3BDQA

Room tempreture crystal structure of sterol carrier protein-2 like-2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
GIRMSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure/function analysis of SCP-2-like2 reveals differences among SCP-2 family members.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2-like 2
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bdqA00
3SXOA 4JGXA 3SXNA 2OZGA 2CG3A 1WFRA 5AJLA 3RYOA 5IV0A 1QNDA 3R1KA 2NBNA 2YHEA 4NURA 3BKSA 1C44A 2KSIA 2CG2A 3BDQA 2QZTA 1PZ4A 4QB9A 2CFUA 3BN8A 3N7ZA 2I00A 4UEIA 5EBVA 2CX7A 2KSHA 5AIJA 4AV7A 5A23A 4MY3A 2C0LB 4AXHA 4JD6A 4MY0A 3CNUA 4PDXA 1IKTA 2CFZA 5EC4A 2HV2A 3BKRA 2NBMA 3UY5A
chains in the Genus database with same CATH superfamily
3SXOA 4JGXA 3SXNA 4ZY7A 2OZGA 2CG3A 1WFRA 5AJLA 3RYOA 3SSMA 1QNDA 3R1KA 5IV0A 2NBNA 2YHEA 4NURA 3BKSA 1C44A 2KSIA 2CG2A 3BDQA 4NSSA 2QZTA 1PZ4A 4QB9A 2CFUA 3BN8A 3N7ZA 2I00A 4UEIA 5EBVA 2NSGA 2CX7A 2KSHA 5AIJA 2NSFA 4AV7A 5A23A 4MY3A 2C0LB 4AXHA 4JD6A 4MY0A 3CNUA 3SSOA 4PDXA 1IKTA 2CFZA 5EC4A 2HV2A 3BKRA 3SSNA 2NBMA 3UY5A
chains in the Genus database with same CATH topology
3SXOA 4JGXA 3SXNA 2OZGA 2CG3A 1WFRA 5AJLA 3RYOA 5IV0A 1QNDA 3R1KA 2NBNA 2YHEA 4NURA 3BKSA 1C44A 2KSIA 2CG2A 3BDQA 2QZTA 1PZ4A 4QB9A 2CFUA 3BN8A 3N7ZA 2I00A 4UEIA 5EBVA 2CX7A 2KSHA 5AIJA 4AV7A 5A23A 4MY3A 2C0LB 4AXHA 4JD6A 4MY0A 3CNUA 4PDXA 1IKTA 2CFZA 5EC4A 2HV2A 3BKRA 2NBMA 3UY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXO A;  4JGX A;  3SXN A;  2OZG A;  2CG3 A;  1WFR A;  5AJL A;  3RYO A;  5IV0 A;  1QND A;  3R1K A;  2NBN A;  2YHE A;  4NUR A;  3BKS A;  1C44 A;  2KSI A;  2CG2 A;  3BDQ A;  2QZT A;  1PZ4 A;  4QB9 A;  2CFU A;  3BN8 A;  3N7Z A;  2I00 A;  4UEI A;  5EBV A;  2CX7 A;  2KSH A;  5AIJ A;  4AV7 A;  5A23 A;  4MY3 A;  2C0L B;  4AXH A;  4JD6 A;  4MY0 A;  3CNU A;  4PDX A;  1IKT A;  2CFZ A;  5EC4 A;  2HV2 A;  3BKR A;  2NBM A;  3UY5 A; 
#chains in the Genus database with same CATH topology
 3SXO A;  4JGX A;  3SXN A;  4ZY7 A;  2OZG A;  2CG3 A;  1WFR A;  5AJL A;  3RYO A;  3SSM A;  1QND A;  3R1K A;  5IV0 A;  2NBN A;  2YHE A;  4NUR A;  3BKS A;  1C44 A;  2KSI A;  2CG2 A;  3BDQ A;  4NSS A;  2QZT A;  1PZ4 A;  4QB9 A;  2CFU A;  3BN8 A;  3N7Z A;  2I00 A;  4UEI A;  5EBV A;  2NSG A;  2CX7 A;  2KSH A;  5AIJ A;  2NSF A;  4AV7 A;  5A23 A;  4MY3 A;  2C0L B;  4AXH A;  4JD6 A;  4MY0 A;  3CNU A;  3SSO A;  4PDX A;  1IKT A;  2CFZ A;  5EC4 A;  2HV2 A;  3BKR A;  3SSN A;  2NBM A;  3UY5 A; 
#chains in the Genus database with same CATH homology
 3SXO A;  4JGX A;  3SXN A;  2OZG A;  2CG3 A;  1WFR A;  5AJL A;  3RYO A;  5IV0 A;  1QND A;  3R1K A;  2NBN A;  2YHE A;  4NUR A;  3BKS A;  1C44 A;  2KSI A;  2CG2 A;  3BDQ A;  2QZT A;  1PZ4 A;  4QB9 A;  2CFU A;  3BN8 A;  3N7Z A;  2I00 A;  4UEI A;  5EBV A;  2CX7 A;  2KSH A;  5AIJ A;  4AV7 A;  5A23 A;  4MY3 A;  2C0L B;  4AXH A;  4JD6 A;  4MY0 A;  3CNU A;  4PDX A;  1IKT A;  2CFZ A;  5EC4 A;  2HV2 A;  3BKR A;  2NBM A;  3UY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...