4QVIA

Crystal structure of mutant ribosomal protein m218l tthl1 in complex with 80nt 23s rna from thermus thermophilus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
229
structure length
229
Chain Sequence
MPKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTLGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein/rna
molecule keywords 50S ribosomal protein L1
publication title Protein-RNA affinity of ribosomal protein L1 mutants does not correlate with the number of intermolecular interactions.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 69
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4qviA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qviA02
1I2AA 4QGBA 4LQ4A 1U63A 3FPNA 3QOYA 5DM60 5DM70 1MZPA 3TG8A 1CJSA 1DWUA 4QVIA 2HW8A 3U56A 4DFCB 4F9TA 4REOA 3UMYA 4QG3A 3ZQJA 3U4MA 1AD2A 1ZHOA
chains in the Genus database with same CATH superfamily
4RFSB 3KSBC 4YRTA 2F9MA 1GTZA 4LRYA 4O4JF 4EZEA 1NVKA 5K3FA 1DKNA 2GAAA 5JOQA 4WCFA 1ZCAA 4AY6A 3FPFA 3UJ8A 1PDVA 3QVJA 3X2EA 1RKVA 1E3MA 1F60A 3SX0A 1KKLA 4ARUA 5AW6A 1IEXA 2V4ZA 3T94A 1C8LA 2FEOA 3FCUB 3HABA 2ZSBA 3KLPX 1PBTA 1TEXA 4ENUA 2YMPA 2P7IA 1J07A 3B20A 3DT6A 3Q87B 4RIIA 3T34A 3X2FA 1Y1TA 4D3YA 1LNSA 2EAUA 3Q5EA 1W47A 5EA2A 4BBPA 3I12A 1M2JA 1JQEA 1PNTA 3NM4A 5AI5A 1LRJA 2H1LA 1BKSB 1QLJA 5K0LA 3UGKA 2I99A 4GYWA 1M2OA 5JCJA 4OMFG 4PBTA 5IAKA 1FL9A 4OFZA 4YJ3B 2H57A 3QW2A 1UUFA 4L9SA 1QLHA 3AI1A 3MM4A 4FFMA 3IQEA 4IG4A 1FY2A 1OXMA 2A59A 4MPDA 4A82A 5JC8A 2AN5A 4E11A 2ZQ5A 4PANA 4Z9FA 1MCZA 3RS4A 2AI2A 1KAGA 2AOTA 4FYMA 1I2ZA 3Q3IA 4FFOA 4OOFA 1NDQA 4HKTA 1MOPA 3SYNA 3GCWA 1SK9A 1FQOA 3F7NA 1XDGA 1P3JA 4IJWA 1GHTA 4G4SO 1SEPA 5G0TA 3G0BA 5JDCA 2PT5A 2HL6A 3MS4A 4Q18A 1CE8A 3DZHA 3PUJA 4A7PA 5TIIA 1CUVA 4W5OA 4OK3A 5LOVB 4CG3A 4LBYA 1VM6A 2Q1WA 1Z13A 4PSAA 3T3EA 5JRDS 3A1FA 1NLUA 2HCBA 2OD2A 4GIBA 4N48A 1EXNA 1MP0A 4GKJB 4EVRA 1HUQA 4DMCA 1RRFA 2NPFA 4H0CA 2XB8A 2FR1A 2FPKA 1FP6A 2H6EA 3COWA 2LZ0A 4IG9A 3ZHVA 1RHMA 4IXNA 1E5TA 3G8YA 4WHMA 2I34A 4LHYA 3UNXA 3G79A 5DYWA 2O8FA 1E62A 4MW5A 2DY0A 2KWIA 2O0MA 1NT2A 3DFFA 1YE3A 5EE9A 2WVAA 1DEXA 2R0QC 1N5JA 2GB4A 4GEGA 1PS8A 1SUFA 2WM2A 1MB9A 3P71T 3BFJA 5FWYA 3AEXA 2CLDX 5BSHA 2RGUA 4J0GA 5BYBA 3BORA 3IL2A 1A77A 3OZRA 1ZNWA 2NO9A 2ZJ6A 3DMPA 3HU1A 2NLOA 3FDIA 1M2VB 2HEGA 1NVGA 3R77A 4K2HA 5B2FA 2OSBA 5LZ2A 2CZCA 2HLNA 1ORRA 3EIWA 1DS6A 1EUCB 1M2WA 2C5BA 5CH3A 3W3AH 4M54A 4RS4A 4RTQA 3MWJA 3TW6A 5BWCA 1A8IA 4A8JC 3H83A 4DIMA 2R87A 3ZGLA 4C43A 2ZJ0A 1TF5A 5C5IA 1ZSYA 1U8XX 3UH1A 3TG8A 1OU4A 3L0YA 5HEKA 3QX7A 1PKEA 4MCAA 1GTSA 2QX8A 3U4CA 3JXEA 4MVJH 1JU9A 2YWJA 1DOAA 2JCVA 3I92A 3BXHA 4ESVA 5BURA 3N7AA 2JLAA 4M99A 1CVLA 2Q2VA 5CXQA 4EUSA 3RHSA 3P7MA 5J63A 2WJ3A 4TLCA 1YJQA 4FGUA 2A1IA 4N5HX 4EHLA 1N2CB 4Q7LA 5JFTA 2GZDA 5DGXA 1JNXX 4AICA 4MTLA 3CSSA 2ZU0C 4UAGA 3KB1A 3V4PB 5EJAA 1YDHA 3RAEC 4EOGA 4RD2A 4ZDJA 1YBFA 4ZQHA 3LW8A 2ZRHA 1NI5A 3MCTA 4ZAFA 1TLFA 4GZLA 4JLOA 3MUEA 4QPNA 3ZUGA 4ZAVA 4LY0A 4IW3B 1J70A 3AVPA 2COEA 4YV7A 5IKMA 3OOJA 3E81A 1Q74A 3IXLA 1ONBA 2I55A 3UV3A 3HBJA 4KOEC 4UE6A 1L4HA 2WNHA 3K72B 2XH8A 1SXIA 3ORYA 4ES6A 5F76A 3PNKA 2XI4A 1FQJA 4BNGA 2B0JA 2NMVA 4XDHA 4FCVA 3VMMA 4ZYXA 4I50A 4RV4A 4C76A 4ZQBA 2BD0A 3SFZA 3C1OA 3HA7A 5J1SB 1NKSA 3AY6A 1B41A 2GFIA 1VPVA 3KEOA 1YA6A 1FOEB 2QF7A 2WP0A 1A2QA 3R3VA 3CZMA 4LGCA 2G4LA 3JW8A 4PE5B 3DH0A 1ISMA 3L0IB 1KEVA 2B9EA 1SWVA 1D1SA 1EX9A 2CLKB 2ISCA 4ARZB 3P2IA 3P9CA 4F8JA 2G77B 1NYRA 2PEZA 1MV8A 2HFKA 2VCEA 2IYQA 2WF8A 3BWCA 3PR1A 4GI2A 5IC6A 4BNIA 3IXQA 2I33A 4Q3EA 1QHSA 3AEKB 4BNNA 2KPOA 3CF0A 3ER9A 4ED9A 4LTMA 3EBPA 3LC0A 2IUUA 3K2QA 1IXKA 5LB2A 2XZTA 3CE6A 4O2AB 4FEYA 5GV8A 1PLLA 4B4KA 1IXYA 3LF2A 1KSJA 4Z5XA 1MZVA 2IXGA 3HBAA 4UHDA 3SI7A 5AUPB 4I81A 1PU2A 1ENPA 1EP2B 4Y2VA 1VJ5A 5C7IO 2JK0A 1VJGA 3M3DA 5JNWA 1USWA 1BXZA 4IXMA 4WDQA 4OHPA 4RVSA 4TL8A 3K6SB 4Q1VA 4DEXA 4I3FA 4M53A 3B7WA 1WCWA 3PNOA 1QO0D 1Y3IA 3Q2IA 2H5IA 4QDUA 3SEQA 3HL0A 2PMBA 1WY5A 1SWWA 3A10A 2VSNA 1YZKA 1FRQA 5HIMA 3UYLA 1UZMA 4EY8A 2AZXA 3I4CA 4FYIA 2F3UA 3TB6A 4MUIA 2G9ZA 4OQXA 4BZZA 3ZX5A 2WIKA 5TX7A 4CMIB 3VO1A 2ODPA 4HNAA 1D9ZA 1BHQ1 2GLUA 2DFLA 2W2PA 1LDNA 4EB6A 4CG0A 3JRNA 3H11A 1U2SA 3RSLA 1DC5A 4XGQA 2AEFA 2H85A 1V3VA 2ODAA 3IHLA 5IC4A 1G55A 3RYCA 3E70C 4M9SA 2H1FA 4KL8S 3B52X 3IAHA 3QUBA 1MG5A 3NHUA 1SAYA 3R3ZA 2Y0CA 5K4HA 1O6ZA 1PUJA 2WRZA 1Y3BE 4E32A 4QDOA 2ZT5A 5GAJA 2OQRA 5ICEA 3EG5A 4F9TA 3DDNA 2JZCA 3FRIA 2I8LA 3LUKA 3IMGA 3TN7A 4RMJA 1T3TA 4INPA 2GD2A 3CVOA 1J2YA 1DUSA 4OUDB 5IVIA 4HH1A 1JQKA 3K35A 4JMLA 4OXKA 2AEMA 4WKPA 1SVWA 4B4DA 3SJBA 1UP7A 3CGGA 4DZTA 1WP4A 3HM2A 3ZE2B 1DIAA 3M34A 3TPZA 3E4DA 3O90A 3ZS9A 3QMPA 1US8A 4O59O 4XDYA 4HRVA 3QU2A 4DJDC 3WLPA 3UJ6A 5KHLB 1AUSS 1XVUA 3A37A 3G9TA 1E77A 3QNUA 1RLIA 4EFNA 3AP1A 3M9WA 4FHZA 4Y9DA 5JSQA 2VAPA 3CSUA 3HKDA 4FKMA 1Z38A 2P62A 2Q6VA 1KOFA 2F4NA 3ZH2A 1VCOA 2I2XB 3ZV3A 1IVSA 5L6MB 2DPLA 4FD2A 3EISA 3MZ0A 4W8OA 4F4DA 3LUCA 3SEZA 3T06B 4YI5A 2YY6A 2PJRA 2CVOA 3E48A 4CKCA 2Y0DA 3NHWA 1L4YA 1SUWA 2K7FA 4P3YA 1QUFA 4UAVA 4LYGA 3RC8A 3NHKA 3LP6A 1PWYE 1WKBA 3LOUA 4QWWA 3MW8A 2RHGB 4K26A 5CXXA 1ZFNA 5FTWA 5HZGA 1H9CA 1T5SA 1JJIA 1V9SA 2IUEA 3GI1A 2OXCA 3WA6A 1N0WA 5CG2A 2JJ2A 4RMHA 3KQLA 1W8IA 2VPIA 3T9EA 3OU7A 4DLXA 5AXBA 4V0MA 3M1AA 3GVHA 1QF6A 5DN6A 4G1CA 3HYSA 1DUIA 5THXA 2DSTA 3MGCA 1XJCA 2OY0A 4JEIA 3NATA 3PU6A 5ALVA 5HXAA 2HXYA 4G8BA 5D3QA 4EJSB 1VA5A 1BDJA 2GTHA 2WWIA 2YJ4A 4FYXA 4DV5B 3C3XA 3EXIA 3M4NA 2VK1A 4FHEA 2JJYA 3KUXA 1A5BB 1ZR2A 1G9TA 3JYNA 2XNCA 5CGZA 5B55A 3WQQA 2QUKA 3L0SA 2AKEA 2POQX 4NEGA 2WUWE 4YV0A 1VE5A 2NSLA 2WJVA 3LL4A 1KNQA 1VHTA 3GEGA 5I7EA 4M0UA 5DNEA 4ND8B 4ZRNA 2P4EA 1HDCA 1PFGA 3WRYA 4O33A 1X7ZB 4DLVA 4YCLA 1LX7A 1X13A 1GT6A 5T5QA 4IH1A 3FPBA 4NX2A 2F2TA 2REXB 2B5OA 4RWEA 2OA0A 1XU7A 3SBEA 1GEEA 2QPLA 1K98A 3EQZA 3LPNA 4YAJA 3CF6R 3KQVA 1PK8A 5KCMA 2D6FA 3MIZA 4KXNA 4UBNA 1ZMOA 2DWCA 3L1HA 1RJWA 3ZV6A 4JXXA 1ONSA 1MJFA 2FY8A 1MFZA 2YV4A 3CNEA 4MP8A 3JWJA 3T52A 1NXWA 3NO4A 1MH1A 4FJ0A 3AX6A 5I7OA 5FOXA 1AKMA 5LP6A 5ALYA 3V1TC 4QHSA 3SK0A 1U8CB 3TDKA 4HMPA 5TPZD 4C2TA 1P33A 1ADBA 1M1UA 3IO3A 1MF7A 3L79A 3QHQA 2ZBQA 4H27A 4JLJA 1Z63A 3TOZA 3G8DA 3QPBA 1OTHA 2I1VB 1ESEA 3L04A 4IKPA 3DZDA 1XP5A 1QZXA 4WGFA 5DW0A 2FQXA 4DR1B 4Z54A 2NTYC 3CNBA 4IO1A 1BJRE 2G07A 4O3MA 3H2SA 2FRDC 5CEFA 2HWYA 5ESDA 4BO5A 1A72A 1TAHA 2FJPA 1YS7A 4DCJA 1NTOA 5JHGB 2H0QA 4UTPA 2Q1XA 3DXFA 3IC5A 4B7XA 4MKHA 4DLWA 4UUPA 3D5TA 1XRNA 2FXIA 1J8YF 4LYYA 5CDFE 3J80A 4BYMA 2A0FA 1T29A 2EF0A 3BN3A 3CISA 1FU8A 1S9DA 2C2OA 5GWXA 5JJIA 3U16A 2C9DA 2XB6A 3C3MA 5ALGA 2OGSA 2PGIA 2E6UX 2CXSA 2O1EA 3IO5A 1EKXA 1M2OB 2G5GX 2I9PA 4PY2A 5JVDA 2B4AA 1N6LA 1MB0A 3AR4A 4X71A 1N5KA 3BGSA 4TTQA 4PWYA 4A5SA 3L41A 1P7WA 4F2PA 5B7NA 1DJPA 5J4HA 5LU8A 3ESZA 3OURA 3QMWA 5L3QB 3KV3O 2L42A 1JDNA 4EGSA 3U13A 5ULLA 1X86B 1M5UA 2AOTB 1SCNE 4ZJUA 3QXCA 1MA0A 3INTA 1YULA 3R3HA 2OV6A 3TXYA 1L7EA 4FOLA 4MUJA 3RB8A 4YCDA 1MIHA 1PZFA 1KY5A 1W36D 1A7JA 1ZXBA 6REQB 1Z33A 1ECPA 4YDHB 1SQ6A 4F96A 3PQ4A 1XK7A 3FUUA 4WD3A 5CH8A 3FVTA 3PNMA 1HQCA 4JL5A 4XARA 3U26A 4D02A 4MR9B 1CE8B 3EOAI 1MDBA 5FEMA 2CHQA 3CEMA 5HDQA 1QGUA 1GO2A 4ZOAA 2X0EA 4M9RA 1Z88A 4IWXA 1VE1A 5H7XA 1A0OA 2ODBA 2OOKA 2C4NA 3CNQS 1AJEA 5KTOA 1DDOA 4X1IB 1YMQA 4EB8A 1GPKA 1LFAA 3GXOA 1R0WA 3N70A 4JYBA 5TXGA 5TEWA 4C5AA 4EYEA 5BR7A 4S35A 1SCKA 4MW6A 2RC6A 3A3OA 4DPMA 2XXAA 1VKOA 4Q1DA 2W71A 2DBYA 5EP4A 3ACDA 3EVAA 2RHTA 1QTQA 3BK7A 2QWXA 4HLNA 5KNBD 1SOWA 4EO7A 1QYCA 3P0EA 2FWIA 4ZK2A 3G2NA 5JEEA 5JAPA 2VSQA 3EZ6A 4Y2TA 1K6JA 3L7DA 3OTGA 1DO2A 1AS3A 2PSSA 4JBIA 5EXSA 3DPUA 4PICA 3LWZA 2CZQA 1Y48E 2IV7A 2DBRA 4M49A 1Y3HA 3AXTA 1XNHA 5SYNA 3JZAA 3MTQA 4FNOA 3UA3A 1PR2A 4BX0A 3RADC 1SB9A 2BGRA 2EX1A 3QVTA 1G8KA 1Q22A 2VATA 4BUJA 4MARA 1NMXA 1V16B 2H4HA 3Q3GE 2VJQA 2P69A 3A32A 4L22A 1G8PA 1UZDC 4FYJA 4R16A 5AHWA 2AF4C 1NM5C 4YRBA 2PRSA 3DA8A 3FNBA 3D5QA 2F00A 3QV2A 2B1GA 3A4TA 4IDDA 4PG4A 4LZJA 4LN1A 4EPVA 1UT6A 3KQTA 1TUEA 3I9KA 3R5SA 5EESA 4R8LA 4TKUA 6AT1A 3BL6A 1YRYE 4XUDA 4MKXA 1JR3A 4Y2GA 2LIVA 2FUCA 3K1YA 5CVCA 1E2KA 1TM7E 4EW6A 4CM6A 3C4JA 3EDCA 3NTOA 2ZI5A 1ZD2P 1Y6FA 1QYWA 3LA6A 1IMJA 3ZZ1A 4QRDA 1JKIA 5AYVA 3H5AA 1GUBA 3D3EA 2EL9A 3E7FA 4NEHB 4BLRA 1EUQA 1PHRA 4AZVA 3MFYA 4NV3A 5T7BA 4LTDA 2A2ZA 2C7RA 3ZDAA 1SHLA 1HFJA 2PX0A 1NW4A 1J5PA 4QAQA 3SHVA 4H6PA 4YP6A 2X8AA 4S05A 2V8OA 4G81A 1TO2E 4ETMA 2B69A 1PS9A 1T0PA 1OIWA 2CL7X 1KIMA 4L9AA 5BT8A 5I5EA 2BMVA 1XIVA 3HSYA 2J6CA 4HEJA 3T8YA 3L1VA 4E7PA 5JXIA 4RKRA 1QK5A 1U7WA 1JMVA 4A92A 4G0NA 4UCQA 3VO2A 2XCSB 1NXSA 3I0ZA 5SY4A 2FSSA 3MF4A 3HYTA 3QE3A 3EGVA 4I50B 1NBMD 4Y7DA 2CVQA 1XMVA 4IUDS 1A1SA 1MTZA 2DOKA 2FG7C 2PX6A 3KR2A 3MINB 4ZP1A 4PZYA 1O7JA 1TMOA 1F2UB 1DEKA 3HFRA 3JCZA 2IYRA 1WABA 3P9SA 2WZBA 1VL6A 4IDBA 2QRPA 3PC8C 3G5AA 3UYKA 5E0KB 2H1IA 4RTSA 1YOBA 2R2AA 4JZYA 1I2BA 2NG1A 4M1ZA 2IZ6A 2BFFB 3AFHA 4KW7A 5HQTA 4IHJF 3P52A 4R7ZA 4DSUA 3VH4A 1LBHA 2JC3A 3DVQX 3LVFO 1ESZA 3NHZA 4OBWA 3LPCA 3VVBA 1G1MA 5GQSA 1DQPA 3GVIA 3NGMA 4PO8A 2AMYA 2GJ4A 3AK4A 1NBEA 3KT0A 4L75A 1PD1A 2HO5A 2H8KA 4O6VA 1OX4A 1PJTA 3CZ5A 5KJFA 1Q1NA 5IVPA 1GAXA 3VNUA 3CLSC 1J56A 1GAQA 4IDOA 3TRIA 4CODB 4KO8A 3P9NA 1XV5A 2Z4SA 1KTIA 1VIYA 4OSOA 3UBTA 2HUPA 2XCIA 3JVVA 4JKOA 3WKEA 1RWKA 1Z4IA 2VPPA 4V0NA 4E2YA 4GOJA 3THXB 3FPSA 4GL2A 2AE2A 5KNDH 1RIIA 1II9A 1OC4A 1NVBA 2VBFA 3U17A 4BO4A 4O2BB 4ZN6A 1SXHA 4H18A 3SM3A 1M1YA 1ST3A 2F64A 3DKKA 4WW0A 3WIUA 4B87A 3SNHA 4CKXA 5B1YA 1ZW6A 4QRIA 3DFKA 4TYMA 3LT0A 2WUGA 1WHSA 3IVXA 3VR6D 1LW7A 3D3WA 1TT5B 3GBPA 3BEOA 4FNGA 4C87A 1I7PA 3TFOA 1IVYA 1PTKA 4RIGA 3A28A 1P81A 4QLOA 2BEVA 3NFRA 1VRWA 2QRGA 3QA3E 1T6YA 2AQ8A 4MJ3A 2R44A 4LDRA 3SVLA 3F3SA 1JB1A 2ZT6A 2PA0A 4TMXA 1NBIA 1A95A 4YS6A 1WMEA 3ZKAA 1PDOA 1NP7A 1LPSA 3AHEA 4GKVA 4BAZA 2YFKA 1CDEA 1TU3A 3AOGA 1E3DA 4ALKA 4C03A 3ZDQA 1U2DA 2HAEA 3LJKA 3O8NA 5FXMA 1JNYA 1ECJA 4NY1A 4AZSA 3K70D 4BRWA 3GGCA 4OQQA 3SC2A 1K97A 3H19A 4KQJA 1FVHA 2CD9A 2EJUA 2C7BA 3DE5X 4I1YA 2OB2A 4YLYA 1MJGA 5IWAB 1IB6A 5JYCA 1FS4A 3NDBB 3OEHD 3RS2A 4C0HA 1J42A 3TSOA 5ALKA 3HC7A 2PBZA 5A5VA 1ZVMA 3E03A 4G4SP 1JDPA 2XUQA 4TN5A 3SDSA 1FVXA 1OA1A 5BN3B 1XXHE 2QSJA 4OEHA 1NKVA 3TIIA 3S4YA 1OPXA 3Q2OA 2VQ3A 1YCDA 2LUOA 3DV2A 4IIHA 4X7RA 3VNSA 2HK8A 1Y1KE 4P3NA 1P9LA 3H8WA 4J6EA 1PT8A 2NUAA 2RGDA 2PN1A 3Q0TA 4D9FA 2Z8YM 1YVUA 3A1TA 1UXHA 3EAQA 4NVRA 4S3MA 5G1PA 2FPIB 3I62A 1P73A 3M5DA 2RAUA 3O2QB 3PHGA 2O8CB 5CLFA 3G85A 4II7A 2BM9A 3BK2A 4B76A 4FZVA 1FU4A 1YRWA 4ZPXA 3NT2A 1XUOA 1GV1A 4YACA 4DFDA 3KSAC 3L43A 2Q6KA 4FS8A 5ALRA 5JSFA 5KTYA 1DJLA 4EF5A 3J81k 4C4OA 3NWBA 3RYIA 2HZ7A 3K30A 1QH0A 3GNSA 1C1DA 5IXJA 4M86A 3RC3A 1JXQA 3LGXA 5EUCA 1C30A 2CYCA 3URKA 2ZE7A 3BZBA 4Q3KA 4B6JA 1B23P 2UVQA 4H35A 3USCS 1MXFA 5I3CA 2AVNA 4UBKA 3GA5A 2FN4A 2QJWA 4YJ2A 2YC2C 4P31A 3KOZA 4HNSA 4J0IA 4QUBA 3VZPA 2NACA 4C14A 2YXNA 3LWBA 1CUCA 4TS3A 4PAMA 1Y37A 5CNKA 3QPUA 1JKXA 2R86A 1HZZA 2I0FA 2GJAA 1I13A 4I08A 4PYQA 2BRUA 1V26A 2XWBF 2BGTA 4LV5B 2NVUA 4Z3DA 2JAWA 2PMEA 2QM3A 3VR5H 1BDBA 1UP4A 1ZOLA 3MS2A 2BR3A 3FBWA 3QF4B 3QQPA 3S27A 3LPMA 4BUZA 1J90A 4DMHA 3E9QA 2NV2B 4G67A 1JJAA 2W2LD 4BO7A 2RHHA 4QG3A 1T8UA 5KYYA 3JWEA 3ZQJA 3A1VA 4UD6A 1W88A 2WSMA 1YI1A 1LZLA 2R1VA 3RC9A 1WDKA 1XD8A 1L1QA 2VJKA 4EJSC 4NXNB 1LJUA 3ILYA 5HE8A 1O58A 1NN5A 1N2BA 3MJHA 3FOAA 5LP6B 2IPXA 2GN6A 2HBZA 3MD0A 4BGVA 5I7WA 5KVVA 4DLKA 2X9GA 2NZUG 2XY4A 4R5MA 1UPPI 1NQOA 4DCCA 3AVUA 3K1AB 1RQRA 2ECPA 5JAUA 3H6GA 1FU7A 1AURA 2BGNA 1K5GA 3HXTA 1I3NA 2WG2A 4Q1BA 5L3ZA 3NHLA 5JWHA 2A94A 4LV8B 2QAGA 1P6QA 3K9QO 4YXWD 2X22A 3GGJA 1CUIA 2ZRJA 2ZI3A 2VKQA 1KYWA 1E1QD 2A1UA 1DL5A 1PK7A 2MSLA 4OJTA 5DHAA 3GIDA 1QO9A 3JQ9C 5TJ9A 4FFNA 5DGTA 4B6FA 3QFFA 4ZVPA 4CIWA 1VGVA 4ESEA 4UBMA 5K3OA 3VI4B 3MPUA 1X8JA 1BGVA 2IV2X 4GOKA 2GF2A 4ERXA 5U4QA 1PCXA 2QW1A 1E9BA 5EQJB 3RIEA 4BPBA 1B8PA 2J7PD 1S2NA 1I4WA 2JI7A 2O54A 1Q6ZA 1M0WA 1QCDA 3PICA 1DT5A 1R0ZA 1A8SA 3KJZA 3C2QA 3ZCRA 5JY1A 1J33A 1EE1A 2BTQB 2JIRA 2ZS7A 3Q88A 4U2FA 5E3HA 4F8EA 1SN7A 4MQFB 1TQHA 3SBDA 2AK2A 4C05A 3TF5A 3COPA 521PA 4M37A 3DBHA 1H3FA 4JLDA 3OQIA 4EFKA 3QKIA 3R6LA 4PLYA 2FQQA 2GDJA 2YIMA 2PRIA 1KEEB 2NW6A 2OLJA 3ZNQA 5K0TA 2OZVA 2BKVA 4YCBA 5KNCA 1QZUA 4PHFA 3HKEA 1LTQA 2GILA 4YRGA 2B3TA 2R2GA 2IVZA 1GQSA 1KZ9A 3RS7A 3ZWCA 3SAJA 4RULA 2O2HA 4QPZA 3GUVA 1H0HA 3ROFA 4P7JA 4JQCA 3KC2A 4OL0A 1RJ9A 4CQLB 4MP6A 4R1SA 3V80A 1JHPA 1C9DB 2GLTA 1XQXA 2OD9A 1N2HA 2QTFA 2PZAA 4R01A 3ICOA 1YZVA 3N28A 4RM2A 4TTRA 4A8TA 5MHTA 3D2LA 3R7NA 3L1UA 3IUNA 1HV8A 2PKYX 4QU0A 2VXYA 1IEQA 5KVCA 2GKOA 4G0XA 1YI8A 1S8OA 2JARA 3CN9A 4GLOA 1Y3DE 2B99A 5CITA 1XZFA 3BHIA 3JD2A 4F4CA 2IYAA 2QAJA 3PFKA 2OORA 4KQIA 3TKAA 4B33A 3D1LA 2XXAB 1HBJA 4OAPA 3H1GA 1ISGA 1UL1X 1KH3A 2GN4A 2N3ZA 2B4KA 2YHUA 4ND2A 4S1TA 4E09A 5IANA 5KJCA 4IICA 3QEAZ 5TE9A 4R8MA 1BG6A 1AU9A 3ODPA 3EBOA 4OJQA 2YRFA 3I04M 4P4SA 2JEYA 3E8XA 5JDCC 4CV2A 1I1NA 4Z1MD 3OOHA 4GNKA 5JXHA 2UYCA 3MTGA 2HMVA 4FN4A 3ZWMA 2OBXA 5JBQA 4EHIA 4UHHA 1HZJA 4PQFA 4MKFA 1X2EA 2WU3A 3EE6A 5FCDA 3UGTA 4AY3A 1P91A 4DCVA 2RHOA 3M6IA 2ZYHA 3ZH9B 2JLZA 4IM7A 4ITUA 2I6TA 1WV0A 4TLDA 4X44A 1JEYB 5CX1A 1O08A 1QPBA 2O3RA 1PG5A 3AWIA 5JRZA 4YN3A 2CMHA 5E9AA 1U2EA 4XVCA 3H9QA 3L6UA 4JLWA 5BWNA 4O63O 3RIMA 4BNZA 3Q5DA 2RARA 3I6YA 4O2LA 1MT0A 2QN8A 3RJ9A 4DUYB 2J3DA 4UM9B 1KJIA 2XGGA 5B4VA 4YALA 2HMYB 3NC1C 1GCIA 4GUAA 1N9GA 1UXOA 1XMPA 4K46A 3WDSA 1KMCA 3D5EA 3WAGA 2BZ1A 2GM4A 4ISBA 4QFCA 5KI6A 1XDZA 2O2YA 1PJ2A 2QD2A 1TIKA 3PYLA 5C4GB 5FRDA 1N25A 3OUUA 3RTBA 2W8BA 3O21A 4W5RA 3ZE8A 1RAIA 1XWWA 4HT3B 1LTHR 4X8MA 4XM1A 1K2WA 3O8QA 3O91A 1WLYA 1XZJA 1Z5VA 4FNMA 1MVLA 1K5HA 2LBPA 3FPLA 3D0QA 2MJLA 1PJLA 3PUIA 5ENZA 3PQCA 1R1DA 4W9RA 4OP3A 3K9LA 3OC6A 2GBFA 3R7WA 4AO7A 2J5XA 5LWQA 3EZFA 4EG6A 3I5MA 3RVJA 2AV6A 3EOBI 1VL5A 1K7SN 2HRRA 3HR7A 2E4AA 4BTEA 1P29A 2QL7A 1TYCA 2QI9F 4JP8A 3SZ3A 1OAKA 1HEUA 3D4IA 4FT4A 3CPHA 5C1IA 3MQFA 1KF0A 4MCJA 5FYDA 1M34A 1U3UA 2RMKA 1HTWA 4QELA 2H7CA 4XUCA 4R9UC 4U3JA 5KQRA 3RAJA 1ZXXA 1J2TA 2XF2A 2VXBA 1SURA 1R8QA 2CUKA 2C88A 3OQVA 2QRVA 4P53A 4R5HA 1QR6A 2AZTA 2BEWA 3N1UA 1WY7A 5CFOA 2P4HX 3PZRA 1BW9B 3FF1A 4QFMA 4BE4A 2EFHB 1TTQB 3F6EX 1HE4A 2HUNA 4IEEA 1L9XA 3EZ9A 1R4AA 3PWTA 4JVNA 1X1EA 2JLBA 1K7XB 4OQEA 5LLSA 5SZJA 1UPTA 4BE7B 1U2TA 1EGQA 4R7GA 5H8WA 1PLJA 1MQ8B 2FSPA 2MSWA 5HM8A 5FOQA 3LC7O 4F9FA 1YZNA 1LLFA 3PRHA 5L7YA 1RCTE 4FLFA 2IK8A 4RORA 1P9NA 1P4HA 5IEBA 2VF4X 2P9BA 4BDSA 1I2DA 4D42A 1CNMA 4M6WB 4BLPA 4RJIA 1THTA 1WMDA 3N0VA 1DWOA 2Z9DA 2AGVA 2VT3A 4I6EA 4Z9AA 4F86A 4F7WA 1EM8B 4HGOA 3PXEA 3WWOA 3ZTTA 221PA 3HJFA 3AR3A 1A96A 1IDN1 4X3PA 4E7OA 3R2JA 1GGMA 4RKQA 3W5AA 3SNKA 4AF7A 2INGX 4H1TA 3GCDA 3WQHA 2Q8PA 2LW7A 2P4QA 5B3AA 1JDZA 4ROSA 4KDCA 4RHYA 5KOJA 3A3PA 2FDCA 4FGJA 5EJ2A 4PYOA 2NNWB 3LPAA 3MJ4A 2NU9B 4BO6A 2QXTA 1RQXA 2G0AA 1CLEA 5G4KB 1TE2A 2X8BA 5TPZA 1PX0A 5FI0B 1I7LA 4EX7A 5EE1A 4EW3A 1FVFA 1M1YB 2FK7A 4HAZA 4ECEA 5IHPA 4BEWA 1A27A 1H9AA 4F4HA 1ZCFA 4P9NA 4TSFA 1RLCS 3VVLA 3QENA 5G1OA 4ZKEA 4PYMA 1OHHA 4N3CA 1K7CA 4ZARA 3TR0A 1A9XB 3TCNA 4ZMSA 2Z2IA 3SX4A 1TOAA 2C9CA 4KHZA 3EXG2 1TC1A 2TMYA 4P33A 3ZHCA 1Z22A 1FRFS 3G9XA 1XMQB 1QCZA 4GPEA 1ULBA 4WOPA 1GPUA 1HNWB 3QW4B 1EXWA 3Q2KA 1V2GA 4ZT3A 5AVOA 4AB1A 2J09A 3TOSA 4PS0A 3P2MA 3SFVA 2QXUA 2IIQA 3G7NA 5I6DA 1F8XA 3WG9A 2GEDA 2QZJA 3SKYA 3F3YA 5LYYA 2A5DA 3PV0A 5BMVB 4PZUA 3P45A 2I6XA 3BBLA 2QYHA 5A9SB 5IC5A 4C7OB 2AHRA 2Q9BA 2ZANA 4ALIA 1DKLA 4E70A 5J4VA 4P93A 4G1UC 2Q21A 2Z5LA 4JQSA 1YASA 1PWZA 1IFXA 3A2MA 1ZO8A 1Y98A 3OZVA 1DRKA 2F48A 3HJNA 3WL5A 2CVZA 1P39A 2IKSA 1WXXA 1C0PA 4HDAA 3TZBA 1JLHA 3K1JA 1ZIYA 1P4GA 4R41A 1V4VA 2ILVA 2KX7A 3BA6A 3NWEA 1HK7A 4L07A 3TIGA 4X7PA 5LYJF 4GSLA 4HYYA 4B74A 2E0IA 4FHCA 4TTPA 1L5GB 3R5HA 4EUNA 1NVDA 1ORIA 2NIPA 1J97A 1VQ1A 2UYYA 4NCJA 2GJKA 4MIOA 3BJMA 1DBIA 4IIUA 3AEQA 3R6GA 3W6UA 2C9BA 2JJQA 2GSDA 3QLEA 3EPJA 2FP4B 2BWJA 3HFSA 4NRDA 1U3VA 1W1IA 4KFTA 2QA5A 1WA5A 2XTMA 1FP2A 4EFLA 2ZPUA 4KKVA 1K8XB 3SJUA 2JKZA 2ZRPA 5JSYA 4AMVA 1KVRA 2EJCA 3GDGA 4TV9F 1IHPA 3DVRX 3L93A 5LKAA 3OQNA 2DERA 2D06A 1OZHA 2NYVA 4RK0A 3HN2A 4UCWA 4WVFA 3U3JA 3ZWAA 4L50A 1VZ2A 3OE7D 2PTGA 1JMKC 1OYYA 1QE0A 3D4OA 3TBFA 4NBWA 2R4TA 3IQGX 2NN3C 3OJWA 4QASA 3TIXB 2YUTA 2UU9B 4IZOA 4N7MA 1QH1A 5SYAA 2D1SA 4XQ9A 1ZL0A 2BEKA 1JLMA 3D4NA 3MGGA 3RYIB 3SR3A 2X5XA 1P44A 2IX3A 3UPTA 2NZJA 5E7IA 4WZ6A 1C30B 1Z17A 2RAVA 3T1QA 1ZRNA 5IT5A 4KPGA 2XGSA 1S2IA 3G68A 3TOVA 3D8UA 3EY9A 1W52X 2F67A 5CVJA 4ADSG 4JBGA 1UMCB 2X1LA 1S2OA 5E4YA 4JQOA 3JQ8B 1XG5A 3VC3A 1L7VC 3HP4A 2RKWA 5JMPA 5JANA 3NHBA 4QREA 2YWHA 4GWKA 5CLLA 3DDWA 1DP4A 4NECA 2J4FA 1WNTA 3QG5A 3QE0A 4G5HA 3ZDBA 5K6AA 2D3TA 2LXNA 3H3FA 3OA2A 3A4MA 4GR9A 1A5AB 4ID9A 4IGFA 5K3CA 3W7VA 1FSPA 3KXIA 5EIAA 3CZCA 1AQNA 3GRYA 1ZGCA 2R6FA 3L7NA 2EEPA 721PA 1TZCA 2P1DA 1Q2XA 4HFMA 3UMBA 1NI3A 4LMPA 1CB0A 5A02A 4DZZA 2AJDA 3H6KA 4R8VA 4XPIA 3WZLA 2Y76A 4HXEB 2WINI 2OSVA 4QHYA 1QHFA 2APJA 1TUGA 1QWOA 2QZ9A 3OJEA 4MIYA 4UM7A 5D87A 1F2TA 4DLZA 1OY1A 1DKRA 2AUTA 2DFTA 2PTHA 2QUBA 2W98A 2YHBA 3JAWB 2R1VB 4IHQA 4G85A 5FOTA 2NXEA 4AKGA 3L9WA 3FCSB 1F2DA 5LN1A 2Q3MA 1QKIA 4EY5A 1BU5A 1WF3A 1HE8B 3ELYA 1B76A 3LDHA 1NXQA 1RYBA 4HLUC 3GOQA 3U4MA 3OF3A 3DLPX 2QENA 5T6BA 5K8UA 4Q3OA 3N2EA 2FWBA 2IDMA 4QUEA 4UULA 3ZYZA 4B09A 2W2MA 3W2TA 3WYCA 2CFOA 1AKWA 3E18A 1NW9B 2QAGB 3H87A 2AI3A 3REOA 5DM70 4G97A 1U0FA 2A1UB 3CHYA 4HDQB 4REMA 4EX6A 2FEPA 4P92A 2K5UA 1Z2OX 2ZEJA 4R1MA 2X5OA 5IYZF 2AOVA 4Y1GA 4LEIA 5AKEA 3EXHA 3DGFC 3GDWA 3QXGA 2EFCB 2WLTA 3AM4A 1G6HA 3MN1A 4G6ZA 4WBSA 2C97A 5LP6C 4UU7A 3T1OA 2DT5A 2JFZA 4YT2A 4PYLA 3IILA 2VHVA 4LV6A 4WRRA 3TZCA 1VKHA 2X5JO 4BZQA 3UG7A 3OIDA 5KYKA 1YFJA 1CPYA 1GLNA 4FQ5A 4C4AA 1PGOA 4C6RA 1PQ4A 4FE3A 3H2ZA 2YV3A 2J3LA 5FUBA 2AJCA 5F7OA 2Q0HA 1KDPA 3HA2A 3VAAA 5EVCA 5DYNA 1PNOA 1WXFA 1NATA 4WJZA 4BN4A 3B5EA 4NQZA 1BS9A 4JN6B 3L0ZA 1VDZA 5DK6A 3U81A 3JD1A 1QM5A 4Q1FA 3BULA 2AFHB 2J07A 1Z9BA 1ECLA 2VWPA 3DBHB 3I73A 4RQUA 2PYZA 2A33A 2ZYUX 4RKYA 2BGMA 3WNCA 2X5KO 5ALFA 4LRXA 4Q9LA 3EGDB 5BYKA 1Y5RA 3MA0A 5H9VA 4UMDA 4DA4A 3UW1A 1GITA 5T6MA 3LO8A 2EFGA 2ZJBA 2Y68A 4WBXC 5LQNA 2GBCA 3RV3A 3EQ8A 4FMBB 2IODA 2QT0A 3OU6A 4L16A 3IELA 2BCGY 4MULA 4IQ0A 2BFEA 2VRBA 3C15C 2AEJA 1JAHA 1JE0A 1OASA 4JOSA 3LNTA 1CUGA 5AVTA 1KRXA 3WGUA 1VP9A 2GVNA 2WAOA 4EHHA 3O4JA 5BSUA 3EMDA 3VU9A 4CLHA 1IXRC 2QU8A 3WGGA 1M74A 5JH7F 4MWSA 5TT1A 3G8AA 5KKCA 1GT91 3X1JA 1LF5A 4HL6A 4ARAA 2OHHA 4TL6A 5TV2A 4L0CA 3OQPA 4RHXA 1Y5MA 2AMFA 2IOFK 4P4TA 4EDFA 1I94B 5K3DA 5JAQA 3JYPA 3H9GA 3DT8A 1I1HA 2GRUA 5K8IA 1IN5A 3PF8A 3UV6A 3WDKA 1BS2A 4X62B 3FTNA 4NZ9A 2WWHA 2X0DA 3HGTA 4LJ6A 1EP9A 4UNRA 4PPNA 1LA2A 4DJJA 3H04A 3SD7A 1GKUB 2O0HA 2FN3A 3IEUA 4RPIA 4RU1A 4A23A 5FWDA 4CFSA 2C0QA 2QTGA 4HZGA 2QUAA 2P2NA 5K2OA 1JHDA 1QXSA 4TYYA 3WK5A 2CHGA 2Z30A 2YIDA 3MOSA 3DLBA 4ZHQF 2I03A 5DBIA 1IY1A 3FOFC 2NZYA 3O75A 1D2HA 4D4LA 4NONA 1K27A 4B6PA 2FEKA 2A86A 1O4WA 3OEHA 2BOVA 1LLCA 1Z62A 5KNBH 3GEBA 3MFQA 1ZCZA 4RLHA 4WN3A 1FSSA 3EIEA 4N6NA 5DLDA 3O73A 3K9FC 4LE0A 1XKTA 3TLYA 1XJ0A 1ZHHA 1T2NA 4ZQCB 3KALA 2WTMA 1MW8X 3JVEA 3OIYA 1Q5PA 3R0JA 4FW8A 4CMJA 1BD4A 3PNYA 4PTZA 4XFJA 1GSHA 4GP6A 2F17A 1T9AA 4NU5A 2CWWA 4PWZA 4AQYB 1R5BA 4CEJA 1QBGA 3GCZA 2W8BB 1NSTA 4K40A 3Q7IA 3S8EA 1J25A 3BDAA 3QKRB 4MS3B 3RVLA 3TNFA 3MQ2A 3E0XA 5ERGB 3W5JA 2IYTA 4KXWA 4OY3A 3M9LA 2H4XA 4RJKA 4J4TA 3KSRA 3MLBA 1E3EA 5BQPA 1SGWA 2O3UA 2Y0BA 3GGSA 2ZSHA 4D9MA 3UMMA 2C4MA 5DCYA 4YREA 3N8IA 1TAGA 1N4AA 2PS3A 2OVBA 4DV2B 3OT5A 1UXKA 3MJEA 4E0BA 4CKWA 5ED0A 2QYSA 5J4YA 3H86A 3O0DA 4YIHA 1TKCA 1ZU4A 3TL3A 2OYCA 3GRRA 4LXHA 5K99A 2I66A 3AR2A 4AULA 1TADA 3X44A 5C8YB 4U3JB 4JP2A 4UDXX 2KBEA 4BNFA 2HA4A 3VH1A 5LXTA 3MWLA 5EJ6A 4XPIB 3WISA 1IN4A 2R8XA 2VHUA 5JI3E 4IINA 1QF9A 2J6IA 4IP0A 3ZD8A 4KMMA 3O5AA 3AP3A 4CIXA 3BJIC 4JSTA 4H3VA 5DNCA 1W7AA 5FLEX 4I4TB 2G04A 1QGOA 2XEXA 4Q05A 1X7WA 3FPAA 3ICWA 2L2QA 2C0PA 3ZZTA 1Y7LA 4MKIA 3WADA 1EJ7S 1JZQA 4QQ8A 3ZYCA 4C5BA 1JB9A 1U8FO 3UHFA 1STOA 3HCWA 4HEA6 4RF5A 4JI8B 3NANA 5FI5A 5A9TA 3STHA 1YJCA 1OTYA 2CNDA 1U8EA 1CUDA 1ZM7A 1FA9A 1AF7A 1VMDA 1YDFA 1SRQA 2EQAA 3DB2A 4P98A 4X20A 3LIIA 3NTVA 1KZ4A 2W2LA 3QI7A 4FUTA 1OX5A 4EYSA 1E7RA 5DHSA 3RVNA 1XEWX 2AXQA 2GEFA 4KBGA 4NQRA 1GTJ1 2Q3LA 1CK4A 1KYVA 4PYRA 3ELDA 2VHCA 3WGZA 2PUCA 2JLCA 4POAA 5HCNA 4X6LA 1NQAO 2XYGA 4NBNA 1KR2A 1CJTC 3SQOA 3GWZA 2P8JA 2DETA 3WICA 5E6RA 1BMTA 2PL3A 2OT3B 2OHFA 5H59A 4JV5B 3F9IA 5BSWA 1LS1A 1SVMA 1HM5A 4M0MA 3DTVB 3A06A 4G0WA 2ATCA 3KUDA 4FR0A 4EKIA 5D5HA 3O8RA 3AT1A 3HJHA 2B61A 4CFZA 2VK8A 5SYMA 4F6LA 3C3AA 2X0NA 1Y1RA 4XVQA 5EXXA 1R88A 2V6AI 1H2EA 1TIBA 4WVLA 1VLJA 1QB8A 1WW2A 1CV2A 1ZH0A 2EJWA 2ZJAA 3RD5A 4R2HA 1H6CA 1PJQA 3AESA 3FSRA 3HLTA 3LCCA 2XMGA 4F9GA 5C1DA 1W76A 1QVZA 3G23A 3ZTWA 3H0EA 3VSBA 3ZDXB 4KR7A 2Y1GA 4ISCA 2B8JA 5B1HA 1QRSA 3QXXA 4FR2A 4WESB 4B79A 1CY7A 2XRZA 3JQFC 2WT8A 1OE0A 3WTBA 3S2IA 2QOEA 5DYYA 1AGXA 3AQIA 1WD7A 2VP0A 2ZCVA 3G0IA 4KX5A 3QU5A 1DBWA 1LK5A 3RWMB 4NYIQ 4IFTA 3T5PA 3AIOA 3Q4GA 5AKLA 5GOTA 4M88A 3FTFA 1CRPA 4A73A 1UBTS 3DBLB 4J1SA 4JBHA 1TW3A 1YKFA 4I0WB 1CUBA 4OU4A 3TE6A 4HYEA 3VR6H 1LPNA 1AKRA 1N2XA 2A5YB 3HCDA 2CDNA 3QX8A 4H7HA 2C2YA 2CXOA 4LMBA 3W5UA 4DLPA 1JKMA 2DMRA 4K9DA 4L73A 2C2GA 1KZHA 1XTRA 1SC9A 4CF3A 1XT6A 3F7MA 1J4AA 2VZ0A 2FPXA 3CUEF 1D6SA 3FMFA 4HAVA 3L8ZA 4XM2A 1OB2A 2NX2A 1TJ3A 3CEJA 2PG3A 1NAIA 1SPXA 4D1YA 4ZV4A 3IAS1 4N01A 4P83A 1IB0A 4MVJE 3A14A 4N3BA 3A1DA 3KOMA 3SC3A 3VPAA 2ZIEA 3AEQB 3GJTA 1TEVA 2MMGA 3E1GA 2X9QA 4WNCA 3TEFA 4P54A 3V00A 3ZLBA 4KFCA 1W1UA 1FRNA 2GVDC 2NXWA 4V3BA 2G25A 3STTA 5FV4A 1UAYA 3IDSA 2ZSAA 3BIJA 2VLBA 3ESXA 3OCJA 2RGCA 1GZ5A 4CW7A 3GPLA 2HLHA 1PEAA 3SS8A 1EFAA 3IEMA 2YL2A 5ALMA 5EERA 4OK5A 4I6JA 1W8DA 1UFVA 1X2BA 1AQIA 2H1CA 2ZJFA 4AN0A 3I0NA 4KXXA 2P3SA 3IS3A 4R6WA 4TLBA 4FQ7A 2Q7OE 1PWXA 3DZGA 3TVYA 3WRXC 1QAOA 1YS2X 2JVKA 4NFYA 5DSZA 4U6QA 3JAKA 5E3JA 1G98A 2OO3A 2E5LB 3ZIAD 4GECA 3GZNB 3GR6A 2OLEA 4G1FA 2Q41A 3GD5A 3BC1A 3LIPA 2DUJA 4EI7A 3FNQA 1TMYA 3VZSA 4B0OA 4ZVNA 4BLVA 2HU5A 1JAYA 4KQMA 1EVLA 2XYPA 5E4FA 3R8XA 4FKZA 4QOGA 5F64A 4FB4A 1ZC4A 1LBSA 1Z8FA 1NWHA 4AP9A 1LDEA 1IWBB 1QHEA 3FBTA 3IIIA 2ZI7A 1FDTA 4UUMA 5H4HA 1U90A 3MMXA 4BP1A 5ADHA 5EE0A 2GN9A 3C7TA 3HKCA 4GM1A 3S2FA 2C3MA 3OICA 4HAXA 1NVTA 2HXGA 3DZFA 1IWAB 1I4EB 3UJBA 3WGKA 3DMDA 3ORSA 1PSDA 5JRJA 1GRVA 5ALIA 2OAP1 3UOAB 5A9RA 5GIOE 3OZGA 1SBNE 2EW1A 1KC1A 1ZH6A 2GYUA 3PHIA 2QE7A 3TTTA 3VOSA 4F04A 4J9UE 2PSJA 2F55A 1EFUA 1P6XA 2NADA 2FQYA 2J9FA 3N76A 3AJEA 4PLCA 5L40A 3SZLA 1U8YA 1ZMRA 8AT1A 1BIFA 2JLRA 2YFHA 4ARVA 4NEQA 5IAEA 4BNWA 3EVZA 3U4QB 2AG6A 2IJGX 1CJBA 1RKUA 4OHBA 1HZZC 2ERXA 1ECCA 3AM5A 1XRRA 1UOEA 1QTIA 1NUHA 2BRUC 2PIDA 5ANRB 1I3OA 3S2EA 3GJ0A 1XVTA 2IXTA 4C0SA 1CG6A 3OCCA 1JI3A 2DFDA 3WWYA 4Q4AB 3L4KA 4A15A 1R2QA 3GNLA 3OTHA 1SUAA 3GJQA 2H1WA 4G26A 2UV8A 4IGAA 3TR5A 1VMKA 4RD4A 3LHDA 2NAFA 4L2IA 1CW2B 4L5AA 3IH5A 2QM7A 4UXHA 4QRHA 2BLLA 2VNSA 1IPHA 3SF8B 2FLWA 2BMWA 3P9PA 4AY5A 3N3AC 1JEJA 4QOHA 3R9IA 3RS3A 3RASA 1URPA 2E5WA 1G6Q1 2FPGA 5F1YA 4X9XA 3WSTA 2HMAA 4HQ6A 4ABTA 3FJ1A 1PJSA 2XW6A 3NBQA 1LVGA 1I7NA 2ZTUA 2QL9A 2XTAA 3D8RA 3K09C 4X61A 4BZPA 2I87A 4LJ8A 3UKJA 2ZAYA 3EFBA 5CYOA 4DNPA 2P0AA 4EIWA 1HI9A 4MGZR 2B4TO 4J1QA 2QAGC 1BFUA 1QV7A 4A6PA 1YAJA 3TQRA 3UXMA 4W5JA 1FUIA 1PWEA 3S2GA 5M3BA 5KIAA 1OZFA 1KSHA 3BILA 3V8RA 1F6BA 2GHIA 2QTTA 4XFKA 4JLPA 4HNQA 5G53C 3RSHA 2JA1A 3T1HB 1G20B 1XPOA 1JHUA 1PSZA 2ISQA 4RMNA 4XIIA 4J0JA 3VUFA 2JIBA 2VRCD 4IIBA 3E61A 5HCUA 4PR0A 1IY9A 2LCIA 4R4JA 4BB5A 3T41A 2KE5A 4AF8A 1ZVKA 1U0LA 1PV4A 1ZMTA 1G42A 4O1IA 3TUIC 3OZTA 5AUQA 3TAHA 4CIDA 1ZRMA 4QYXA 1U7DA 5H16A 4I1IA 5JATA 2OAQ1 2BFEB 2VYVD 3DZBA 3MUOA 2BTEA 3QTBA 1E4VA 3DM9B 4CMEC 1MOZA 4JP1A 3RAFC 1PS0A 2QM8A 2XUDA 3EIQA 1U1DA 2JLYA 2HWUA 2Q4OA 3E9CA 2HX1A 4J0HA 4LJ9A 3VU9B 3C16C 2IX9A 2I1LA 4RZIA 4ZHSA 2DF8A 4PXYA 5E1DA 1HMYA 1OI2A 1OH7A 1Q11A 2ZPAA 3BTSA 1GPWB 1V8PA 4BMOB 1P1RA 2C5AA 1F0KA 3DEAA 2RJNA 1TU0A 1NW5A 1T1EA 1INLA 2XOEA 3KZOA 4YJHA 4JI6B 2EX0A 4MVJI 3BWEA 4TQGA 4WOKA 4MVCA 1KMNA 421PA 4C78A 4US1R 3FB1A 4XYGA 3LQ2A 4ZI7F 2H08A 4Z9YA 3KQQA 2H8GA 5BMOA 1BQ4A 1FJ2A 2I78A 3CCCA 3PGA1 3BJZA 5EINA 4IIYA 4M1MA 2B35A 4IJUA 4L8FA 3ZWQA 1GKYA 3S40A 4F7DA 3FROA 4G9EA 2VJPA 5D7NA 2ZCUA 5EXEA 3V6LA 4ESOA 1KE1A 1UJ5A 1YE8A 3EXG1 3DLAA 2WILA 4GSYA 4JJZA 2A58A 4HUQA 4XCVA 5BYJA 4YMTA 5HKBA 1L7XA 1P1BA 1WOYA 3IMCA 1QNLA 4TSKA 2XCQA 4PZ0A 3T3PB 2H06A 4G0QA 4DKXA 4DQ0A 1YC5A 1JH9A 2QJOA 5JROA 5K8LA 1H2YA 3WFZA 3BZUA 3CB2A 3MAGA 3AHGA 2AG0A 1E69A 4BRUA 4OHOA 4R1QA 3N86A 3DZCA 1EZ4A 3JARA 3IE1A 2HDOA 4XRGA 2HPVA 3FLEA 3P2OA 1HPLA 2G7MC 1BAPA 3MWDB 1VSQA 5T4FA 2FDRA 3FDXA 5A4JA 3JX9A 5HRAA 1K0UA 2GBLA 1E1DA 3DAHA 5K0NA 1XCMA 3E3AA 1Z7WA 3DUFA 1TI7A 5AVJA 3H4MA 2CUZA 4KO3S 2QMZA 4CEJB 5IUNC 3BMNB 4RVFA 2OPHA 3PQ8A 1MD9A 1V11A 2B2XA 2CYBA 3TL6A 1IIRA 3DJYA 2WYIA 3AVWA 2C5EA 2CLHB 2XVXA 4WY5A 1XB2A 3GEIA 1OV6A 2V7WA 4FI3C 4GUDA 2AD1A 3LLVA 3QPWA 3UANA 3ACBA 3FTDA 3RKSA 4KHPB 1KPHA 1L5OA 3QJYA 2X9NA 2OZKA 3ZDEA 3OE7A 3FDZB 4AJPA 2JKVA 4TKLA 2YW2A 1SXGA 3CUVA 2M6LA 1VG0B 4OHCA 1XN4A 4KWTA 4BNVA 3SJCA 1CFJA 1SXJA 1KJWA 4LGVA 4F6RA 4RPCA 2JFHA 1NMZA 5IXSA 1GLGA 1CIJA 2R5WA 2XRFA 5IFLA 2BGWA 4CM8B 4EDHA 5LXTB 4DZRA 2WUEA 1HL7A 2JDIA 1Z2CA 5JCXA 1DC6A 2NUPB 3VYSB 1D0VA 4GH5A 3BHJA 3WYDA 2VP6A 5CFRA 1OLOA 2XT6A 5BOVA 1ISSA 4HWGA 4RPLA 3A9SA 4L78A 1VB5A 4BP9A 4CMAA 1X7WB 1EGVB 1RBZA 1EVQA 2R7AA 3IERA 4H7EA 4Q02A 4X3CA 5B30A 4CMGA 1EQUA 4A2CA 2KHZA 2HJWA 3T7DA 2WLSA 1T8WA 1MC1A 4NBLA 5C34B 5H1YA 2LDBA 2O05A 2NPIA 1YKSA 4UEQA 4O4JB 1TUBB 2IDJA 4II3A 2DHCA 1UXJA 4ZEWA 2PXHA 1DRUA 1AA9A 1RRVA 4GICA 1G5TA 2EFEB 3VOBA 2WR8A 1PT6A 1OBFO 3B1KA 3O9ZA 2V97A 2AW5A 1ECBA 4DWOA 4JL8A 1YH3A 4KLNA 3SBOA 2H0AA 2ZRGA 3R3UA 3F6PA 5IVDA 2Z2ZA 4Q7EA 1O77A 1KZ1A 1P2SA 2GS9A 2ONKA 3GAFA 3Q0IA 3D9QX 4CMBA 1EVIA 3UN1A 3ZCUA 2R6ZA 3AF4A 2ZSJA 3VKWA 5IUJC 5ER9A 5DWVA 1E9SA 1DTSA 1FRVA 2BF7A 4O4IF 4XWYA 4U0KA 2X1MA 3QFSA 1A9RA 4FN5A 1ISIA 4NNPA 4E46A 2VAMA 1RVV1 3CU5A 4LSGA 3SPXA 4BNHA 1V71A 2R8RA 3Q3HA 2WPDA 1H85A 1WULS 3EF1A 3L2OB 4I1RA 1B6TA 1QDLB 4KI7A 2BHRA 3UFXB 2QX7A 1T36A 2X8JB 2Z2XA 1KWGA 4RY0A 4QTUB 1YK0A 2CW5A 3R4CA 4TOIA 1M0TA 2O3TA 3KJHA 5CCBA 1G18A 2X42A 3AESB 4CV0A 2Q0XA 4EA8A 4IIGA 1Q20A 4M38A 3BFPA 3F5MA 1AK1A 3LCJA 2W4QA 3X3HA 4AJ1A 5AW8A 1A1VA 2R5NA 1F38A 1TF7A 3CUSA 5F5NA 2QX6A 3GGOA 2WIJA 4JA2A 4E3ZA 3GROA 4WK4B 1L4BA 1M3SA 3P9RA 4JT9A 3O26A 4KFUA 3DV0A 3WGQA 3PPYA 4ND1A 5LBTA 5IN4A 1CUFA 2QR3A 3E8SA 4X64B 2VJLA 1APBA 2FH5B 2MOKA 2KSQA 5EMNA 1MH9A 4A27A 3NVKI 1G8FA 1L4GA 1TCVA 1AB5A 1DAOA 1YQQA 5IZ4A 3QVKA 3ES9A 1OWMA 1OA0A 2HRDA 1CSEE 2YYSA 4LZNA 4JI5B 1Y8RB 3B13B 1VCNA 3AL2A 4QOEA 4NZZA 2R79A 3EG9A 1H2WA 5EMHA 2AL7A 4TLAA 4IJQA 5C9ZA 3VKGA 3HLKA 4ZO7A 3PWSA 2GFHA 2Z6QA 1SVNA 3VISA 4EPXA 4UQLA 4FTWA 1KFBB 1L5VA 1G5PA 1FQWA 5FR2A 2EWWA 2XKJE 4OIMA 2HHJA 3OVMA 1RXEA 3G5MA 5A6VA 2WAAA 4X6YA 5TR9A 1YQXA 5BW8A 1EA5A 5IF3A 1A8PA 4X65B 1FSFA 1T0BA 2R85A 1BX0A 4JU8A 3NKVA 1MORA 2YXEA 4Z4HA 5BYAA 4UVDA 3PPVA 3RJTA 4A1FA 3S5JA 2RIPA 5AOCA 1ISFA 5C1OA 4HVTA 4JEMA 4R51A 3TI7A 3ZHRA 1U1FA 3TSAA 3RREA 1F9AA 4MGYR 1C0KA 2ZK7A 3JTMA 1MMFB 4J0QA 5KPJA 4KLAA 3JQAD 3UF0A 1D6MA 2D5CA 3C4VA 4K6KA 1OCEA 1Q0HA 1PL7A 1YRQA 3FDJA 4DCPA 3W8EA 3I37X 1WLSA 4TQUS 1T5HX 1G63A 1RJFA 4UNSA 4E1VA 1QIIA 1GNLA 4MI9A 4QGGA 4J8PA 1ZNQO 3ANMA 3NGXA 2GJ8A 3AEZA 1Z6TA 1E2LA 5D2CA 3WJ2A 2QR5A 4D56A 3HP7A 4NZMA 4DKJA 3JAKB 4CR6A 1JDVA 3FUVA 1OU0A 4RVCA 1JDUA 3G6KA 2FSUA 1OLXA 2QSYA 1D2RA 4CLXA 4PNEA 3CA8A 4XQCA 1AY0A 4L4RA 4TUYF 2H1SA 4D44A 1CUXA 1PFWA 2EYQA 2J0EA 5K0JA 3GLUA 1FMCA 1RM5A 2NXJA 2HN9A 4IIVA 1ZZEA 1GNRA 1TZBA 3FZGA 4UQPA 1Z3CA 5F4BA 1H0SA 4HATA 4H1VA 4ZZ0A 2VDWA 2C4HA 1I33A 5AI8A 3GNQA 4UTOA 3HKCB 1VCHA 3GLFA 4G5RA 1SQGA 3C5CA 3D0KA 2HMSA 3EJWA 3BWXA 1NXXA 3GJSA 2DR3A 3Q7EA 1UK8A 1G8SA 5E8JA 5JAZA 1JVNA 4JKYA 3GA7A 4WLFA 1G21B 2ZJ3A 3O6VA 4YQZA 3CNLA 4QDJA 4GPTA 4J0EA 4YJFB 5DASA 1TIPA 2WHRA 5EJ7A 1OLSA 1KSFX 3U0VA 3HG7A 3KELA 3OJOA 4R2MA 1AF4A 2D8MA 4DIEA 3F9RA 1X1AA 4IV8A 1VMEA 4RZ2A 5EHQA 5J40A 4KN5A 2R47A 1NZJA 5F7XA 4H1HA 2ZRMA 3B60A 4RADA 4JJ6A 4WEOA 1JAIA 3QGMA 3W9SA 1DAEA 4AJHA 4L7QA 1U3FA 1YQTA 2I29A 3DSRA 1YUBA 4RAOA 5KDOA 4RQAA 2B4YA 5K6AC 4G5XA 3CWQA 3WHLA 1UKZA 1YBHA 3PFCA 4WJLA 3IULA 4Q6BA 3X0DA 1FTNA 1WEHA 2V7GA 1G2QA 4JB2A 2OM2A 3DYIA 5IDQA 3D7NA 4IHJA 4L85A 4X41A 1O97D 4QBTA 5AVSA 4DIBA 4N47A 2W4MA 4Q01A 2GK3A 5LZ9A 1DBPA 3SU8A 2HD4A 3GT7A 3GZTB 1BQ3A 3IRVA 3QFRA 2XVAA 4GW3A 4KQFA 5EL0A 5B53A 4YMLA 2VWHA 1H23A 1QGDA 4L2IB 3RVSA 5C7OO 3SYRA 3QWAA 4Q9JA 2WFLA 3PNQA 5NLLA 3ED5A 4DDHA 3QWBA 2CBZA 2YR0A 1V5EA 3NBZC 5CA0A 3VR4D 4BNDB 2DWPA 3CLKA 5DDIP 2FAXA 5F7ZA 1ADCA 6PFKA 1NF9A 3DB1A 1KAMA 1OYVA 2AT1A 2NVBA 3SVZA 3PT9A 5CFQA 3EBLA 3T9BA 1UZHC 4R84A 2IIBA 3CINA 4OHMA 3FGNA 1GQFA 3NHMA 2DH5A 3HFGA 1MHTA 3MCWA 3FVRA 1OFIA 2ZUWA 2I6SA 4YRCA 1A2BA 2I65A 5JSZB 1ZG3A 3I8OA 4TV8F 4PXSA 5AM1A 2EWMA 3OCYA 2ZB2A 4OHVA 4EBBA 1T6NA 4YHHB 2W42A 5KAMA 4D98A 2V69I 2OC4A 1V7ZA 2WT9A 3LBYA 3EHDA 4AT1A 4IVPA 5EHNA 3ZDYB 1EYZA 4JR0A 4GP7A 1B8OA 4Z4CA 5A5FA 1FP4A 4HQOA 4WXHA 1P45A 4PLTA 1RXCA 1AQ6A 3B3GA 1LVHA 2JW5A 3GEMA 4QA9A 4XOUA 2RGYA 3GFBA 4ZVMA 1EK0A 1H2ZA 2ZYAA 3T7AA 2YHIB 4JUCA 1R10A 1O0BA 5B58C 1QG4A 2O0LA 3DBRA 3GHHA 4XAQA 5ERXA 4Q48A 3FUCA 4PAQA 2XCTB 1TEZA 2IYSA 4LMRA 3UXYA 3CF4A 3BXOA 1A4RA 2WD7B 3JQDA 3C5WP 4QAJA 5ITVA 5CDSA 3A9UA 2OK8A 1OYWA 4IOMA 4Z8YA 5DI9A 2YXPX 2D59A 1KO4A 1N1MA 1Y3CE 3CW8X 5K51A 3RODA 621PA 1DO0A 2QVCA 4L74A 3OQ6A 2OXRA 3I3OA 5JJCA 1WZNA 1TF2A 3MGBA 4NJEB 3OIGA 4V0LA 4Q4CA 4FEGA 2I80A 1DBRA 4MB6A 4BJ6A 4MWOA 2OGUA 3O92A 4QEZA 2FWJA 4HBGA 1R0KA 4D82A 2AQHA 5A2GA 1GDTA 5ILQA 2AN3A 4LDJA 3EGOA 2R66A 3EMBA 1I0LA 1MR3F 3LQ1A 4GLFA 4X95A 5AHOA 5FA5A 4C6SA 1E2FA 2BKLA 2UZAA 2EFDB 1WQ3A 3AI7A 5EWJA 2IHBA 3SQXA 3IPRA 1JFFA 4KK4A 1KY3A 2VDNB 1Z5OA 3EFEA 4R1LA 1E0AA 1VSVA 2IP1A 3AERB 3VU1A 3ZE1B 4E2WA 4EHNA 1Z4KA 1W0JD 4A10A 4C01A 3ADPA 3O7WA 4R8KA 4QPJC 1CRWG 4X8HA 5FD8A 3BMQA 4YFYA 5AICA 1UDXA 3CTMA 4EWLA 1EX7A 1V7PC 5ALNA 1EUDA 1JX6A 2OBFA 2Q5IA 4P3XA 2G82A 1LSUA 2FE1A 1UKCA 1NVFA 1EK2A 3JARB 4DJFC 5TLSA 1U99A 2Z9CA 3D54D 4LX0A 2FR0A 3NNSA 1REQB 3X1XA 3DWIA 5PNTA 5FX2A 1YVPA 2YZGA 2VG8A 4J9VA 1F12A 4WADA 3WMFA 4MICA 4ZZ2A 3T95A 2DBQA 4E5DA 1OVGA 2XCLA 2ZUUA 4LBZA 4URWR 4PG8A 3HL4A 3JQCA 4OTZA 2FI1A 3DUFB 4D74A 2WU1A 2I7VA 4OHYA 1DOHA 2YN0A 2XHZA 1ZHOA 3SQMA 4B9EA 1N6PA 1JQBA 3UUFA 4NJMB 4AS1A 1N78A 4EHFA 1KFEB 2H51A 3DAFA 3CKKA 3MUFA 1U3CA 1XZGA 2ES4A 1KQNA 3EYWA 1KI4A 2NVWA 2ZP1A 2ZSFA 4E21A 1TFRA 4M76B 1QIMA 2CFCA 4KQWA 3SXUB 3UK2A 3WNDA 3LMKA 3KKOA 2GN1A 2OQ2A 2ZQZA 3ER6A 4MV6A 5TQ0B 4DV0B 3S3TA 2OFFA 4YCSA 2QY6A 2BBOA 3BD6A 4RZHA 1XTSA 2RGAA 3FYDA 3RQIA 2OECA 1SXJB 2P78A 3TSYA 3WQRA 1XU4A 3ANYB 3ROEA 3LGAA 4UXIA 4WXPA 2PX2A 4ZAWA 3RYHA 1V1RA 3AUKA 2BBSA 4MW4A 3PRYA 4GE3A 5EIBC 4HG2A 4XX0A 1N7HA 5HIIA 3DCNA 4B4VA 3OP4A 2WHEA 4XLLA 1Q19A 4U7FA 1EVEA 4RUKA 5F9MA 1K7FB 3THOA 1U0HC 3QKUA 2ZI6A 1EVYA 4LJAA 3GAMA 1JG7A 4HD8A 4XJTA 3SZMA 2COUA 1K4YA 2QY9A 3IP8A 7ABPA 2QG6A 4UD2A 2PKEA 3WGLA 2V59A 1ORHA 4NDAA 3M6VA 3HU2A 1Q3KA 1JLLA 4JA0A 4U63A 4WNAB 2A88A 4F3CA 1MPTA 2P0YA 2OUIA 1YQEA 2JBWA 4C4SA 4F1JA 5B1EA 2IBTA 4HNTA 2IW3A 3K2IA 4JYAB 2AB0A 3IP6A 2ZJ7A 4RHEA 3MAAC 3OM9A 2AYZA 1ITZA 2Z83A 1T2UA 4MWBA 4TTIA 1TU4A 5ECYA 1JPNA 3RBAA 3GOHA 3L7MA 3KD3A 4L0MA 4RVNA 3QKWA 3RVQA 1ZAKA 4C7VA 3M5CA 4D43A 5BPFA 4FCWA 1H2AS 1YO6A 5C8ZA 4HQNA 1RYDA 1T8SA 4OHKA 4BFYA 1THMA 1VYVA 3LCMA 4GKBA 3WIVA 4YVFA 1OFUX 2EKPA 4WE3A 2VTBA 4B3CA 4WX2B 5KOHB 1FTGA 1PI3A 1JEDA 3F90A 1JI0A 2ZRDA 4RPJA 1XLVA 4ZQGA 3L8GA 1Q1QA 3IQWA 1FTYA 5HILA 2OXIA 1ZK4A 1XHEA 1H9BA 1XA0A 3I3SR 4J49A 5I8PA 3A9CA 2I67A 4I46A 1OROA 1EZ1A 1P7YA 3BRWD 4IYJA 4JZKA 3CPJB 5EFZA 2WEKA 4JVMA 2GRAA 2QVZX 3W2FA 4DTIA 4ENPA 3DDSA 3STXA 3BS4A 3FWNA 2PWBA 2Z6VA 2BFPA 1BA2A 4FJ1A 4BU1A 1KU6A 4BJ1A 1T36B 2VPZA 3D4BA 3OY7A 1VLHA 3U49A 1JJ7A 4LOIA 3GLRA 3OTOB 1NAHA 1N6KA 2CLMB 1XJQA 5EPOA 3SLGA 4AXBA 4CTNA 3QXHA 2QTZA 3BSYA 2SCUA 4JUAA 5DHTA 3L8DA 1IBLB 1NP6A 2RHLA 3FTEA 2REQA 3KSMA 4OFWA 5I7HA 4XIYA 2HBQA 3DV0B 3VGJA 3RANA 3QPDA 4AU1A 5KDLA 5D6OA 5IULC 4I1OA 4OXQA 1YRLA 3RTCA 3TQTA 1ATZA 2Z04A 1VXOA 4ZD6A 5J5AA 1SOMA 1JIVA 3H9BA 1F1JA 4LXYA 5DXAA 4DNQA 1ZZGA 5B37A 5ADUS 5BRAA 2HIGA 3QF7A 2JI4A 3COYA 5EUBA 1ZW1A 5EN4A 3AUXA 2P40A 3MIIA 1RCOC 2BFNA 3KYDB 4P3OA 2YV5A 1JFTA 3WLMA 1GCUA 1ST2A 3NCHA 2ACEA 2WZQA 4B8ZA 1D4FA 5F7JA 4MVJF 3EZXA 4DA0A 4IILA 2KI5A 2CNBA 4CCYB 4DDUA 4BXOA 3D1VA 1QIHA 5LL6P 1XCGB 1ZM4A 2YNMD 1CR1A 5KYTA 3RAPR 4LYDA 4RO0A 1NP3A 1C1XA 2JIQA 3HJRA 1UEIA 2VHWA 2GUGA 1U9IA 2WOJA 1N6OA 3C8ZA 3ENVA 2HNAA 1YR3A 2VYVA 3OZFA 1EHCA 3BSWA 5EGSA 5TMDA 2ZYTX 4DCUA 1D1PA 5C5EA 1TEHA 1Z5PA 4D9CA 4LWZA 1YS6A 4BVKA 1L7DA 5AW7A 2VH2A 1LBIA 1JEEA 4ML3A 1KS2A 3V8EA 5H4GA 1LPPA 2GCIA 4K9RA 4QO7A 2IS2A 1CZLA 1TMGE 4JC5A 1N5OX 2H4WA 2QX4A 1W0KD 3R0QA 3R7FA 3T5AA 1RYEA 1E1RD 3K94A 1YFLA 4KSBA 1DEAA 4X5OA 1G9XA 3OJXA 3U7QA 3I39X 1ZPDA 3H4IA 5F21A 4PYIA 1QUEA 5BSFA 3UFBA 3ROGA 4NBVA 1HDEA 1DQRA 1TFUA 1USGA 3JQQA 3L49A 3AUAA 4G09A 4JYZA 1J5XA 1FFGA 1YDWA 2O52A 4CLEA 2FZVA 3DBIA 4DREA 5NULA 1K6MA 3A11A 5TY0A 3V42A 3S7ZA 2I22A 3AL3A 1RWNA 4ENRA 4F72A 1UMBB 1FDWA 1K06A 2XA2A 5J2UF 3Q8MA 1IJFA 4ZU3A 2BSQA 4QEDA 2F8SA 2PFKA 1QQTA 1KHTA 3A6HA 1UT5A 4G01B 4EGCB 4CR8A 4BQOA 3BGOS 5HRUA 1Z18A 2FW8A 1CQJA 1GYPA 5AK0A 1DWQA 1CDZA 3K4HA 3TDNA 1OLSB 2VZEA 3OIVA 1N8TA 1ETUA 1I80A 3H7IA 3W4KA 4EZBA 5K9ZA 5KMGB 1WUTA 3M1LA 3HCCA 4RVDA 3SDZA 3JQ7B 3DE0X 2AOXA 2BFAA 4E88A 5EKTA 1JWLA 2QPTA 1UT8A 3IIMA 1MIOA 2V6BA 1POXA 3STYA 1DMRA 1O96A 3H0KA 4JOCA 1ESMA 2PUHA 2PHZA 2G6TA 1CDDA 4GQBA 4QT0A 1YA8A 4DAEA 2VP9A 4YMHA 1GTRA 5FI3A 1BFKA 3KHTA 3RTDA 3MT8A 3H97A 5DX8A 1QONA 2QLFA 2X15A 4LJ5A 4IHJB 3C3KA 5HKKD 5G0UA 5HUQA 1KAHA 3UJNA 3GY0A 5CCXA 3EX7C 5P8WA 3FHLA 3MTBA 3HV0A 3RUDA 4YMIA 1NSYA 3AHJA 3RRBA 4C0XA 5MFZA 1TVKA 3Q5GA 1LPOA 2P2SA 3PI6A 1T1RA 2R4QA 4TQ9A 1JIXA 1P2UA 1KC3A 1TDJA 1C3OB 2GXSA 2N42A 2WFLB 3H2KA 3S44A 3L06A 3ZBUA 5CA1A 4DYDA 3PVZA 1Q50A 3V97A 2CK3D 1ZDMA 2G4VA 3KFXA 2EGHA 4RIFA 5FOVA 3IT1A 1Q57A 1IBMB 3QVVA 3GK3A 5FADA 4EVSA 1XX6A 1NYTA 1T3LA 3QLUA 4CMKA 5D3MB 2BEUB 3LQKA 1UBNA 3EDQA 3O2SB 2F1JA 1DTWA 2NT3A 1UBGA 1U31A 4I5GA 1JG1A 4QTZA 2H16A 4JB0A 3SIXA 5LIRA 2OP1A 3LUAA 3TQOA 1IQUA 2HRZA 3ZY3A 1TNDA 4K2AA 1ZK1A 3F4BA 3FPCA 3SVTA 2VXCA 3H1PA 2QQ0A 1QC5B 1YT5A 4QU8A 2P90A 3GJZA 2DHRA 2P5UA 1VE6A 5IJ0B 5E2AA 1KOGA 1M2HA 3IUYA 4WJKB 5E6SA 3OTWA 3KXLA 1R4MB 1UJCA 3IR7A 4FVTA 1H6DA 5DO9A 3U1TA 4QUGA 4KRFA 5HIJA 1GJRA 2JFXA 3IV9A 1R16A 6ADHA 4DJ5X 3PIIA 4JT2A 7YASA 1BMDA 4N0EA 3DBRB 5CM9C 1QWSA 4QXOA 2QUZA 2GNPA 2JI8A 1F6DA 3PTAA 4YC7A 4PIMA 1I8TA 3IHTA 2ZBPA 3WMEA 4ND4A 2QTRA 3PT5A 2VHYA 1BMFD 1JG3A 2YWFA 1P72A 3EZYA 4MDHA 1VIMA 2A14A 3F4LA 1SCQA 1VLVA 4HPJB 5BNFA 3UHPA 1XEAA 5K6TA 1HLFA 2HA7A 4QUDA 3LRTA 1IM5A 3HR4A 4BNMA 821PA 5IP5A 1OZ0A 2PZEA 2YMQA 3STVA 4YO8A 4MTCA 3KOXA 1JEYA 1BCRA 2XDAA 5LYJA 1KP9A 1XC7A 3HB4X 5LZ8A 4CKBA 4MYDA 1JBEA 2J3QA 2RBGA 5HHTA 4Y6OA 1BGWA 4JVLA 4Z99A 2QB5A 4S04A 1IZ0A 5BVGA 4BVJA 4EQZA 3D8SA 3QUSA 3UH0A 5TJHA 2XDWA 4HTFB 3GLGB 5JZSA 2Q3JA 1JFFB 3ZY6A 4YP1A 4DQLA 3DMNA 1T8TA 4DDMA 3WHIA 2VCYA 2IWRA 4F45A 2VPYA 5EOVA 4HWTA 2ALJA 5C1BA 4D3FA 1WHTB 1XRMA 4IGEA 4B4UA 5FUQA 3H5OA 3IDZA 3O4VA 2ORVA 3D0RA 4A8PA 4EAAA 1FPMA 3VYRB 2PUDA 4CT5A 3NJ8A 5IM5A 2C99A 1EWQA 3I23A 1Y4SA 2B1IA 3X1DA 4PNHA 2VZLA 2KLBA 1QYDA 1AUOA 5FPTA 2PWAA 2WE8A 4P5DA 2OCBA 2QZPA 5DT9A 3UO8B 4ZC1A 2ZZNA 2BR4A 5J1TB 1YR9A 2W6JA 3TYXA 4KH1A 5ALXA 4B6OA 3TGPA 2F3RA 1TKRA 2FEAA 2FF5A 1XQ6A 2FKNA 4Y1FA 4D46A 2HQOA 1CRZA 4A3SA 1UANA 3NNDA 3CNHA 2ZZKA 2GK4A 4FUQA 3RI3A 2A9OA 3L7BA 3JQAA 4BLOA 4UNNA 1N3BA 2P3LA 3ETCA 4ZAZA 4JC0A 1UK7A 3MOGA 1CR0A 1G7CA 2HA2A 2BYTA 1E7SA 1Q91A 2C0CA 2R4UA 3B12A 4S12A 4U2KA 3V8QA 1QE3A 3N74A 3WLLA 3GJYA 4WN9B 3W0LB 4NCNA 1R6UA 4KUGA 2P6RA 2W2NA 1U3TA 3NTUA 5KYUA 2DSNA 3X1WA 4CGYA 1N32B 2DX7A 4XH9B 2X2OA 2XADA 1DFHA 2GBLC 4HB3A 2B8EA 3L1KA 2B94A 3IP3A 3SOZA 3UT6A 4TWIA 2A9FA 4DG9A 4CIYA 2V03A 1CD5A 1E1YA 3H5TA 2R6GA 1WOMA 2WYWA 4U5XA 5C2JB 3RYHB 5JUWA 2AC7A 3PFNA 4XX0B 4EUHA 3AHHA 3CUTA 3DVLA 4G1MB 4KSYA 5DP1A 3FSGD 1FFHA 3ZWWA 3GFSA 1L7BA 4KK3A 3U19A 4PAGA 4KREA 3FCAA 4NAHA 1KTVA 3KYJB 1N34B 4UCFA 1X0XA 4FFLA 3G89A 1ZVJA 5LIPA 3T7KA 3CIFA 3PJGA 4Q1CA 1AGPA 4J1TC 1L5HA 1RABA 3S8MA 2WF5A 1JLLB 2E5FA 2FSIA 2VUIB 1SXJC 1E5DA 1KJ9A 2VT6A 3PJDA 4B3HA 4BYGA 4D8TA 3U61B 2WG0A 3LKBA 4EKDA 1GVNB 1U2PA 4YV2A 5IYZA 5CDFA 4WOCA 5JY6A 3V2UA 1ZGZA 5MN6A 1IN7A 4OYHA 4DWWA 4EY7A 1QYRA 2NO6A 1N3IA 3OY2A 3COZA 4BATA 1IWOA 2ANCA 4ZVRA 4TXMA 2SKCA 3DNPA 2P79A 4LZLA 3BM5A 1HNNA 1ZC3A 3GPIA 4JLSA 4UJ5A 1M10A 5JC1A 4EJMA 3W1WA 4OQZA 5KTSA 1PLKA 4N12A 4LSZA 3QG1A 1O94C 3I5UA 2DZDA 1PNVA 2BR5A 2IYVA 2ZVJA 1DTEA 3H8SA 2BM1A 5AVWA 1O94D 4V3CA 4FZRA 3ZDFA 2PK3A 4TTVA 3N7UA 3QVXA 2XMQA 1Z37A 4V2UA 1JPUA 1O6GA 9MHTA 1PL8A 1KHHA 1OC2A 2IPAB 4FDVA 2LCQA 4NBRA 1E61A 2X0RA 4H6VA 4BQFA 1RLUA 1CF9A 1VLZA 3AKCA 3JSAA 3EGXB 3GCGA 5DRYA 1YOVA 2I4NA 2Q1YA 2ZSUA 3H1FA 5INTA 1WETA 3P9QA 4KIUA 4AJ2A 1UBEA 3VR4A 2XAAA 3QELA 3R5FA 1QP0A 4C7JA 4FYWA 2AH5A 4YUXA 4L3WA 4KBFA 1HMPA 5LVAA 1A04A 2IZOA 2HSJA 5DM1A 2CVPA 1WIWA 1GQQA 2YMLA 3HA3A 2VP5A 1FFCA 3RSFA 4XWWA 3KS9A 1JN0A 2WJPA 1JH8A 2GVZC 2I2WA 2JGNA 1E9RA 2WPNA 3G59A 2OEPA 1NV9A 3DVAA 4B2PA 1RAHA 3ZCTA 1K89A 2GDZA 1DBVO 1FDIA 2WFAA 1MT3A 3ILSA 1KA9H 3ZVLA 5K7SA 1NTRA 4HLCA 2LV8A 2O7NA 1COWD 3MTAA 1F4VA 4CV1A 3GLIE 2R48A 4M7PA 1P9RA 3QHPA 4MKZA 3B6EA 2IUYA 1M7BA 3HI6A 3NAGA 3O1LA 2Y92A 3K0AB 3MWEB 3CJQA 4OB8A 3R9XA 3OE4A 4PHCA 5AVQA 1N33B 3MJRA 1TXGA 3I9NA 4F3NA 4O4HA 3TQCA 2Q2WA 2WT4A 3OT1B 3ILVA 4OCZA 4BXOB 3LF1A 1E4YA 1LGYA 1SVUA 1T5LA 2H1VA 2ZBVA 4QJBA 3DKPA 3MWYW 3GFRA 4FE7A 3R9KA 3RUFA 2WW8A 1UKBA 4EI2A 4TTAA 1XTQA 4DLBA 1KJZA 3T0IA 1TRKA 4KH0A 4ITVA 3JWPA 1FFAA 1T1IA 2O7VA 4OMCA 3RS8A 1UMDA 5DM60 2B8WA 4I9NA 4FIZA 1F6WA 2EARA 3DL7A 1I5RA 2QROA 2DM6A 4JDUA 4OBBA 3K9WA 5KYXA 4DBVO 4RTMA 4ZVKA 3DAPA 2C5HA 3F98A 4RANA 2O5RA 2G5CA 4LYHA 2JIPA 4X85A 5HM6A 3AR9A 3PE6A 1Z4MA 2AOUA 1NFRA 2C5SA 3L7YA 3OEYA 4K28A 4L4SA 1AIPA 4RJLA 4EFDA 4N9QA 2B0CA 4W5QA 4M0LA 1B2LA 1HQYE 4MXDA 3IP1A 3GT0A 1K9SA 3NXKA 4WWHA 3U7QB 1Q7EA 1NXTA 3IOEA 4Y6PA 1NOIA 3Q7RA 4CQJA 3WTCA 4CTJA 1ESNA 2G7ZA 4JX8A 1F4LA 5CB8A 4C22A 1I7SB 5LUBA 3FD8A 2BPOA 4FW9A 1NVUQ 4IIXA 4X1OA 4GZ3A 3CMMA 5CPFA 3T7JA 1D8AA 3DP7A 4Q9HA 5EJ4A 3O4RA 3L6RA 5B12A 2H2IA 1W0JA 3LD9A 3ICEA 1U4NA 4KODA 2MYNA 4PHTA 2G5PA 3AHDA 4A0SA 3O1HB 5C3UA 4G84A 4JD5A 1TGVA 4AROA 1UM9B 2FW0A 2QD5A 3ZY5A 2R1ZA 1AKTA 3ZQ4A 4EKYA 2FRXA 5A6SA 3IJEB 1GPNA 3T3MB 5BWOA 1AO3A 1Q7RA 4OXIA 5JYDA 4ONEA 2ZKLA 1HSOA 3NV7A 1AQUA 1CQJB 3P8ZA 5FYQA 3LUGA 4JGGA 4QWMA 1EJ0A 3N2KA 2PBFA 1F8FA 5JV5A 1XA3A 3RVRA 1I3MA 1U5BA 4GR5A 4JVOA 3NTLA 4BNKA 3M4XA 3LDFA 4W5HA 4JXJA 2BFDB 3IX7A 4P81A 2XXJA 2BKUA 4E2XA 4OJNA 4AJLA 2HQRA 3PUZA 3IAM6 1O96B 4OGWA 3R8CA 2DWQA 3W04A 3CCFA 5LDDC 3D6FA 3E3LA 4YI3A 2VF2A 1TA4A 2G88A 4NMLA 4D97A 3A2LA 2GCGA 1NBME 3B9RA 4RNCA 5DFAA 3UWSA 3W9UA 4DMLA 5I7SA 1ZGAA 4B2YA 1FJXA 3LY8A 2EDCA 2PZBA 2LR0A 5IEJA 1EZZA 1A5TA 1HOTA 3H9JA 3T9CA 4DGSA 2Y2UA 2B8NA 1G2IA 4IDCA 4L02A 2VJOA 3HGMA 2QTVB 1EK6A 4LHXA 4X94A 4AP6A 4C2BA 4KR2A 1HX7A 2Q6OA 1NG1A 2VBIA 1XZCA 3QLTA 3RFVA 4QE3A 1TVKB 4I4NA 2D0DA 2RAPA 1T5BA 4IGKA 4MH0R 1CQWA 1TA9A 4U6SA 3W2HA 3WLHA 3KU1A 3TM4A 3DFZA 1HDOA 4UXJA 6GPBA 3C70A 2CN1A 3BFKA 3QQ5A 1Q17A 4XD7D 1PL6A 3BAFA 2GH1A 3PFBA 1UMKA 2QQFA 1H5NA 3K32A 3ECSA 4JXZA 3BF8A 4CGZA 1S2DA 4YYZA 1GNQA 2Z9BA 3C24A 3QTTA 4DJAA 4B3RB 3FG9A 1IAQA 3N2GB 3N5CA 5B3JA 4YYEA 2FMKA 4B8WA 3M33A 2J0UB 3IOMA 3O1IC 3A1UA 3P4YA 4I4IA 2ZIXB 3OEED 1X19A 2H5EA 2HJHA 2W8ZA 2Y1FA 4B3TB 4HDOB 1YIAA 6NULA 1P74A 3UENA 3ASVA 4P5PA 3CQ9A 2B83A 4MK4A 2CNWD 4KKXB 3O31A 2OBYA 4ACAA 5JFGA 3KEGA 3I4FA 2YIVX 4KGVA 3GD7A 2NZ2A 4ARBA 3UJPA 3I1IA 4DC9A 3RR2A 4GI5A 5FJIA 1D4ZA 4MYRA 4KNVA 1XPUA 4CEHA 2XWPA 1IJKA 2B1RA 2BFBB 2O0JA 2QXYA 2WMYA 3D02A 4MQ5A 5DF1A 3Q8KA 5BSEA 3MUNA 2A0XA 1LKZA 3TLCA 4XWGA 2H2WA 3NCTA 5LCXA 4NNJA 4D6PA 2P68A 3VDMA 4D99A 4BNJA 2OXFA 1DKOA 3AP2A 3M3PA 4QHTA 1L8XA 4HDNA 1XXHA 3F6YA 2IE8A 1Y8QB 1VGRA 1QG0A 1R6TA 5CIWA 5A4DA 4RA9A 4XOIA 3WLTA 1TAUA 1OR8A 1YRBA 2GKGA 1RAGA 1XWFA 4KVZA 1YS1X 4JLVA 4NU8X 1OF1A 4MW2A 4QU9A 1Z7GA 1OX6A 2BFMA 2XR1A 3EK2A 3KT8A 1PQUA 4R0VA 4MP3A 4ASUD 1H69A 1E94E 5JS7A 1SUEA 2OFXA 5LYJB 2WHPA 1G9SA 3ELUA 4CIAA 3CIOA 2MTBA 1QHIA 2IW1A 2OGZA 3KDPA 3ZKWA 4DSTA 5HGXA 1XTVA 4RLSA 1GU0A 5FHRA 5L3SA 4FCTA 3ABRB 3Q8XB 3ITDA 1JHRA 4TKZA 4ZQIA 4DSOA 1EFPA 4WOBA 1V8OA 3ZCXA 3NBMA 1BXGA 2J5RA 3OZEA 3ED1A 3PXGA 4ZZ3A 4BBZA 5K0ZA 4NBSA 3UGQA 5MN5A 4IFBA 5G3YA 1VBKA 1KI8A 3JQBA 4XQ0A<