3CNUA

Crystal structure of the predicted coding region af_1534 from archaeoglobus fulgidus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
MSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGEEFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the predicted coding region AF_1534 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Predicted coding region AF_1534
total genus 33
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3cnuA00
4JGXA 2KSHA 3SXOA 2C0LB 1WFRA 2CFUA 5A23A 5IV0A 3CNUA 4AXHA 5AIJA 2HV2A 4QB9A 4MY0A 4MY3A 2NBNA 1PZ4A 3BDQA 1C44A 5AJLA 2QZTA 3N7ZA 2CFZA 3UY5A 4AV7A 2CX7A 3BN8A 4JD6A 1IKTA 2KSIA 3BKSA 4PDXA 4NURA 5EC4A 2NBMA 2YHEA 5EBVA 3BKRA 3R1KA 2CG2A 3SXNA 3RYOA 4UEIA 2I00A 2CG3A 2OZGA 1QNDA
chains in the Genus database with same CATH superfamily
4JGXA 2KSHA 3SXOA 2C0LB 1WFRA 2CFUA 3SSNA 2NSFA 5A23A 3CNUA 5IV0A 4AXHA 5AIJA 2HV2A 4QB9A 4MY0A 4MY3A 2NBNA 1PZ4A 3BDQA 1C44A 5AJLA 2QZTA 3N7ZA 2CFZA 3UY5A 4AV7A 2NSGA 4ZY7A 2CX7A 3BN8A 4JD6A 1IKTA 2KSIA 3BKSA 4PDXA 4NURA 5EC4A 2NBMA 2YHEA 5EBVA 3BKRA 3SSMA 3R1KA 2CG2A 3SXNA 3RYOA 4NSSA 4UEIA 2I00A 3SSOA 2CG3A 2OZGA 1QNDA
chains in the Genus database with same CATH topology
4JGXA 2KSHA 3SXOA 2C0LB 1WFRA 2CFUA 5A23A 5IV0A 3CNUA 4AXHA 5AIJA 2HV2A 4QB9A 4MY0A 4MY3A 2NBNA 1PZ4A 3BDQA 1C44A 5AJLA 2QZTA 3N7ZA 2CFZA 3UY5A 4AV7A 2CX7A 3BN8A 4JD6A 1IKTA 2KSIA 3BKSA 4PDXA 4NURA 5EC4A 2NBMA 2YHEA 5EBVA 3BKRA 3R1KA 2CG2A 3SXNA 3RYOA 4UEIA 2I00A 2CG3A 2OZGA 1QNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGX A;  2KSH A;  3SXO A;  2C0L B;  1WFR A;  2CFU A;  5A23 A;  5IV0 A;  3CNU A;  4AXH A;  5AIJ A;  2HV2 A;  4QB9 A;  4MY0 A;  4MY3 A;  2NBN A;  1PZ4 A;  3BDQ A;  1C44 A;  5AJL A;  2QZT A;  3N7Z A;  2CFZ A;  3UY5 A;  4AV7 A;  2CX7 A;  3BN8 A;  4JD6 A;  1IKT A;  2KSI A;  3BKS A;  4PDX A;  4NUR A;  5EC4 A;  2NBM A;  2YHE A;  5EBV A;  3BKR A;  3R1K A;  2CG2 A;  3SXN A;  3RYO A;  4UEI A;  2I00 A;  2CG3 A;  2OZG A;  1QND A; 
#chains in the Genus database with same CATH topology
 4JGX A;  2KSH A;  3SXO A;  2C0L B;  1WFR A;  2CFU A;  3SSN A;  2NSF A;  5A23 A;  3CNU A;  5IV0 A;  4AXH A;  5AIJ A;  2HV2 A;  4QB9 A;  4MY0 A;  4MY3 A;  2NBN A;  1PZ4 A;  3BDQ A;  1C44 A;  5AJL A;  2QZT A;  3N7Z A;  2CFZ A;  3UY5 A;  4AV7 A;  2NSG A;  4ZY7 A;  2CX7 A;  3BN8 A;  4JD6 A;  1IKT A;  2KSI A;  3BKS A;  4PDX A;  4NUR A;  5EC4 A;  2NBM A;  2YHE A;  5EBV A;  3BKR A;  3SSM A;  3R1K A;  2CG2 A;  3SXN A;  3RYO A;  4NSS A;  4UEI A;  2I00 A;  3SSO A;  2CG3 A;  2OZG A;  1QND A; 
#chains in the Genus database with same CATH homology
 4JGX A;  2KSH A;  3SXO A;  2C0L B;  1WFR A;  2CFU A;  5A23 A;  5IV0 A;  3CNU A;  4AXH A;  5AIJ A;  2HV2 A;  4QB9 A;  4MY0 A;  4MY3 A;  2NBN A;  1PZ4 A;  3BDQ A;  1C44 A;  5AJL A;  2QZT A;  3N7Z A;  2CFZ A;  3UY5 A;  4AV7 A;  2CX7 A;  3BN8 A;  4JD6 A;  1IKT A;  2KSI A;  3BKS A;  4PDX A;  4NUR A;  5EC4 A;  2NBM A;  2YHE A;  5EBV A;  3BKR A;  3R1K A;  2CG2 A;  3SXN A;  3RYO A;  4UEI A;  2I00 A;  2CG3 A;  2OZG A;  1QND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...