3BDQA

Room tempreture crystal structure of sterol carrier protein-2 like-2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'GIRMSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2-like 2
molecule tags Lipid transport
source organism Aedes aegypti
publication title Three-dimensional structure/function analysis of SCP-2-like2 reveals differences among SCP-2 family members.
pubmed doi rcsb
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bdqA00
1C44A 3SXNA 2I00A 3R1KA 5IV0A 5EBVA 3BDQA 1QNDA 2KSIA 4JD6A 2HV2A 2YHEA 1IKTA 3CNUA 4JGXA 2CFUA 3BKRA 2OZGA 5A23A 5EC4A 5AIJA 5AJLA 2CG3A 1WFRA 3UY5A 4MY0A 1PZ4A 3BN8A 3N7ZA 2CX7A 4MY3A 4NURA 2QZTA 3RYOA 4AV7A 2KSHA 3BKSA 4UEIA 2NBNA 2CG2A 4AXHA 2CFZA 4QB9A 2C0LB 2NBMA 4PDXA 3SXOA
chains in the Genus database with same CATH superfamily
4ZY7A 1C44A 3SXNA 2I00A 3R1KA 5IV0A 5EBVA 3BDQA 1QNDA 2KSIA 4JD6A 2HV2A 2NSGA 2YHEA 1IKTA 2NSFA 3CNUA 4JGXA 2CFUA 4NSSA 3SSNA 3BKRA 2OZGA 5A23A 5EC4A 5AIJA 5AJLA 2CG3A 1WFRA 3UY5A 4MY0A 1PZ4A 3BN8A 3N7ZA 2CX7A 4MY3A 4NURA 2QZTA 3RYOA 4AV7A 2KSHA 3SSOA 3BKSA 4UEIA 3SSMA 2NBNA 2CG2A 4AXHA 2CFZA 4QB9A 2C0LB 2NBMA 4PDXA 3SXOA
chains in the Genus database with same CATH topology
1C44A 3SXNA 2I00A 3R1KA 5IV0A 5EBVA 3BDQA 1QNDA 2KSIA 4JD6A 2HV2A 2YHEA 1IKTA 3CNUA 4JGXA 2CFUA 3BKRA 2OZGA 5A23A 5EC4A 5AIJA 5AJLA 2CG3A 1WFRA 3UY5A 4MY0A 1PZ4A 3BN8A 3N7ZA 2CX7A 4MY3A 4NURA 2QZTA 3RYOA 4AV7A 2KSHA 3BKSA 4UEIA 2NBNA 2CG2A 4AXHA 2CFZA 4QB9A 2C0LB 2NBMA 4PDXA 3SXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C44 A;  3SXN A;  2I00 A;  3R1K A;  5IV0 A;  5EBV A;  3BDQ A;  1QND A;  2KSI A;  4JD6 A;  2HV2 A;  2YHE A;  1IKT A;  3CNU A;  4JGX A;  2CFU A;  3BKR A;  2OZG A;  5A23 A;  5EC4 A;  5AIJ A;  5AJL A;  2CG3 A;  1WFR A;  3UY5 A;  4MY0 A;  1PZ4 A;  3BN8 A;  3N7Z A;  2CX7 A;  4MY3 A;  4NUR A;  2QZT A;  3RYO A;  4AV7 A;  2KSH A;  3BKS A;  4UEI A;  2NBN A;  2CG2 A;  4AXH A;  2CFZ A;  4QB9 A;  2C0L B;  2NBM A;  4PDX A;  3SXO A; 
#chains in the Genus database with same CATH topology
 4ZY7 A;  1C44 A;  3SXN A;  2I00 A;  3R1K A;  5IV0 A;  5EBV A;  3BDQ A;  1QND A;  2KSI A;  4JD6 A;  2HV2 A;  2NSG A;  2YHE A;  1IKT A;  2NSF A;  3CNU A;  4JGX A;  2CFU A;  4NSS A;  3SSN A;  3BKR A;  2OZG A;  5A23 A;  5EC4 A;  5AIJ A;  5AJL A;  2CG3 A;  1WFR A;  3UY5 A;  4MY0 A;  1PZ4 A;  3BN8 A;  3N7Z A;  2CX7 A;  4MY3 A;  4NUR A;  2QZT A;  3RYO A;  4AV7 A;  2KSH A;  3SSO A;  3BKS A;  4UEI A;  3SSM A;  2NBN A;  2CG2 A;  4AXH A;  2CFZ A;  4QB9 A;  2C0L B;  2NBM A;  4PDX A;  3SXO A; 
#chains in the Genus database with same CATH homology
 1C44 A;  3SXN A;  2I00 A;  3R1K A;  5IV0 A;  5EBV A;  3BDQ A;  1QND A;  2KSI A;  4JD6 A;  2HV2 A;  2YHE A;  1IKT A;  3CNU A;  4JGX A;  2CFU A;  3BKR A;  2OZG A;  5A23 A;  5EC4 A;  5AIJ A;  5AJL A;  2CG3 A;  1WFR A;  3UY5 A;  4MY0 A;  1PZ4 A;  3BN8 A;  3N7Z A;  2CX7 A;  4MY3 A;  4NUR A;  2QZT A;  3RYO A;  4AV7 A;  2KSH A;  3BKS A;  4UEI A;  2NBN A;  2CG2 A;  4AXH A;  2CFZ A;  4QB9 A;  2C0L B;  2NBM A;  4PDX A;  3SXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...