1C44A

Sterol carrier protein 2 (scp2) from rabbit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
SSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGKAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of sterol carrier protein 2 at 1.8 A resolution reveals a hydrophobic tunnel suitable for lipid binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Lipid binding protein
molecule keywords PROTEIN (STEROL CARRIER PROTEIN 2)
total genus 33
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1c44A00
2CX7A 2I00A 4QB9A 2CFUA 4PDXA 2NBMA 3UY5A 2CFZA 3BN8A 3N7ZA 5AJLA 3R1KA 2QZTA 5IV0A 2YHEA 2OZGA 1PZ4A 3BDQA 4JD6A 1WFRA 2CG3A 2KSIA 3BKRA 1QNDA 4UEIA 5AIJA 1IKTA 3SXOA 4NURA 2NBNA 3CNUA 4AXHA 2CG2A 4MY0A 3SXNA 5A23A 1C44A 2HV2A 5EBVA 2C0LB 3BKSA 4JGXA 5EC4A 3RYOA 2KSHA 4MY3A 4AV7A
chains in the Genus database with same CATH superfamily
2CX7A 2I00A 4QB9A 2CFUA 4PDXA 2NBMA 3UY5A 2CFZA 3BN8A 3N7ZA 5AJLA 3SSMA 2NSGA 3R1KA 2QZTA 5IV0A 2YHEA 4ZY7A 2OZGA 1PZ4A 3BDQA 4JD6A 1WFRA 2CG3A 2KSIA 3BKRA 1QNDA 4UEIA 3SSNA 1IKTA 2NSFA 3SXOA 5AIJA 4NURA 4NSSA 2NBNA 3CNUA 4AXHA 2CG2A 4MY0A 3SXNA 5A23A 1C44A 2HV2A 5EBVA 2C0LB 3SSOA 3BKSA 4JGXA 5EC4A 3RYOA 2KSHA 4MY3A 4AV7A
chains in the Genus database with same CATH topology
2CX7A 2I00A 4QB9A 2CFUA 4PDXA 2NBMA 3UY5A 2CFZA 3BN8A 3N7ZA 5AJLA 3R1KA 2QZTA 5IV0A 2YHEA 2OZGA 1PZ4A 3BDQA 4JD6A 1WFRA 2CG3A 2KSIA 3BKRA 1QNDA 4UEIA 5AIJA 1IKTA 3SXOA 4NURA 2NBNA 3CNUA 4AXHA 2CG2A 4MY0A 3SXNA 5A23A 1C44A 2HV2A 5EBVA 2C0LB 3BKSA 4JGXA 5EC4A 3RYOA 2KSHA 4MY3A 4AV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX7 A;  2I00 A;  4QB9 A;  2CFU A;  4PDX A;  2NBM A;  3UY5 A;  2CFZ A;  3BN8 A;  3N7Z A;  5AJL A;  3R1K A;  2QZT A;  5IV0 A;  2YHE A;  2OZG A;  1PZ4 A;  3BDQ A;  4JD6 A;  1WFR A;  2CG3 A;  2KSI A;  3BKR A;  1QND A;  4UEI A;  5AIJ A;  1IKT A;  3SXO A;  4NUR A;  2NBN A;  3CNU A;  4AXH A;  2CG2 A;  4MY0 A;  3SXN A;  5A23 A;  1C44 A;  2HV2 A;  5EBV A;  2C0L B;  3BKS A;  4JGX A;  5EC4 A;  3RYO A;  2KSH A;  4MY3 A;  4AV7 A; 
#chains in the Genus database with same CATH topology
 2CX7 A;  2I00 A;  4QB9 A;  2CFU A;  4PDX A;  2NBM A;  3UY5 A;  2CFZ A;  3BN8 A;  3N7Z A;  5AJL A;  3SSM A;  2NSG A;  3R1K A;  2QZT A;  5IV0 A;  2YHE A;  4ZY7 A;  2OZG A;  1PZ4 A;  3BDQ A;  4JD6 A;  1WFR A;  2CG3 A;  2KSI A;  3BKR A;  1QND A;  4UEI A;  3SSN A;  1IKT A;  2NSF A;  3SXO A;  5AIJ A;  4NUR A;  4NSS A;  2NBN A;  3CNU A;  4AXH A;  2CG2 A;  4MY0 A;  3SXN A;  5A23 A;  1C44 A;  2HV2 A;  5EBV A;  2C0L B;  3SSO A;  3BKS A;  4JGX A;  5EC4 A;  3RYO A;  2KSH A;  4MY3 A;  4AV7 A; 
#chains in the Genus database with same CATH homology
 2CX7 A;  2I00 A;  4QB9 A;  2CFU A;  4PDX A;  2NBM A;  3UY5 A;  2CFZ A;  3BN8 A;  3N7Z A;  5AJL A;  3R1K A;  2QZT A;  5IV0 A;  2YHE A;  2OZG A;  1PZ4 A;  3BDQ A;  4JD6 A;  1WFR A;  2CG3 A;  2KSI A;  3BKR A;  1QND A;  4UEI A;  5AIJ A;  1IKT A;  3SXO A;  4NUR A;  2NBN A;  3CNU A;  4AXH A;  2CG2 A;  4MY0 A;  3SXN A;  5A23 A;  1C44 A;  2HV2 A;  5EBV A;  2C0L B;  3BKS A;  4JGX A;  5EC4 A;  3RYO A;  2KSH A;  4MY3 A;  4AV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...