2QZTA

Crystal structure of sterol carrier protein 2 like 2 (scp2-l2) from aedes aegypti
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'GIRMSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2-like 2
publication title Three-dimensional structure/function analysis of SCP-2-like2 reveals differences among SCP-2 family members.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2qztA00
4JGXA 3BN8A 4AV7A 4PDXA 3R1KA 4QB9A 5IV0A 2CFZA 3UY5A 3N7ZA 4UEIA 2KSHA 2CG3A 2NBNA 1PZ4A 3SXNA 5A23A 3CNUA 2NBMA 4JD6A 1WFRA 2CG2A 2CFUA 2C0LB 3BDQA 3BKRA 2QZTA 2KSIA 4MY3A 3RYOA 2YHEA 2OZGA 5AJLA 1IKTA 4AXHA 2HV2A 3BKSA 4NURA 4MY0A 3SXOA 5AIJA 2I00A 1C44A 5EC4A 5EBVA 2CX7A 1QNDA
chains in the Genus database with same CATH superfamily
4JGXA 3BN8A 4AV7A 4PDXA 3R1KA 4QB9A 3SSOA 2CFZA 5IV0A 3UY5A 3N7ZA 4UEIA 2KSHA 2CG3A 2NBNA 1PZ4A 3SXNA 5A23A 3CNUA 2NBMA 4JD6A 1WFRA 2CG2A 2CFUA 2C0LB 3BDQA 3BKRA 2QZTA 4NSSA 2KSIA 4MY3A 3RYOA 2YHEA 2OZGA 5AJLA 2NSGA 1IKTA 4AXHA 2HV2A 3BKSA 4NURA 4ZY7A 4MY0A 3SXOA 5AIJA 2I00A 1C44A 2NSFA 5EC4A 2CX7A 5EBVA 3SSMA 1QNDA 3SSNA
chains in the Genus database with same CATH topology
4JGXA 3BN8A 4AV7A 4PDXA 3R1KA 4QB9A 5IV0A 2CFZA 3UY5A 3N7ZA 4UEIA 2KSHA 2CG3A 2NBNA 1PZ4A 3SXNA 5A23A 3CNUA 2NBMA 4JD6A 1WFRA 2CG2A 2CFUA 2C0LB 3BDQA 3BKRA 2QZTA 2KSIA 4MY3A 3RYOA 2YHEA 2OZGA 5AJLA 1IKTA 4AXHA 2HV2A 3BKSA 4NURA 4MY0A 3SXOA 5AIJA 2I00A 1C44A 5EC4A 5EBVA 2CX7A 1QNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGX A;  3BN8 A;  4AV7 A;  4PDX A;  3R1K A;  4QB9 A;  5IV0 A;  2CFZ A;  3UY5 A;  3N7Z A;  4UEI A;  2KSH A;  2CG3 A;  2NBN A;  1PZ4 A;  3SXN A;  5A23 A;  3CNU A;  2NBM A;  4JD6 A;  1WFR A;  2CG2 A;  2CFU A;  2C0L B;  3BDQ A;  3BKR A;  2QZT A;  2KSI A;  4MY3 A;  3RYO A;  2YHE A;  2OZG A;  5AJL A;  1IKT A;  4AXH A;  2HV2 A;  3BKS A;  4NUR A;  4MY0 A;  3SXO A;  5AIJ A;  2I00 A;  1C44 A;  5EC4 A;  5EBV A;  2CX7 A;  1QND A; 
#chains in the Genus database with same CATH topology
 4JGX A;  3BN8 A;  4AV7 A;  4PDX A;  3R1K A;  4QB9 A;  3SSO A;  2CFZ A;  5IV0 A;  3UY5 A;  3N7Z A;  4UEI A;  2KSH A;  2CG3 A;  2NBN A;  1PZ4 A;  3SXN A;  5A23 A;  3CNU A;  2NBM A;  4JD6 A;  1WFR A;  2CG2 A;  2CFU A;  2C0L B;  3BDQ A;  3BKR A;  2QZT A;  4NSS A;  2KSI A;  4MY3 A;  3RYO A;  2YHE A;  2OZG A;  5AJL A;  2NSG A;  1IKT A;  4AXH A;  2HV2 A;  3BKS A;  4NUR A;  4ZY7 A;  4MY0 A;  3SXO A;  5AIJ A;  2I00 A;  1C44 A;  2NSF A;  5EC4 A;  2CX7 A;  5EBV A;  3SSM A;  1QND A;  3SSN A; 
#chains in the Genus database with same CATH homology
 4JGX A;  3BN8 A;  4AV7 A;  4PDX A;  3R1K A;  4QB9 A;  5IV0 A;  2CFZ A;  3UY5 A;  3N7Z A;  4UEI A;  2KSH A;  2CG3 A;  2NBN A;  1PZ4 A;  3SXN A;  5A23 A;  3CNU A;  2NBM A;  4JD6 A;  1WFR A;  2CG2 A;  2CFU A;  2C0L B;  3BDQ A;  3BKR A;  2QZT A;  2KSI A;  4MY3 A;  3RYO A;  2YHE A;  2OZG A;  5AJL A;  1IKT A;  4AXH A;  2HV2 A;  3BKS A;  4NUR A;  4MY0 A;  3SXO A;  5AIJ A;  2I00 A;  1C44 A;  5EC4 A;  5EBV A;  2CX7 A;  1QND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...