2QZTA

Crystal structure of sterol carrier protein 2 like 2 (scp2-l2) from aedes aegypti
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
GIRMSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure/function analysis of SCP-2-like2 reveals differences among SCP-2 family members.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2-like 2
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2qztA00
1QNDA 4NURA 3BDQA 3UY5A 2CFZA 5EC4A 2NBMA 4AV7A 5AJLA 2CX7A 1PZ4A 2KSHA 3CNUA 3SXNA 4MY0A 2C0LB 4AXHA 2CFUA 4JGXA 3RYOA 3R1KA 1C44A 3N7ZA 4MY3A 2CG2A 2YHEA 2CG3A 4JD6A 4QB9A 2NBNA 5A23A 2HV2A 2OZGA 4PDXA 5EBVA 3BKSA 3SXOA 5IV0A 2QZTA 4UEIA 5AIJA 1WFRA 2I00A 2KSIA 3BKRA 1IKTA 3BN8A
chains in the Genus database with same CATH superfamily
1QNDA 4NURA 3BDQA 3UY5A 2CFZA 2NSFA 2NBMA 5EC4A 4AV7A 5AJLA 2NSGA 2CX7A 1PZ4A 2KSHA 3CNUA 3SSMA 4MY0A 3SXNA 2C0LB 4ZY7A 4AXHA 2CFUA 4JGXA 3RYOA 3R1KA 1C44A 3N7ZA 4MY3A 2CG2A 3SSOA 2CG3A 2YHEA 4JD6A 4QB9A 2NBNA 5A23A 2HV2A 2OZGA 4PDXA 3SSNA 5EBVA 3BKSA 3SXOA 5IV0A 2QZTA 4UEIA 5AIJA 1WFRA 2I00A 2KSIA 3BKRA 4NSSA 1IKTA 3BN8A
chains in the Genus database with same CATH topology
1QNDA 4NURA 3BDQA 3UY5A 2CFZA 5EC4A 2NBMA 4AV7A 5AJLA 2CX7A 1PZ4A 2KSHA 3CNUA 3SXNA 4MY0A 2C0LB 4AXHA 2CFUA 4JGXA 3RYOA 3R1KA 1C44A 3N7ZA 4MY3A 2CG2A 2YHEA 2CG3A 4JD6A 4QB9A 2NBNA 5A23A 2HV2A 2OZGA 4PDXA 5EBVA 3BKSA 3SXOA 5IV0A 2QZTA 4UEIA 5AIJA 1WFRA 2I00A 2KSIA 3BKRA 1IKTA 3BN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QND A;  4NUR A;  3BDQ A;  3UY5 A;  2CFZ A;  5EC4 A;  2NBM A;  4AV7 A;  5AJL A;  2CX7 A;  1PZ4 A;  2KSH A;  3CNU A;  3SXN A;  4MY0 A;  2C0L B;  4AXH A;  2CFU A;  4JGX A;  3RYO A;  3R1K A;  1C44 A;  3N7Z A;  4MY3 A;  2CG2 A;  2YHE A;  2CG3 A;  4JD6 A;  4QB9 A;  2NBN A;  5A23 A;  2HV2 A;  2OZG A;  4PDX A;  5EBV A;  3BKS A;  3SXO A;  5IV0 A;  2QZT A;  4UEI A;  5AIJ A;  1WFR A;  2I00 A;  2KSI A;  3BKR A;  1IKT A;  3BN8 A; 
#chains in the Genus database with same CATH topology
 1QND A;  4NUR A;  3BDQ A;  3UY5 A;  2CFZ A;  2NSF A;  2NBM A;  5EC4 A;  4AV7 A;  5AJL A;  2NSG A;  2CX7 A;  1PZ4 A;  2KSH A;  3CNU A;  3SSM A;  4MY0 A;  3SXN A;  2C0L B;  4ZY7 A;  4AXH A;  2CFU A;  4JGX A;  3RYO A;  3R1K A;  1C44 A;  3N7Z A;  4MY3 A;  2CG2 A;  3SSO A;  2CG3 A;  2YHE A;  4JD6 A;  4QB9 A;  2NBN A;  5A23 A;  2HV2 A;  2OZG A;  4PDX A;  3SSN A;  5EBV A;  3BKS A;  3SXO A;  5IV0 A;  2QZT A;  4UEI A;  5AIJ A;  1WFR A;  2I00 A;  2KSI A;  3BKR A;  4NSS A;  1IKT A;  3BN8 A; 
#chains in the Genus database with same CATH homology
 1QND A;  4NUR A;  3BDQ A;  3UY5 A;  2CFZ A;  5EC4 A;  2NBM A;  4AV7 A;  5AJL A;  2CX7 A;  1PZ4 A;  2KSH A;  3CNU A;  3SXN A;  4MY0 A;  2C0L B;  4AXH A;  2CFU A;  4JGX A;  3RYO A;  3R1K A;  1C44 A;  3N7Z A;  4MY3 A;  2CG2 A;  2YHE A;  2CG3 A;  4JD6 A;  4QB9 A;  2NBN A;  5A23 A;  2HV2 A;  2OZG A;  4PDX A;  5EBV A;  3BKS A;  3SXO A;  5IV0 A;  2QZT A;  4UEI A;  5AIJ A;  1WFR A;  2I00 A;  2KSI A;  3BKR A;  1IKT A;  3BN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...