1C44A

Sterol carrier protein 2 (scp2) from rabbit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
SSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGKAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of sterol carrier protein 2 at 1.8 A resolution reveals a hydrophobic tunnel suitable for lipid binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Lipid binding protein
molecule keywords PROTEIN (STEROL CARRIER PROTEIN 2)
total genus 33
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1c44A00
1PZ4A 2CFUA 2YHEA 2KSHA 5A23A 5AJLA 3N7ZA 3SXNA 4AXHA 1C44A 5EBVA 1IKTA 1WFRA 3BDQA 3UY5A 2CG2A 3BN8A 2HV2A 4MY3A 4PDXA 2CX7A 2I00A 2CFZA 2OZGA 4MY0A 2NBMA 5IV0A 2CG3A 2C0LB 3SXOA 4JGXA 4QB9A 2QZTA 4NURA 4UEIA 5EC4A 3BKRA 4AV7A 2NBNA 3RYOA 3CNUA 4JD6A 1QNDA 3BKSA 5AIJA 2KSIA 3R1KA
chains in the Genus database with same CATH superfamily
1PZ4A 2CFUA 2YHEA 2KSHA 2NSFA 5A23A 5AJLA 3N7ZA 3SXNA 4AXHA 1C44A 5EBVA 1IKTA 1WFRA 2NSGA 3BDQA 3UY5A 2CG2A 3BN8A 4NSSA 2HV2A 4MY3A 4PDXA 2CX7A 2I00A 2CFZA 2OZGA 4MY0A 2NBMA 5IV0A 3SSOA 2CG3A 2C0LB 3SXOA 4JGXA 4QB9A 3SSMA 2QZTA 4NURA 4UEIA 5EC4A 3BKRA 4AV7A 3SSNA 4ZY7A 2NBNA 3RYOA 3CNUA 4JD6A 1QNDA 3BKSA 5AIJA 2KSIA 3R1KA
chains in the Genus database with same CATH topology
1PZ4A 2CFUA 2YHEA 2KSHA 5A23A 5AJLA 3N7ZA 3SXNA 4AXHA 1C44A 5EBVA 1IKTA 1WFRA 3BDQA 3UY5A 2CG2A 3BN8A 2HV2A 4MY3A 4PDXA 2CX7A 2I00A 2CFZA 2OZGA 4MY0A 2NBMA 5IV0A 2CG3A 2C0LB 3SXOA 4JGXA 4QB9A 2QZTA 4NURA 4UEIA 5EC4A 3BKRA 4AV7A 2NBNA 3RYOA 3CNUA 4JD6A 1QNDA 3BKSA 5AIJA 2KSIA 3R1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZ4 A;  2CFU A;  2YHE A;  2KSH A;  5A23 A;  5AJL A;  3N7Z A;  3SXN A;  4AXH A;  1C44 A;  5EBV A;  1IKT A;  1WFR A;  3BDQ A;  3UY5 A;  2CG2 A;  3BN8 A;  2HV2 A;  4MY3 A;  4PDX A;  2CX7 A;  2I00 A;  2CFZ A;  2OZG A;  4MY0 A;  2NBM A;  5IV0 A;  2CG3 A;  2C0L B;  3SXO A;  4JGX A;  4QB9 A;  2QZT A;  4NUR A;  4UEI A;  5EC4 A;  3BKR A;  4AV7 A;  2NBN A;  3RYO A;  3CNU A;  4JD6 A;  1QND A;  3BKS A;  5AIJ A;  2KSI A;  3R1K A; 
#chains in the Genus database with same CATH topology
 1PZ4 A;  2CFU A;  2YHE A;  2KSH A;  2NSF A;  5A23 A;  5AJL A;  3N7Z A;  3SXN A;  4AXH A;  1C44 A;  5EBV A;  1IKT A;  1WFR A;  2NSG A;  3BDQ A;  3UY5 A;  2CG2 A;  3BN8 A;  4NSS A;  2HV2 A;  4MY3 A;  4PDX A;  2CX7 A;  2I00 A;  2CFZ A;  2OZG A;  4MY0 A;  2NBM A;  5IV0 A;  3SSO A;  2CG3 A;  2C0L B;  3SXO A;  4JGX A;  4QB9 A;  3SSM A;  2QZT A;  4NUR A;  4UEI A;  5EC4 A;  3BKR A;  4AV7 A;  3SSN A;  4ZY7 A;  2NBN A;  3RYO A;  3CNU A;  4JD6 A;  1QND A;  3BKS A;  5AIJ A;  2KSI A;  3R1K A; 
#chains in the Genus database with same CATH homology
 1PZ4 A;  2CFU A;  2YHE A;  2KSH A;  5A23 A;  5AJL A;  3N7Z A;  3SXN A;  4AXH A;  1C44 A;  5EBV A;  1IKT A;  1WFR A;  3BDQ A;  3UY5 A;  2CG2 A;  3BN8 A;  2HV2 A;  4MY3 A;  4PDX A;  2CX7 A;  2I00 A;  2CFZ A;  2OZG A;  4MY0 A;  2NBM A;  5IV0 A;  2CG3 A;  2C0L B;  3SXO A;  4JGX A;  4QB9 A;  2QZT A;  4NUR A;  4UEI A;  5EC4 A;  3BKR A;  4AV7 A;  2NBN A;  3RYO A;  3CNU A;  4JD6 A;  1QND A;  3BKS A;  5AIJ A;  2KSI A;  3R1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...