1 5AICA 2ILTA 4BP8A 2EJWA 3CVWA 1VJRA 3HWRA 3HI6A 3IV7A 3QYJA 3ZOKA 1OY1A 2WIJA 1X7YB 3OZGA 3WRYA 4O2RA 1TKBA 4R0MA 2XYGA 2VDQB 3GLHB 3AY0A 5DW3A 3RU3A 3P2YA 3IOBA 3ECCA 1SELA 5HUHA 2DRIA 2WHQA 3JYPA 1JPUA 1YFKA 1E2HA 2HDHA 3AESB 3ELYA 4KYTA 1M6YA 4YMHA 1M8FA 2MT9A 5TC4A 1AMOA 1QQAA 1VIVA 1X7ZB 2O7QA 2XY4A 1UXGA 2WV9A 2QUBA 1F9AA 1K92A 5C4MA 1SKYB 3M82A 5I7OA 1I94B 2YBDA 1GZ7A 3ZN2A 2A5GA 2P1ZA 2RGCA 1MQ9A 4LF6B 3LSTA 3I30X 3NIWA 2OV6A 1HZJA 1N0VC 1T1GA 2IC5A 4JVSB 4YAFA 4EFDA 2LPMA 2FSVC 2WSSD 2W6MA 4YASA 4XSGA 1CC1S 2YXNA 4H17A 1E96A 5SZHB 1P5FA 1RJGA 3H4TA 1VG9B 3DTTA 4PFQA 2I4OA 4E4RA 4RMIA 1M5UA 2AFHB 1MJ5A 1RI4A 1YOBA 3OBIA 4MWEA 3WYEA 1SXHA 3I3SR 4GE0A 2ENWA 2HJSA 3VDNB 2C1ZA 5IYZF 4CKBB 3PHGA 4NDZA 4UEWA 2YRWA 5DK6A 3R0QA 2JD0A 3MJHA 1E1RD 1PP4A 1Q0ZA 2YX1A 3O9ZA 4RPHA 2DUMA 2EFHB 3RI3A 1WLSA 2EP5A 1B73A 2JEZA 4WDQA 3HJRA 5G1NA 3RYFB 5TXGA 1AE1A 1DRVA 3CZPA 2GSDA 1MV8A 3DOFA 5LVAA 3KQHA 3BGDA 4DSAA 1J8YF 4B4WA 2E4UA 2JS7A 4WNAA 3C7DB 3I61A 3KFVA 3JQ9A 5KNCD 4J2TA 3V8BA 4ZP1A 3TIIA 4B47A 1ZJYA 3RRZA 2F90A 4BGUA 1I24A 2VNHA 3KCQA 3RTGA 3O2NA 1X9GA 2HB6A 1BRTA 4CV3A 1KFEB 3DR3A 2C7VA 1H1LA 5D51S 5LNK6 1W96A 3DLIA 4L16A 5TMBA 4EX7A 1TQ8A 1Z5GA 2FF5A 4DIBA 4ZCTA 2QVBA 1QSGA 5GJCA 2RAVA 4ND1A 4NDAA 2A0YA 1I4TD 3RBAA 1NYTA 4O4LA 5IT0A 3Q0IA 2IH5A 4IGFA 2GCNA 4Q9AA 2YJTD 3C74A 4GUAA 4B9EA 2IHUA 1TAUA 3HVHA 4AJIA 1CHDA 2JLSA 3GD7A 1HMPA 3DLCA 2O8BA 4MUBA 2XOEA 2XGMA 4JYPA 5BMOA 2C97A 2FR8A 1RLDS 3H11B 4LJ7A 1YI1A 4XB1A 3ROMA 3V1MA 2H2DA 3OHPA 5LOVB 2VTDA 4R83A 4L0MA 4C6SA 4Q03A 4AS1A 3TG8A 2J09A 2CNWD 2QM0A 1VFPA 3B48A 3WBJA 2NG1A 2CDAA 4UASA 1X7GA 2PO7A 3OSZA 2F1RA 2Q1UA 4G56A 4CN9A 3RC2A 3VTZA 3EXIB 5A5FA 1BXKA 1CQJB 4J0FA 4QQNA 2FLVA 4PZ9A 3B70A 1VL1A 5EZSA 1H65A 1GNTA 5LU8A 2PKQP 2HA6A 4KKXB 1QAOA 2VK4A 1IN5A 2OVFA 4ISBA 4FR0A 1VLLA 4C03A 5EKXA 2M6KA 2CVZA 1OGYA 2ZVJA 2IZOA 1G0NA 3I5YA 2NW6A 4RPGA 1H3EA 2B4AA 3CZ4A 4P08A 3TBFA 2OKCA 1C4KA 3F5QA 4ZYWA 3R9WA 3WBKA 3QLEA 3PGA1 1IQPA 1MA3A 1W5BA 4ASUD 4C4RA 4ER3A 2B69A 1SBQA 2YH2A 2P4SA 3NYIA 4M0MA 4DIDA 4WCFB 1MOSA 1VM6A 1XQ1A 1OTYA 2BTOA 4YYEA 1X8KA 2ZR7A 2V65A 2JG3A 3O75A 3RYHB 2YHUA 1O4WA 4R05A 4J3NA 4HUTA 4GBMA 4UMEA 3BQMB 3EVZA 3JQAA 3BKXA 4TXHA 3USES 1JAXA 3OTQA 1YE3A 3DUFB 2GWRA 2O2IA 2Q3HA 1NBMD 4BEVA 3U61B 1A71A 1OH8A 1MAAA 1T2NA 4QULA 5L3SB 3DQQA 2QDKA 4IDOA 5CB6A 1LLCA 3FVQA 3MLBA 1GGFA 2PNFA 4L28A 1HLDA 1J33A 4B79A 2RHHA 4PQGA 3RS3A 4F56A 5LP6B 3T9DA 3AHIA 1D2AA 4R2WA 4R3UC 1E1MA 3G89A 3OZIA 4JLVA 4M8LA 4TSFD 2G82A 2XJ4A 3ZV6A 3ZHQA 4YMTA 3FCOA 4I0WB 4FGJA 2VPQA 4LF5B 3QI2A 2GYWA 2VRCA 4CLOB 1BN7A 5FD8A 3BWEA 3K0FB 2Z09A 2QQ0A 2B0JA 3GMSA 1N2OA 1Z2CA 1AM4D 1JVSA 2F6RA 1YSCA 4DUZB 1UZHC 4Y2SA 4E4YA 2NUAA 5KNDH 4AYTA 4KLNA 1EVYA 1PR5A 1ZGHA 4F46A 4PM4A 4QUGA 4AMBA 5LZ4A 3AXKS 4TVOA 3VFDA 4X66B 3GRPA 3G68A 5G0TA 4WXRA 2L2QA 2ODNA 1DMSA 2A33A 1S5PA 4NBVA 5CAEB 2O1EA 5DM4A 5HVNA 1AV7A 3K8YA 4JXJA 1F8FA 4RDHA 1GYQA 2VQEB 4MUEA 1NBHA 3B2QA 2PMCA 2MU1A 4Z3DA 3TKAA 4R0VA 4KR3A 4F3TA 3EDOA 3IP9A 3LRPA 5JXHA 3QXHA 1PEKE 1NOIA 4E1AA 1DC7A 1F4LA 3M2TA 4HTFA 4RANA 2H0QA 2PLNA 5CJJA 5CRIA 1CF4A 4R41A 5G40A 2HF8A 1KHTA 1C3EA 3JQFA 4MITA 4RMHA 2OZLB 2QR5A 3AXMS 1QH0A 1ZKDA 5GGYA 3VGPA 3VZPA 2JIZD 2GEUA 4PZZA 3RRBA 5E3JA 8ABPA 1ZQ1A 3IXLA 1ADBA 2Q3EA 2BFAA 4IF4A 2ATCA 2VJOA 4QOJA 5JQGB 2WTEA 5DNDA 2YASA 4I8DA 3WB0A 3HN2A 4Z9BA 3QG5A 4HPWA 4B3JA 4P93A 3FUWA 3NZEA 4ND8A 1Y81A 1H9AA 3BTUA 4E6PA 1YJ5A 3PKJA 3UC9A 1PD1A 3DLAA 4FGKA 4OUKX 4ZVKA 3WLQA 2ID4A 2CVFA 3DV2A 3CUVA 4ZHQF 3KWJA 1M6HA 3T9FA 4EJSA 1NA5A 3JQCA 1P7VA 1UOEA 1WEKA 4PSDA 4TLMB 2ZUUA 5BSUA 4KX5A 1WVIA 4N5IX 4QDOA 4R7ZA 3ZD9A 2FFHA 1OZGA 1RRVA 3DTYA 4KXMA 2F17A 4S1WA 2DTXA 1T4CB 2OFPA 4Q1VA 2ZIVB 2VQDA 3LHIA 4QVGA 2VBFA 5IDVA 2QX4A 5GOTA 2ISQA 4FNAA 4J0JA 2V3VA 2W2OA 1MB2A 1MQ8B 1Y4SA 4AU1A 2BPOA 5B7PA 2C99A 1RYYA 3R23A 4X7BA 1A77A 2AA3A 3I09A 1AUSS 1SRRA 1EX9A 3OZ7A 1CWUA 1FK8A 3LQKA 1EFCA 3ZCPA 5JMWA 2VYQA 1IRXA 2A3NA 3B9PA 4HAXA 2BJWA 2DC1A 1SC6A 2VDJA 4MMZB 1RXEA 3K1JA 4MULA 1NAIA 1Z2PX 4CIWA 5K7SA 3JQ6A 3IVAA 3JATA 1BU5A 1P0CA 1FQJA 4F6RA 2W6CX 4EVQA 2PUDA 3NVAA 4P35A 4F2PA 4Q4JA 3HKCB 1YZUA 2DFVA 1EI9A 2OXRA 4X20A 3RJZA 1M9NA 3LC7O 1J0AA 5IYZA 1D2CA 1C4WA 5ICMA 4CEHB 2QIPA 3HYRA 2Z4RA 1RZRA 4FEGA 3GGOA 4U5QA 3NTUA 4DJTA 3SQXA 1G5TA 5HS4A 1RMQA 2C2ZA 5EOVA 1GL9B 3BMQA 3HJUA 1BRMA 1PZEA 1J56A 3B51X 5A2GA 1OVGA 2FGJA 1AQIA 1ZN9A 2FUG6 2VHCA 4G0NA 1HE2A 5T41A 2BHNA 1EVIA 2XQVA 2ZJ7A 4DDUA 4UZFA 1Z62A 3I8XA 4AICA 1NNLA 2EKQA 5ALDA 4B6RA 1XAJA 5J5AA 1WU7A 4XYGA 5HKOA 1HQCA 4NNOA 3PJFA 1ZOSA 3LE8A 4CL8A 2ZS8A 4REQA 3L7DA 3FMFA 4D3SA 3DBRA 1D4OA 3RC7A 1NUQA 1XDWA 3WRYC 4GMDA 3AEQB 5JH7B 5DM1A 1CUXA 2RD2A 3K2EA 1YZHA 3IIEA 1MFPA 2VDHI 3R4VA 2FE1A 3IVGA 4KXLA 1YBVA 1ONPA 1PCXA 4QVKA 3VX3A 1U0GA 3Q8KA 2R6CA 2Y68A 1KC1A 3YASA 4HJRA 4KWIA 4BGIA 3LF1A 2IVZA 4X8LA 1EBUA 1Z4NA 4QFDA 1TM3E 1J39A 4IFEA 4Q37A 3RIXA 3DDOA 1L4LA 4KYUA 1N2CE 3AJRA 3OEHA 4OKSA 4TWAA 3RRXA 1Q1ZA 2CNBA 1AZTA 3UWMA 1PGQA 4MB0A 1IXZA 2YWRA 4IQ4A 4BQEA 1I4DD 1VSTA 3WKBA 4AN0A 1SBZA 2GN8A 3TQFA 1STOA 2EL7A 2HJGA 3IP1A 1KVUA 1N5RA 5C35A 4UHJA 3SJZA 3D8SA 3X1YA 4PXAA 5KINB 4GLLA 1HDGO 4G1VA 4DDHA 3UO8B 4QPJC 4G84A 1GUDA 3N2EA 4O08A 4JOBA 1MGPA 2DPMA 1E77A 2O2YA 1JP7A 4HGPA 4CKYA 4H59A 4EO9A 1ZMRA 3E03A 4G1FA 3HK2A 2ZB7A 1FSSA 5HZKA 2PKRA 3UJ3X 3F67A 4C6TA 1SY7A 2EFYA 4PPGA 5CHEA 4I8XA 3EVCA 1O58A 1HUQA 2WYWA 4HEQA 4P54A 3UAZA 3C3XA 4HAOA 3IMGA 3TW6A 1WHSB 1A2BA 1YBAA 2MSCB 4LVNA 1YQGA 4PWZA 3V8NA 3WL7A 4DXDA 3WKDA 3K70D 1PE0A 1M73E 1OT3A 4RHEA 3WK9A 4D9IA 4BFUA 3D6JA 2Q50A 4F0KB 1A4UA 1Z5VA 5B1SA 3T3EA 3ZQUA 4HZUA 2GA9A 4L7VA 4LJKA 4UD2A 2I54A 2E3JA 3AF3A 3EBOA 4MO9A 1DKPA 3BAZA 4B3MB 1I0ZA 3ROEA 1DAEA 1ZAKA 1GPBA 1W52X 2HHLA 1DXQA 3EUWA 5CA1A 1QWOA 4TZ0A 3C6XA 4OH1A 5KI6A 3OG9A 5A4FS 3VR3D 1MVOA 1YXMA 4JVOA 1ZOIA 4YRQA 3WSTA 4M83A 3RK4A 2EERA 3VISA 2CHUA 3LT2A 4UOQA 3TEMA 4JR1A 2VHWA 2JATA 3V32A 4R6WA 4JC8A 3VO2A 3W2EA 4RE6A 4B84A 1M1YB 4LOAA 2G4LA 2DYKA 2OHOA 2C3YA 2JGDA 1RDFA 3PHJA 1U63A 1CRQA 1D8AA 2VDKB 4ND4A 3MJTA 4XCVA 5DBHX 1SVKA 4TMZA 2Z3WA 1VJGA 5CM2Z 3GBPA 4J0KA 2DT8A 1NE2A 5BN3B 1E6KA 1M2NA 2CZCA 2R8RA 3H6HA 1R8QA 2AH5A 2QN6A 3CLHA 3H2HA 5ALZA 5KKCA 2YKGA 2HWXA 2VDPB 5KYWB 4ARSA 2CFRA 2J9YB 4HEHA 4KI0A 3EGXB 3Q4GA 4AQYB 4KE8A 3PT9A 3PJDA 2AMLA 2VN8A 2W2TA 3OOWA 4Q4HB 4RSGA 3ECAA 3G1TA 1EIZA 3W90A 2Q5CA 2CL6X 1JFRA 4BB5A 4CFYA 3WTBA 2OY0A 4Q4LA 2GZMA 2WJYA 4JUDX 3FOEC 3KOOA 2RC5A 1MH9A 4Z0PA 5THXA 5AUQA 1QX4A 1GXSA 4YQFA 2XUFA 1TUGA 1YC2A 2FSUA 4KRFA 1DOZA 3L6EA 3O8LA 5J58A 2XVYA 3CF0A 1Z63A 4GMGA 1L9KA 1RE1A 2GAFA 2W6JD 4WJKB 5DBGA 4PYLA 4TKLA 4EFLA 1GCUA 4J9UE 4UBKA 2WLSA 1G5HA 3NRCA 3SBXA 3UWOA 3WYDA 3RS5A 2D2FA 1P72A 3I5MA 3UAGA 4AJPA 4L50A 4D1YA 4CM3A 2NPFA 2JFVA 4UUAA 1ID8A 2RGBA 3IR7A 1W4RA 1XZPA 4OYHA 5DGCA 2JK0A 3W04A 3WGJA 1ZR4A 4U6SA 3ZVLA 1GCGA 2RGGA 3GUUA 4BN0A 3ANXA 3L18A 4ZOLB 4BBAA 2NPOA 3GW8A 4WLOA 1E9VA 3R3ZA 2BFFA 4N03A 1FE8A 2R5NA 4AMGA 2C54A 4C14A 4ZHQA 3L7CA 2YJ6A 4A2PA 5FBQB 1P2UA 2NU6A 3C3CA 1HNZB 1LD3A 1Z35A 3BE4A 1EVJA 4QYSA 2WWIA 2QLNA 1OU4A 3HDYA 1JEOA 1IG0A 1AO0A 1JS1X 4KV7A 4Z0NA 3DL4A 4C0LA 3RAGA 2ZR9A 4BGDA 1XIVA 2DZDA 3WJAA 2IOYA 4OXRA 5EHZA 3FUUA 3TQSA 3MWEA 1N6NA 5M5BA 1AQJA 5A05A 2IYUA 4NULA 4ROSA 4EJ0A 5BUZA 4RJTA 4KMSA 2XWPA 2H59A 2C2YA 3WLRA 4BLVA 5JZMA 2FEOA 2YIVX 1SXJD 3RK0A 4MRMA 4M1ZA 2XCTB 3S2UA 1KEUA 4V2UA 4IQ8A 3VHQA 1X8JA 3FOBA 3VX4A 2A59A 2BTQA 3DDCA 1L5GB 1C0IA 4D8UA 4G4SP 1R66A 5LOVF 2IK8A 3L8MA 4M0KA 1V3UA 1XT6A 2CNNA 2ZJ2A 3N59A 1IFXA 2ZE8A 2YY7A 3P71T 2VBCA 2CXHA 1J5EB 3OOJA 5EMLA 4J0DA 1SVWA 1HO3A 5BUSA 2ONZA 2X5OA 4RCZA 1SNYA 3BRWD 3NRBA 1KY3A 2BFMA 3K8ZA 3KYCB 5JMTA 5KQLA 3WBBA 5KNDD 4GPIB 4WXMA 3CH6A 5HIKA 3HSKA 1T0IA 1XXHA 3G79A 5HJ5A 1WV1A 3OC0A 3BH0A 1PJTA 2BKVA 3FH0A 1M72A 2NQTA 2HR1A 3JR7A 1QVZA 3Q0TA 1ORVA 4JCCA 1JQDA 5IASA 4JR2A 2XVMA 4CT4B 3ICOA 4DFDA 3DE5X 4MKZA 2K5UA 1FLVA 3CCCA 2MSKA 2XUDA 5T8KC 1B42A 1EP9A 1XZHA 3PDUA 3QE3A 4U63A 3TTWA 4Z2AA 1ZR2A 4YN3A 3SJCA 2WJAA 3A4VA 2JI7A 2Z9BA 4P83A 1C4XA 1L5FA 2GDJA 2ZI9A 3EJWA 4G3XA 2WAMA 4G1BA 1E1YA 1PWEA 4JDPA 3KVOA 4ODIA 4WXYB 5E1BA 3T7JA 5DCUA 1I10A 3PR3A 5HE9A 1APBA 2W2LA 2ACVA 1H2WA 3ADBA 3MA0A 4HGZA 2XRYA 3LPAA 1FP7A 2NQ2C 2QR3A 2I4LA 3RF6A 5AM1A 1GPDG 5JD3A 2A0UA 5LWHA 1D04A 4BNFA 1W4ZA 3JWIA 1OLXA 3THYB 2NAFA 2GETA 1JA1A 3KXKA 2QTFA 3AH8A 4B46A 1X77A 3WMRA 4JI2B 1NW6A 4WQMA 2P2NA 4OFBA 2Q1WA 2UXBB 3T38A 1M7BA 1PR4A 4NECA 1CUSA 1DAOA 5LQCA 1HEIA 4EYGA 4GUDA 2VATA 3H5VA 3HU1A 5IW8A 5IEJA 1Z17A 4LX0A 5LP6F 1KI1A 4FHGA 4H1TA 1NZJA 4FWIB 2IS6A 4ZJYA 2XZLA 4DR1B 4D6XA 2B3DA 1LBQA 1RTTA 1JMYA 3JXEA 3TR0A 4GPZA 1Q92A 4WZAE 3THWA 3IBSA 1X1TA 2NV0A 3V8MA 2ZJ0A 4PPNA 2HIAA 3K6RA 4I19A 1SVNA 2ZT6A 1MT0A 3G8YA 3KFXA 3QH4A 1N6OA 1PL6A 3NFYA 4H7IA 4PG5A 5FB3A 4F0HB 3HCPA 1J25A 2G1PA 3GFSA 5DU2A 4O3MA 3N8GA 5C32A 2AN9A 3F4KA 5DEIA 5K8CA 4K1XA 3IVCA 5LC1A 1VZ2A 1EM8A 4EY7A 1PL8A 4MVJF 3W0LB 2HWUA 4G67A 2XCOA 3F5FA 1E66A 3S1LA 1M2GA 3H9QA 3KELA 2XYRA 4MUKA 1PFQA 2QV7A 3E81A 3DLBA 1LNSA 2ZIEA 4FS8A 1ZRMA 3TZQA 3IQFA 4PS1A 4PO8A 2O8EB 4YAGA 1RJEA 1YZTA 2VT7A 1I5EA 3AUJB 1FFAA 4NV3A 4CG0A 2YWGA 4S0ZA 3TE7A 3GFRA 3ZKWA 4LDRA 3K92A 2X23A 2PZAA 5KHAA 2N0SA 5AOBA 4C0AC 1DEAA 1MX9A 3EEQA 4PZCA 2RKOA 1DKNA 1LPMA 4QOIA 1I4WA 4QOHA 5CXXA 4DC1A 3VHXB 1H6BA 3ZLTA 1PT8A 1QPBA 2OBBA 3WIUA 2AG5A 2NU7A 4HJXA 2V0CA 3H86A 4ZJUA 2G77B 2OZVA 3OD5A 4QE3A 3CIOA 1NXTA 5C80A 2JIPA 3EWNA 5JQGF 5JPDA 4FZRA 4UHBA 1QYXA 4GYKA 3QX3A 3ANTA 3HUEA 2EHJA 4DVJA 2QAGB 4CQMA 2OO5A 4OHCA 3UMCA 2WP0A 3K31A 1PU2A 4MJ3A 4NG5A 4B7CA 1AUPA 1KYWA 2J0VA 4M2LA 2QN2A 1FDOA 1U1CA 1HL3A 2GN0A 4HLQB 5A0TA 1IM8A 1ARZA 1M34A 2JA1A 2JAWA 3IPCA 5AVTA 5JV5A 1OA1A 1N1DA 2PVSA 2VZLA 3IX7A 5ADWA 4B87A 4EHJA 3L02A 2WF7A 3OLQA 2PD6A 1BA3A 5FOWA 5E9JA 3FBWA 2ODBA 4E1VA 3KJHA 3PUIA 2X4LA 3FA2A 3I9V6 1R8YA 2J5QA 4Z8XA 3S5JA 5ESWA 1E4EA 1X7YA 3HLYA 5HF9A 3VKFA 4F5YA 3GLHA 4RKWA 5BMVB 1QQBA 4M21A 4J2OA 4Y2YA 4ZU6X 3A6KA 1N2SA 5ULLA 4ENWA 3A9TA 3AESA 1JF8A 4MQ6A 2QN9A 4QRDA 3PFKA 4TWRA 3WB2A 4BFSA 1X7ZA 4GWLA 1YQWA 2OD2A 5BV7A 1J20A 3K2BA 3TOSA 2YCBA 5DHSA 3VHRA 1C3OB 5IHPA 1JKMA 3CF4G 5ICSA 2QMZA 5D3KA 1TQ6A 3OCZA 1Y8QB 3IEKA 3SMQA 1JU3A 3DS8A 5EKDA 3GF4A 1W76A 3GMIA 5FUBA 9LDBA 5LKRA 2V6GA 1U9YA 3M1AA 2O48X 2ZYAA 3I28A 4M1YA 4WCVA 3Q88A 5CJPA 3UV6A 4DSNA 3T3GA 4MKHA 2V8OA 1YMUA 1JIQA 4RKEA 5A4KA 3CX8A 2AFHA 4HH4A 2PAAA 2QMYA 4RQBA 3OJXA 3QWBA 2VSNA 1CUJA 4JP8A 4DCNA 4AXXA 4E5DA 4CKBA 2JIDA 1D7OA 1QHIA 5BYKA 5CG1A 2H8GA 4PCAA 3EXHB 1B0AA 3RIEA 1PLJA 3KJEA 1QGAA 1K6JA 4ARAA 1BROA 3RYFA 2X1MA 4DSZA 3OICA 1ZY2A 3FPGA 3SGLA 2Z4TA 4QRHA 3WAJA 2O8FB 1VJ1A 1DEHA 3ETEA 4KHZA 4ZT2A 1IXYA 4K87A 1J97A 2HW8A 2N1MA 4RTPA 4HPJB 2WBLC 4J7UA 3GA7A 1IBKB 8OHMA 4P4TA 4XZ3A 2ZIAA 4QPZA 3WV4A 3O4JA 2M32A 2ID9A 3WX0A 2QGNA 3SK0A 2ZDQA 3ZXIA 2J3LA 1BZYA 5JH7F 1IDOA 1DIHA 5AW1A 2VUIB 5KB3A 5M04A 4IH4A 4RJIA 16PKA 3PV0A 2GFHA 3ODGA 3HXMA 2Q29A 3IVRA 2ZIZA 2A6PA 3VVLA 2A86A 2AE2A 1TZ2A 2QS9A 1DG3A 1AKTA 1PW7A 3CURA 4C4XA 3EPKA 3KX2A 5L3ZA 5K0JA 3H1PA 2C3UA 1BGXT 3CLSC 4UVIA 5GVRA 3NBMA 1R10A 3H11A 1P0MA 4GIBA 4N8EA 1N77A 4ID9A 1NRWA 2UAGA 5LOVA 1WW8A 2V8BA 3Q85A 1RRFA 4XOUA 2BOVA 3F1LA 1R3UA 5KTKA 1R0KA 4MW5A 1DO8A 2BONA 3AWDA 4NAVA 1MPTA 5FR2A 9LDTA 3C8HA 1UKZA 2ZRLA 4IDQA 5FNZA 3SKYA 3V7UA 2B9VA 1CQJA 4KGXA 3RC9A 3QJGA 2O0HA 1QFMA 4BVAA 5C7YA 1JZQA 5JARA 1W36B 3HY4A 3ZWQA 3BVPA 3TTXA 3T4UA 5CEJA 3AR6A 3STVA 2B82A 4V0LA 3FMOB 2W2KB 2E6UX 4QJIA 4YACA 1NAHA 4EW1A 4PG6A 1ADJA 2F00A 2IXDA 3NWJA 5CVCA 1Q20A 2DFKB 3WLAA 1T9GR 2EKDA 5CFRA 1QRAA 3FSJX 4GC9A 3LHFA 4RHFA 4HR7A 4QTUB 4P4SA 3SLRA 3SFZA 4MRPA 3I72A 4ECAA 1U80A 4OF4A 1Y5MA 2WC1A 1UDCA 3FNQA 3JQPA 4BKOA 4CLRB 3F5SA 2CNOA 3OPYB 3EVTA 1CIPA 4HN2A 4WCFA 5AKYA 5DI3B 3K9NA 3LUJA 3Q3IA 3EPJA 3RYHA 1THGA 3IGFA 2XR1A 3H2JA 1SUPA 2HWYA 1OYVA 3BD6A 2G0AA 3AVUA 1OFVA 3DUFA 1ZJ4A 5DNYB 2JI8A 5C5IA 4YQYA 1KBZA 2ZTMA 3ZEIA 4UAUA 3STHA 1U8ZA 2GMWA 1SU8A 4FZVA 3WJ7A 3GDOA 1OB5A 3AGPA 2WJJA 4Q34A 5BSFA 5TGTA 5JQWA 5LP6A 2GOYA 1R64A 1PR1A 3TQQA 5EPOA 3RS0A 1RCFA 3DFKA 1DI0A 1RAGA 4WINA 5JNSA 5GIOE 3DMHA 4LYFA 5DGTA 3PQ3A 5CFZA 5G0UA 4EW2A 3AUUA 1CR2A 1YA4A 4ZC8A 1VGRA 2A14A 1EWYA 4KXQA 1CRWG 5DNUA 2BGLA 2Q41A 2WPDA 3K9BA 3WHLA 1HDEA 4YPOA 3C1UA 1SCDA 1LS1A 1N8KA 3U80A 1ATIA 4CF4A 4Q4AA 3UEOA 5BW4A 2J9GA 1YB1A 4W1QA 2Q4TA 4KFUA 3COSA 4CF3A 2VHTA 3DKPA 1L7EA 2ZYSA 4FYHA 2X0DA 2A5DA 5HGXA 4YQEA 3UWPA 1T36B 5CAEA 4ZZIA 1X1AA 2RDMA 5I4IA 1GTRA 1CB0A 1WKCA 4IJQA 4Q3KA 4KREA 2IEBA 4FEEA 2J0UA 2YV1A 3JALB 5GQSA 1ZA2A 3WYCA 3CZ9A 4TTPA 1Y8AA 3U4GA 2VNSA 3HI4A 3E5RA 2V7QA 3EDRA 4HVAA 4PN7A 5K3CA 4LY3A 2CY0A 4KUEA 2F1JA 3RUCA 4P5DA 3SHQA 2P6OA 3FOZA 2OZLA 2RHGB 3EPPA 2OE2A 2Q27A 5AM3A 4LTMA 5BUQA 2MSNA 4ACBA 3NM5A 1T3SA 1AQLA 1NI4B 1ZM9A 1JAYA 2RE8A 4URXR 4CMGA 2YQ4A 2HAEA 1N9GA 3OIDA 5JS1A 1A04A 5JQGA 3H97A 4YC7A 1KY5A 3IJEB 4YIKA 1QHXA 1FMJA 4A6EA 2YJ4A 4EA7A 1RXWA 2J5XA 4ZOLF 4AN1A 3A3NA 1FMCA 1JDPA 1XMVA 3DFIA 3U4IA 4ZTZB 2PBLA 3KO8A 1HM5A 3DDHA 1G42A 2CJWB 4OSOA 2WE8A 5LQRA 1FQWA 3P0HA 2CKMA 2H9IA 2VPTA 3AOGA 4Y2RA 4K9NA 4EO7A 3EZFA 4JB8A 9ATCA 1C9EA 1UK6A 3FBTA 5ICFA 2P6NA 5FR1A 2BKUA 2VJKA 3NV9A 2VHQA 4H35A 3CIFA 1KL7A 3GFGA 4ALLA 3NBAA 4N4AA 1KZ7B 4V0OA 4XJXA 1EFPB 1BFUA 1KJJA 5C3UA 3WQBA 3CN7A 4MPTA 3A9CA 4AO7A 2P4QA 1T9HA 4OHKA 1CHNA 4D4LA 1L5NA 1EWKA 4EA8A 2O1WA 3A31A 2QTZA 4FKMA 3IE0A 1USWA 4YFYA 2D5IA 3PJEA 2EJCA 4AUNA 3MPOA 2V59A 4ES6A 2ZUBA 2QTGA 3OQ6A 1YDEA 2WMOB 3PHIA 3WR5A 5DX1A 3TO5A 5ICEA 2HXGA 2FMFA 2I4NA 3BERA 4IH1A 4RVDA 4RC9A 3AZPA 1BE1A 3D8RA 4YALA 3QXGA 4N3BA 3WLLA 2PTHA 2JFGA 2WKSA 1WEHA 3GB9A 4EJ6A 1LK7A 2VP3A 3UJAA 1G291 3MPUA 4RFLA 3HB9A 4ALNA 1OT5A 2WUFA 3EEYA 4NWIA 3AEKB 2R7AA 3BJIC 4X65B 2R9VA 2VZ8A 4BMVA 4TTTS 5IJ9B 6ABPA 3CC8A 3EXG2 1DTSA 3T95A 3NB0A 2FW6A 5KMGB 4U7WA 2H4HA 4GRIA 1JEJA 3A9RA 3OF2A 4I9NA 3OIFA 4CW7A 1LVHA 1Q21A 3AEYA 1GGJA 4HDCA 1G8FA 3SLKA 3X1DA 2BH2A 1QGDA 2IUSA 3HRKA 3QW4B 5I9BA 1DWOA 4CEHA 2MSWA 4F4HA 2W6ZA 1OILA 4IINA 5K0BA 3UB3A 3ON5A 2VP4A 1BAPA 2G40A 1TMYA 4QXQA 2I2DA 1G9SA 1GT91 3LUGA 2OO5C 3AFIA 3PYXA 4P38A 1EBFA 5FNVB 1P33A 2PKXA 2PX8A 3ZS9A 2BC9A 1BG6A 5E6RA 4RL4A 2HO4A 5D84A 2RK3A 3OFSA 1TC1A 1GAWA 3VBCA 5IFKA 2B30A 3UUWA 1F6DA 1UXOA 3OZXA 4JROA 2QVLA 4LXQA 5JSUA 2BFDB 1XKXA 5B53A 1YNSA 3UANA 3MFQA 4LZOA 2WU3A 1DUSA 2C2MA 1NVXQ 3P5SA 3PPXA 3FPEA 4XOIA 1EFVB 2NVUA 3NHWA 1ATZA 1ODCA 1W9HA 3GT0A 2OV4A 3AEQA 1UDXA 4IIVA 3TQIA 5JH7A 4QYWA 1JWLA 1F17A 1WPXA 1M1XB 1Z73A 4NZNA 4QD3A 5ES4B 1AUQA 1U9IA 1R4AA 4LZJA 4WNIA 5FOSA 4YUAA 5AVXA 1O96B 4O8ZA 1C9YA 1VPLA 2WYIA 2ZS9A 3MGAA 3T52A 3VH2A 2PO5A 1GYRA 5ED4A 4ZKDA 3AM1A 1C80A 3CNEA 4LMRA 1BQ3A 4KB5A 4OQFA 4YNBA 2W2NA 5J5VA 3FGNA 2W11A 3M9XA 5IJ0B 1G38A 4NG4A 4Z8YA 2HA5A 1J22A 1ACMA 2Q3MA 2SCUB 3AYXB 1EE9A 1CJUC 2WB4A 4WH0A 1W8DA 2G5TA 4E2WA 2VAMA 5HKKA 2ONKA 2C4HA 1WX1A 1USKA 1PS8A 1K97A 4BMYA 4EB3A 1Y1QA 2GD2A 4F4CA 2P6UA 3GLTA 3EIEA 4LV5B 3R8XA 4K9DA 2PSHA 3JD4A 2GM9A 1XCPA 2ZYHA 2WJ6A 3LDAA 3OJLA 1I3CA 2QDXA 1Z06A 2ZTUA 1BWPA 3OX1A 1OPXA 3QMWA 4G97A 4MI1A 3FZGA 4Q19A 3AHFA 1CJBA 3V7FA 2VTBB 2DTDA 3CLSD 4PE5B 2PRSA 2XKBA 3CBGA 3LZ6A 3PR1A 3HR8A 4KSBA 3C87A 3TL6A 4EQ6A 1VSUA 2V7WA 3GP3A 4JWTA 5ALGA 2RHRA 2P0YA 3G2IA 3JVEA 2VSXA 3C1OA 3GLFB 4D8XA 4C1NA 1EWVA 2BBSA 1CIVA 3DE7X 5C8YB 5ITZB 1WHSA 2QORA 2FVXA 1F6BA 4CCAA 3HJGA 1DHRA 1RKQA 4LF4B 2DX7A 2I7XA 2K6GA 3UYLA 4GP9A 2YMPA 5F64A 1EVQA 3L0PA 4FLMA 3DWGA 1OI4A 2ZRDA 2XVXA 4CFSA 3V4ZA 3DOCA 4JC5A 4JLBA 1D6SA 4DR2B 2I33A 1NI3A 1E79A 2X5XA 3OOYA 3PXEA 1Y7PA 2O2JA 4H7PA 1ZU5A 5DPMA 3RS4A 2IZ6A 3EGEA 4QBTA 5SV2A 1S8FA 3NO4A 5F21A 3WGHA 4CF7A 1B41A 4URYR 1C3VA 2FA9A 1FYVA 1VP9A 3ZHTA 3WV5A 3IO3A 4EARA 1IM2A 1OJ7A 4PGMA 1E5QA 2TMDA 5JNRA 4C0BA 5I7EA 1YS1X 1GPWB 1ZUD1 1ZUWA 3WIDA 5KQGA 1XTQA 2UU9B 4BMNA 2AZXA 2R86A 1J8VA 4KO2S 2ZB3A 4U2KA 4YP0A 4NOKA 4N6NA 4P8RA 5EJMA 1TADA 2HKIA 3GRZA 3JX9A 2OD7A 4FYVA 3BL6A 4GM1A 5T4EA 2IP2A 2YHBA 3W5VA 3WYAA 5FBKA 4AF8A 5D7NA 4Q66C 4U8HA 3VDMA 2XB2A 3REGA 3MC1A 4L4ZA 5DH9A 3ORYA 4YQZA 3V4VB 1GQYA 1RYFA 2YFQA 4QG7A 1U7XA 5JD5A 1EGVB 1LQTA 1P1FA 3JWGA 3GFOA 3MOSA 1TAGA 1D1SA 4XPZA 5KYWA 3EGXA 5ALNA 4MVCA 2IE8A 3OTWA 3TCXB 4R8SA 5BMVF 2A1UA 1KZHA 2VJCA 4I1IA 5TQJA 3DT8A 1P3JA 3HXQA 2GZ2A 1B26A 2E49A 3KNZA 4QDZA 1P1JA 3L7JA 1T8SA 3LOQA 4K26A 1D4AA 2TYSB 1RHJA 3IQZA 4DLXA 3L06A 3GRYA 4Z4GA 2I1WA 2J07A 2HX1A 4WBNB 1DQPA 5EKUA 1G0OA 4MGEA 1WVMA 1ZC4A 1A2KC 1SUWA 1XB2A 2WT8A 2P62A 4FI3C 1MCZA 4N3NA 1VPVA 1O6CA 3FUTA 1KE2A 1KDPA 2GO1A 2WVJA 5LYJB 3SR4A 3I62A 1MGOA 3N6VA 2VQ3A 2ZWIA 3WSVA 2FPIB 3M1YA 2RJOA 2WIKA 3UJNA 3OLYA 4QWWA 3V2UA 3L8YA 1ZI6A 1G7RA 1SHUX 4ENPA 4YRDA 5IHXA 1JXQA 4OFWA 3HJAA 5IM4F 1R6BX 1ZK0A 3A6LA 2RHDA 2BMWA 4UM9D 4I5EA 3CE6A 4ZOLA 2XODA 1G5RA 1OV6A 3L6OO 4P3PA 1QYIA 3Q3GE 5HIAA 4CCSA 5IVPA 3N5CA 5K6RA 1SM4A 4OQEA 1ESDA 1GRVA 4HWKA 4MV1A 4B40A 1PT9A 2WVGA 3TDMA 4ZHSA 1PG2A 1YA8A 2Y99A 2YMMA 4IDPA 3WADA 4L8WB 4BXOA 1VG0B 3BZUA 2P67A 4EHLA 4GKBA 1PGPA 4K6HA 2O2CA 1WM1A 2J3IA 2KWIA 1F2DA 2O3RA 1DO0A 2AUMA 3MTDA 4YCDA 2X42A 5BSTA 2WJWA 1XQYA 1LFDB 4RCVA 1WDMA 1I30A 1Z6ZA 3KYIB 4RTQA 3AVXA 4GDMA 3FCXA 4REOA 2XGJA 5DWVA 6ADHA 5DYNA 1TA4A 1XHEA 3G88A 2WU4A 1OR8A 2WSLA 3DVSX 4ISCA 2CJPA 1MW8X 3B1YA 3QJ5A 5I9TA 5EWMB 3PQEA 4A0FA 3LC0A 1LNQA 4C7JA 4B76A 2XQIA 3QX8A 1AHIA 1MD9A 1GD1O 4B1FA 1F1BA 5BWMA 1UANA 3LLCA 2F3SA 1FZQA 1FU7A 2OHVA 3KSUA 3WDLA 4CV1A 1E9EA 2OHFA 3OCCA 3FTEA 3HHPA 1FYEA 4OI0A 4F7WA 4WEOA 1GR0A 1I2ZA 3A6EA 3A4TA 4GS5A 4W7HA 2E4YA 4IYRA 3IBYA 1NKTA 4NEHB 3ZTWA 1T43A 2ZBRA 3P2EA 4G8BA 3IBTA 3VC3A 4FFLA 3RVDA 4B5KA 3T9EA 4O3FA 5LZ2A 4XEUA 1KORA 2A0WA 4DWWA 4BFCA 3F9CA 1PDOA 5CNIA 3AP2A 3QHPA 4MGKR 1NNI1 2YHAA 3KPJA 2HGSA 4MXDA 4JB3A 2FG5A 5ISMA 2JFBA 3LW8A 3F8SA 1OWMA 4TWBA 2RGNC 3THXA 1GQOA 1KQGA 5FWXA 1I3MA 3HNPA 4LZNA 2YV4A 1TZCA 1JNXX 1ZN8A 3TZCA 1H93A 3TTVA 3BJZA 4FSDA 3V2IA 1U7WA 2HIGA 1YIAA 3C0KA 3M4ZA 4TL7A 5FEUA 3BB3A 5DLQC 2Q7XA 2G9ZA 3QF4B 2CDBA 2GARA 3FXAA 4MPRA 3GT3A 2PV7A 3D4NA 3X3HA 2H1SA 2JIOA 1G3RA 2HQBA 4XRGA 4HF7A 4PNZA 4BASA 1YULA 3PVCA 4ID3A 4LXYA 4G85A 3M6XA 4X94A 4Y2UA 3VGJA 3LHSA 1C7ZA 1U04A 1ZSYA 1NLUA 2BR5A 2FQWA 1KKUA 1PKXA 3BWDD 3I2YX 3EX7C 3THYA 4L0DA 1C1YA 1XU7A 5K8TA 4TMFA 3SXUB 3PEUA 1H8HD 5CDHA 2FEWB 1NW5A 3R40A 3M6UA 4FDVA 1CTQA 4KLCA 1RC0A 5EMNA 3U7EB 4P7GA 2AUTA 5B1DA 3I39X 1TA0A 5EQFA 4P0PB 2DJ5A 4HEA1 3VYWA 2TSYB 1WPQA 2W5UA 1EZ1A 1NE7A 5JDIA 2II6A 5FUWA 1NN0A 2WJIA 3W2FA 1FXWF 1VLHA 1P2FA 5IAGA 4UQPA 1N6LA 1J9ZA 3LY8A 3IB3A 3QIVA 2G1KA 1GKYA 3B20A 1O94A 2G70A 1TTTA 1QTQA 1WW3A 1E6LA 2JA2A 3P20A 2FDRA 3PDWA 5AK6A 3WLNA 5CB4B 2GXAA 4AK9A 2ZYGA 1JKIA 1Z08A 3WVNA 1PVVA 1IY1A 4MB2A 5C5EA 1IY8A 4JGBA 4OV6B 3ZWCA 1N7IA 2OILA 3TZHA 1L4MA 4FYMA 2YMQA 1LK5A 2NSDA 4FNGA 4MV8A 4Q3AA 4EHIA 2O8CB 2XE6A 2QBYB 4C0JA 1UP6A 4ZRMA 3KP1A 1U81A 2QSUA 3JQGB 4JT2A 2WAAA 2GERA 2BISA 3KU4A 1RJFA 1NDQA 4Z4QA 3VZBA 3G8CA 5CD9A 1XU4A 3L7BA 2O8EA 1U1GA 1VB3A 4N65A 3KK0A 1IOWA 5EJ2A 2LDXA 3OOHA 5A7GA 1L8XA 1A9RA 5L3RA 2JFQA 5CGZA 4MKRA 4EIWA 3K16A 2GD1O 2D0DA 3B53X 4K7JA 3T34A 1W581 1EFRA 1Z12A 2FSGA 2OP1A 3LA8A 1IC6A 2J6HA 1H2YA 2EV9A 5KOHB 1KFBB 4D3YA 4OAOA 1QNFA 2XVZA 5FOTA 3VHXA 4IX9A 4ND3A 2BMVA 2EEZA 1V9LA 3D6FA 1U9IC 3IUBA 4QGGA 1FUKA 1P7PA 2WSYB 3VUEA 5BURA 2HN9A 1NMZA 2Q4DA 2YYSA 4HV4A 3DMGA 4FXPA 3ZU4A 2X76A 5F1OA 1J2EA 1J70A 3AOEA 4KQJA 1Z75A 4JH0A 2I3BA 1PDVA 2HPZA 2IU6A 2QAGA 2YN0A 4GL4A 4I1SA 3ZV3A 2G25A 1D3AA 2FRXA 4A8PA 2QRZA 4EI9A 5ELXA 4I6EA 5JOQA 4OHVA 1QPZA 3V97A 4L76A 1VJ0A 3QEMB 1DC4A 2IQIA 1P3Y1 3UUEA 2V54A 2WINI 2YVLA 3ELBA 1K7CA 1V47A 1E2LA 1LRKA 3T3MB 1GGMA 4JGGA 1EJ0A 1GGVA 4ZO7A 1WMSA 1V35A 2JI9A 3P7MA 9MHTA 2HZ7A 1KGDA 1LLDA 1P1BA 3DCJA 3B7WA 1FIUA 3TIXB 3AR5A 4EI7A 4BPRA 2GK6A 4URVR 5J4KA 3H6GA 3OJ0A 3PKIA 2O5VA 3QWFA 5EIWA 4BS9A 4EL0A 1HKHA 5BMVA 4JASB 3KQKA 4U7TB 1KE1A 1ES9A 1IN8A 3OECA 3TSOA 4IQGA 1PK9A 1I4EB 5I47A 4K0RA 2V7EA 1YE5A 1Q7TA 2NZ8A 3RIMA 4ZJZA 5JHGB 1G8JA 1G16A 3LT0A 4M7PA 2R6DA 5EE5B 1C3OA 4IP0A 5FO1A 5K05A 5JT1A 4LKRA 2ZVDA 4RCYA 5KU7A 1O3YA 4CUZA 4QDTA 3JQBA 2C9DA 4DL9A 5TF0A 2V7TA 4ZK6A 5JWRA 4G0VA 2NTNA 4R7TA 1NONA 2F1OA 1RXOC 2NADA 4PHCA 3VO1A 4ZARA 3A2MA 5JO0A 1QIFA 3HZHA 5MGNA 1XVIA 1YIOA 4QGHA 4U4AA 2OSBA 5DISB 5IM4A 2WTXA 2QZJA 3HO1A 1OI7A 1U6IA 2LW7A 4GKVA 4GR4A 4K9PA 4IDEA 3H4VA 1QH1B 5C2JB 4HN4B 3ZCTA 3EXHA 1O89A 4Q7JB 1RADA 1E7QA 1Q11A 1SIUA 1VMEA 2FWBA 3A6DA 3L5KA 3M34A 3HG7A 4HFJA 4U3JB 4ZGGA 3LP5A 3QYFA 4NMMA 5FNVF 4WXHA 3E15A 2PEZA 5FT9A 2C9CA 2GFIA 3VNRA 3LD9A 5MDHA 4AP5A 1O1YA 4RADA 1CQPA 4H77A 5E6SB 5IVDA 1DAKA 2FLKA 3HFJA