1C44A

Sterol carrier protein 2 (scp2) from rabbit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
SSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGKAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STEROL CARRIER PROTEIN 2)
publication title Structure of sterol carrier protein 2 at 1.8 A resolution reveals a hydrophobic tunnel suitable for lipid binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Lipid binding protein
total genus 33
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1c44A00
3R1KA 2CG2A 2NBMA 3BKSA 4JGXA 1IKTA 4MY0A 2QZTA 1PZ4A 2NBNA 2HV2A 5EC4A 2C0LB 5EBVA 1C44A 4AV7A 5AIJA 3BKRA 3SXOA 5AJLA 4JD6A 2OZGA 5IV0A 3SXNA 1WFRA 3BN8A 2CFUA 2CFZA 4PDXA 3RYOA 2KSHA 1QNDA 4UEIA 4AXHA 5A23A 2YHEA 3N7ZA 3BDQA 2CG3A 2KSIA 4MY3A 3UY5A 4NURA 2CX7A 4QB9A 3CNUA 2I00A
chains in the Genus database with same CATH superfamily
3R1KA 2CG2A 4NSSA 3SSNA 2NBMA 3BKSA 4JGXA 1IKTA 4MY0A 2NSFA 2QZTA 1PZ4A 2NBNA 2HV2A 5EC4A 2C0LB 5EBVA 1C44A 4AV7A 5AIJA 3BKRA 3SXOA 5AJLA 4JD6A 2OZGA 5IV0A 3SXNA 1WFRA 3BN8A 3SSOA 2CFUA 2CFZA 4PDXA 3RYOA 2KSHA 1QNDA 4UEIA 4AXHA 5A23A 2YHEA 3N7ZA 3BDQA 2CG3A 2KSIA 4MY3A 3UY5A 2NSGA 4NURA 2CX7A 3SSMA 4QB9A 4ZY7A 3CNUA 2I00A
chains in the Genus database with same CATH topology
3R1KA 2CG2A 2NBMA 3BKSA 4JGXA 1IKTA 4MY0A 2QZTA 1PZ4A 2NBNA 2HV2A 5EC4A 2C0LB 5EBVA 1C44A 4AV7A 5AIJA 3BKRA 3SXOA 5AJLA 4JD6A 2OZGA 5IV0A 3SXNA 1WFRA 3BN8A 2CFUA 2CFZA 4PDXA 3RYOA 2KSHA 1QNDA 4UEIA 4AXHA 5A23A 2YHEA 3N7ZA 3BDQA 2CG3A 2KSIA 4MY3A 3UY5A 4NURA 2CX7A 4QB9A 3CNUA 2I00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1K A;  2CG2 A;  2NBM A;  3BKS A;  4JGX A;  1IKT A;  4MY0 A;  2QZT A;  1PZ4 A;  2NBN A;  2HV2 A;  5EC4 A;  2C0L B;  5EBV A;  1C44 A;  4AV7 A;  5AIJ A;  3BKR A;  3SXO A;  5AJL A;  4JD6 A;  2OZG A;  5IV0 A;  3SXN A;  1WFR A;  3BN8 A;  2CFU A;  2CFZ A;  4PDX A;  3RYO A;  2KSH A;  1QND A;  4UEI A;  4AXH A;  5A23 A;  2YHE A;  3N7Z A;  3BDQ A;  2CG3 A;  2KSI A;  4MY3 A;  3UY5 A;  4NUR A;  2CX7 A;  4QB9 A;  3CNU A;  2I00 A; 
#chains in the Genus database with same CATH topology
 3R1K A;  2CG2 A;  4NSS A;  3SSN A;  2NBM A;  3BKS A;  4JGX A;  1IKT A;  4MY0 A;  2NSF A;  2QZT A;  1PZ4 A;  2NBN A;  2HV2 A;  5EC4 A;  2C0L B;  5EBV A;  1C44 A;  4AV7 A;  5AIJ A;  3BKR A;  3SXO A;  5AJL A;  4JD6 A;  2OZG A;  5IV0 A;  3SXN A;  1WFR A;  3BN8 A;  3SSO A;  2CFU A;  2CFZ A;  4PDX A;  3RYO A;  2KSH A;  1QND A;  4UEI A;  4AXH A;  5A23 A;  2YHE A;  3N7Z A;  3BDQ A;  2CG3 A;  2KSI A;  4MY3 A;  3UY5 A;  2NSG A;  4NUR A;  2CX7 A;  3SSM A;  4QB9 A;  4ZY7 A;  3CNU A;  2I00 A; 
#chains in the Genus database with same CATH homology
 3R1K A;  2CG2 A;  2NBM A;  3BKS A;  4JGX A;  1IKT A;  4MY0 A;  2QZT A;  1PZ4 A;  2NBN A;  2HV2 A;  5EC4 A;  2C0L B;  5EBV A;  1C44 A;  4AV7 A;  5AIJ A;  3BKR A;  3SXO A;  5AJL A;  4JD6 A;  2OZG A;  5IV0 A;  3SXN A;  1WFR A;  3BN8 A;  2CFU A;  2CFZ A;  4PDX A;  3RYO A;  2KSH A;  1QND A;  4UEI A;  4AXH A;  5A23 A;  2YHE A;  3N7Z A;  3BDQ A;  2CG3 A;  2KSI A;  4MY3 A;  3UY5 A;  4NUR A;  2CX7 A;  4QB9 A;  3CNU A;  2I00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...