1C44A

Sterol carrier protein 2 (scp2) from rabbit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
b'SSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGKAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STEROL CARRIER PROTEIN 2)
publication title Structure of sterol carrier protein 2 at 1.8 A resolution reveals a hydrophobic tunnel suitable for lipid binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Lipid binding protein
total genus 33
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1c44A00
4NURA 3CNUA 5EBVA 4MY3A 5AJLA 1IKTA 2CG3A 2HV2A 4JD6A 2I00A 2CFUA 4JGXA 1C44A 4AXHA 2QZTA 4AV7A 5EC4A 4UEIA 1PZ4A 2KSHA 3BDQA 3BKSA 2CG2A 2NBMA 3BN8A 3R1KA 5IV0A 2YHEA 3UY5A 2NBNA 2C0LB 2KSIA 3SXOA 1QNDA 3N7ZA 5A23A 5AIJA 4MY0A 3RYOA 2CFZA 2CX7A 3SXNA 1WFRA 2OZGA 3BKRA 4QB9A 4PDXA
chains in the Genus database with same CATH superfamily
4NURA 3CNUA 5EBVA 4MY3A 5AJLA 1IKTA 2CG3A 2HV2A 4JD6A 2I00A 3SSOA 2CFUA 2NSGA 4JGXA 4ZY7A 1C44A 4AXHA 2QZTA 4AV7A 5EC4A 3SSNA 4UEIA 1PZ4A 4NSSA 2KSHA 3BDQA 3BKSA 2CG2A 2NBMA 3BN8A 3R1KA 5IV0A 2NSFA 2YHEA 3UY5A 2NBNA 2C0LB 2KSIA 3SXOA 1QNDA 3N7ZA 5A23A 5AIJA 4MY0A 3SSMA 3RYOA 2CFZA 2CX7A 3SXNA 1WFRA 2OZGA 3BKRA 4QB9A 4PDXA
chains in the Genus database with same CATH topology
4NURA 3CNUA 5EBVA 4MY3A 5AJLA 1IKTA 2CG3A 2HV2A 4JD6A 2I00A 2CFUA 4JGXA 1C44A 4AXHA 2QZTA 4AV7A 5EC4A 4UEIA 1PZ4A 2KSHA 3BDQA 3BKSA 2CG2A 2NBMA 3BN8A 3R1KA 5IV0A 2YHEA 3UY5A 2NBNA 2C0LB 2KSIA 3SXOA 1QNDA 3N7ZA 5A23A 5AIJA 4MY0A 3RYOA 2CFZA 2CX7A 3SXNA 1WFRA 2OZGA 3BKRA 4QB9A 4PDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUR A;  3CNU A;  5EBV A;  4MY3 A;  5AJL A;  1IKT A;  2CG3 A;  2HV2 A;  4JD6 A;  2I00 A;  2CFU A;  4JGX A;  1C44 A;  4AXH A;  2QZT A;  4AV7 A;  5EC4 A;  4UEI A;  1PZ4 A;  2KSH A;  3BDQ A;  3BKS A;  2CG2 A;  2NBM A;  3BN8 A;  3R1K A;  5IV0 A;  2YHE A;  3UY5 A;  2NBN A;  2C0L B;  2KSI A;  3SXO A;  1QND A;  3N7Z A;  5A23 A;  5AIJ A;  4MY0 A;  3RYO A;  2CFZ A;  2CX7 A;  3SXN A;  1WFR A;  2OZG A;  3BKR A;  4QB9 A;  4PDX A; 
#chains in the Genus database with same CATH topology
 4NUR A;  3CNU A;  5EBV A;  4MY3 A;  5AJL A;  1IKT A;  2CG3 A;  2HV2 A;  4JD6 A;  2I00 A;  3SSO A;  2CFU A;  2NSG A;  4JGX A;  4ZY7 A;  1C44 A;  4AXH A;  2QZT A;  4AV7 A;  5EC4 A;  3SSN A;  4UEI A;  1PZ4 A;  4NSS A;  2KSH A;  3BDQ A;  3BKS A;  2CG2 A;  2NBM A;  3BN8 A;  3R1K A;  5IV0 A;  2NSF A;  2YHE A;  3UY5 A;  2NBN A;  2C0L B;  2KSI A;  3SXO A;  1QND A;  3N7Z A;  5A23 A;  5AIJ A;  4MY0 A;  3SSM A;  3RYO A;  2CFZ A;  2CX7 A;  3SXN A;  1WFR A;  2OZG A;  3BKR A;  4QB9 A;  4PDX A; 
#chains in the Genus database with same CATH homology
 4NUR A;  3CNU A;  5EBV A;  4MY3 A;  5AJL A;  1IKT A;  2CG3 A;  2HV2 A;  4JD6 A;  2I00 A;  2CFU A;  4JGX A;  1C44 A;  4AXH A;  2QZT A;  4AV7 A;  5EC4 A;  4UEI A;  1PZ4 A;  2KSH A;  3BDQ A;  3BKS A;  2CG2 A;  2NBM A;  3BN8 A;  3R1K A;  5IV0 A;  2YHE A;  3UY5 A;  2NBN A;  2C0L B;  2KSI A;  3SXO A;  1QND A;  3N7Z A;  5A23 A;  5AIJ A;  4MY0 A;  3RYO A;  2CFZ A;  2CX7 A;  3SXN A;  1WFR A;  2OZG A;  3BKR A;  4QB9 A;  4PDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...