2QZTA

Crystal structure of sterol carrier protein 2 like 2 (scp2-l2) from aedes aegypti
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
GIRMSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure/function analysis of SCP-2-like2 reveals differences among SCP-2 family members.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2-like 2
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2qztA00
3SXNA 4UEIA 2KSIA 3R1KA 4MY3A 2HV2A 2NBNA 5IV0A 3UY5A 2YHEA 3BN8A 3SXOA 3BDQA 2CFZA 4JGXA 4JD6A 1IKTA 4MY0A 4QB9A 3N7ZA 1PZ4A 4PDXA 2CFUA 2CX7A 5AIJA 4NURA 2CG3A 2QZTA 4AV7A 3CNUA 1QNDA 2NBMA 5AJLA 3BKRA 2KSHA 5A23A 1C44A 2CG2A 2I00A 3RYOA 1WFRA 4AXHA 2C0LB 5EBVA 3BKSA 5EC4A 2OZGA
chains in the Genus database with same CATH superfamily
3SXNA 4UEIA 2KSIA 3R1KA 4MY3A 3SSMA 2HV2A 2NBNA 4NSSA 5IV0A 3UY5A 2YHEA 3BN8A 3SXOA 3BDQA 2CFZA 4JGXA 4JD6A 1IKTA 4MY0A 4QB9A 3N7ZA 1PZ4A 4PDXA 2CFUA 2CX7A 5AIJA 4NURA 2CG3A 2QZTA 4AV7A 4ZY7A 3CNUA 1QNDA 2NBMA 5AJLA 3BKRA 2KSHA 5A23A 2NSGA 1C44A 2CG2A 2I00A 3SSNA 3SSOA 3RYOA 1WFRA 4AXHA 2NSFA 2C0LB 5EBVA 3BKSA 5EC4A 2OZGA
chains in the Genus database with same CATH topology
3SXNA 4UEIA 2KSIA 3R1KA 4MY3A 2HV2A 2NBNA 5IV0A 3UY5A 2YHEA 3BN8A 3SXOA 3BDQA 2CFZA 4JGXA 4JD6A 1IKTA 4MY0A 4QB9A 3N7ZA 1PZ4A 4PDXA 2CFUA 2CX7A 5AIJA 4NURA 2CG3A 2QZTA 4AV7A 3CNUA 1QNDA 2NBMA 5AJLA 3BKRA 2KSHA 5A23A 1C44A 2CG2A 2I00A 3RYOA 1WFRA 4AXHA 2C0LB 5EBVA 3BKSA 5EC4A 2OZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXN A;  4UEI A;  2KSI A;  3R1K A;  4MY3 A;  2HV2 A;  2NBN A;  5IV0 A;  3UY5 A;  2YHE A;  3BN8 A;  3SXO A;  3BDQ A;  2CFZ A;  4JGX A;  4JD6 A;  1IKT A;  4MY0 A;  4QB9 A;  3N7Z A;  1PZ4 A;  4PDX A;  2CFU A;  2CX7 A;  5AIJ A;  4NUR A;  2CG3 A;  2QZT A;  4AV7 A;  3CNU A;  1QND A;  2NBM A;  5AJL A;  3BKR A;  2KSH A;  5A23 A;  1C44 A;  2CG2 A;  2I00 A;  3RYO A;  1WFR A;  4AXH A;  2C0L B;  5EBV A;  3BKS A;  5EC4 A;  2OZG A; 
#chains in the Genus database with same CATH topology
 3SXN A;  4UEI A;  2KSI A;  3R1K A;  4MY3 A;  3SSM A;  2HV2 A;  2NBN A;  4NSS A;  5IV0 A;  3UY5 A;  2YHE A;  3BN8 A;  3SXO A;  3BDQ A;  2CFZ A;  4JGX A;  4JD6 A;  1IKT A;  4MY0 A;  4QB9 A;  3N7Z A;  1PZ4 A;  4PDX A;  2CFU A;  2CX7 A;  5AIJ A;  4NUR A;  2CG3 A;  2QZT A;  4AV7 A;  4ZY7 A;  3CNU A;  1QND A;  2NBM A;  5AJL A;  3BKR A;  2KSH A;  5A23 A;  2NSG A;  1C44 A;  2CG2 A;  2I00 A;  3SSN A;  3SSO A;  3RYO A;  1WFR A;  4AXH A;  2NSF A;  2C0L B;  5EBV A;  3BKS A;  5EC4 A;  2OZG A; 
#chains in the Genus database with same CATH homology
 3SXN A;  4UEI A;  2KSI A;  3R1K A;  4MY3 A;  2HV2 A;  2NBN A;  5IV0 A;  3UY5 A;  2YHE A;  3BN8 A;  3SXO A;  3BDQ A;  2CFZ A;  4JGX A;  4JD6 A;  1IKT A;  4MY0 A;  4QB9 A;  3N7Z A;  1PZ4 A;  4PDX A;  2CFU A;  2CX7 A;  5AIJ A;  4NUR A;  2CG3 A;  2QZT A;  4AV7 A;  3CNU A;  1QND A;  2NBM A;  5AJL A;  3BKR A;  2KSH A;  5A23 A;  1C44 A;  2CG2 A;  2I00 A;  3RYO A;  1WFR A;  4AXH A;  2C0L B;  5EBV A;  3BKS A;  5EC4 A;  2OZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...