3BDQA

Room tempreture crystal structure of sterol carrier protein-2 like-2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
GIRMSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure/function analysis of SCP-2-like2 reveals differences among SCP-2 family members.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2-like 2
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bdqA00
5EBVA 5IV0A 2CG3A 3BDQA 4MY3A 1C44A 3CNUA 3BKRA 5EC4A 1WFRA 3SXNA 4NURA 2HV2A 2I00A 2CG2A 2YHEA 4AXHA 4QB9A 2CX7A 4AV7A 4MY0A 1PZ4A 2KSHA 3UY5A 5AJLA 1QNDA 2NBMA 2CFZA 4JGXA 4UEIA 3N7ZA 2NBNA 3R1KA 3SXOA 2CFUA 5AIJA 2KSIA 4PDXA 1IKTA 5A23A 3RYOA 2QZTA 2OZGA 3BKSA 4JD6A 3BN8A 2C0LB
chains in the Genus database with same CATH superfamily
5EBVA 5IV0A 2CG3A 3BDQA 4MY3A 1C44A 3CNUA 2NSGA 3BKRA 5EC4A 1WFRA 3SXNA 4NURA 2HV2A 2I00A 2CG2A 3SSOA 2YHEA 4AXHA 4QB9A 2CX7A 3SSMA 4MY0A 4AV7A 1PZ4A 2KSHA 3UY5A 4ZY7A 5AJLA 1QNDA 2NBMA 2CFZA 3SSNA 4JGXA 4NSSA 4UEIA 3N7ZA 2NSFA 2NBNA 3R1KA 3SXOA 2CFUA 5AIJA 2KSIA 4PDXA 1IKTA 5A23A 3RYOA 2QZTA 2OZGA 3BKSA 4JD6A 3BN8A 2C0LB
chains in the Genus database with same CATH topology
5EBVA 5IV0A 2CG3A 3BDQA 4MY3A 1C44A 3CNUA 3BKRA 5EC4A 1WFRA 3SXNA 4NURA 2HV2A 2I00A 2CG2A 2YHEA 4AXHA 4QB9A 2CX7A 4AV7A 4MY0A 1PZ4A 2KSHA 3UY5A 5AJLA 1QNDA 2NBMA 2CFZA 4JGXA 4UEIA 3N7ZA 2NBNA 3R1KA 3SXOA 2CFUA 5AIJA 2KSIA 4PDXA 1IKTA 5A23A 3RYOA 2QZTA 2OZGA 3BKSA 4JD6A 3BN8A 2C0LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBV A;  5IV0 A;  2CG3 A;  3BDQ A;  4MY3 A;  1C44 A;  3CNU A;  3BKR A;  5EC4 A;  1WFR A;  3SXN A;  4NUR A;  2HV2 A;  2I00 A;  2CG2 A;  2YHE A;  4AXH A;  4QB9 A;  2CX7 A;  4AV7 A;  4MY0 A;  1PZ4 A;  2KSH A;  3UY5 A;  5AJL A;  1QND A;  2NBM A;  2CFZ A;  4JGX A;  4UEI A;  3N7Z A;  2NBN A;  3R1K A;  3SXO A;  2CFU A;  5AIJ A;  2KSI A;  4PDX A;  1IKT A;  5A23 A;  3RYO A;  2QZT A;  2OZG A;  3BKS A;  4JD6 A;  3BN8 A;  2C0L B; 
#chains in the Genus database with same CATH topology
 5EBV A;  5IV0 A;  2CG3 A;  3BDQ A;  4MY3 A;  1C44 A;  3CNU A;  2NSG A;  3BKR A;  5EC4 A;  1WFR A;  3SXN A;  4NUR A;  2HV2 A;  2I00 A;  2CG2 A;  3SSO A;  2YHE A;  4AXH A;  4QB9 A;  2CX7 A;  3SSM A;  4MY0 A;  4AV7 A;  1PZ4 A;  2KSH A;  3UY5 A;  4ZY7 A;  5AJL A;  1QND A;  2NBM A;  2CFZ A;  3SSN A;  4JGX A;  4NSS A;  4UEI A;  3N7Z A;  2NSF A;  2NBN A;  3R1K A;  3SXO A;  2CFU A;  5AIJ A;  2KSI A;  4PDX A;  1IKT A;  5A23 A;  3RYO A;  2QZT A;  2OZG A;  3BKS A;  4JD6 A;  3BN8 A;  2C0L B; 
#chains in the Genus database with same CATH homology
 5EBV A;  5IV0 A;  2CG3 A;  3BDQ A;  4MY3 A;  1C44 A;  3CNU A;  3BKR A;  5EC4 A;  1WFR A;  3SXN A;  4NUR A;  2HV2 A;  2I00 A;  2CG2 A;  2YHE A;  4AXH A;  4QB9 A;  2CX7 A;  4AV7 A;  4MY0 A;  1PZ4 A;  2KSH A;  3UY5 A;  5AJL A;  1QND A;  2NBM A;  2CFZ A;  4JGX A;  4UEI A;  3N7Z A;  2NBN A;  3R1K A;  3SXO A;  2CFU A;  5AIJ A;  2KSI A;  4PDX A;  1IKT A;  5A23 A;  3RYO A;  2QZT A;  2OZG A;  3BKS A;  4JD6 A;  3BN8 A;  2C0L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...