3CNUA

Crystal structure of the predicted coding region af_1534 from archaeoglobus fulgidus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
MSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGEEFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the predicted coding region AF_1534 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Predicted coding region AF_1534
total genus 33
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3cnuA00
2KSHA 5AIJA 4UEIA 2C0LB 1QNDA 2NBMA 2CG2A 3UY5A 3BDQA 3R1KA 3N7ZA 3RYOA 4AV7A 5IV0A 4NURA 5AJLA 2KSIA 2YHEA 2HV2A 4AXHA 1WFRA 4JGXA 2CFUA 2CFZA 4MY3A 1IKTA 4PDXA 3SXNA 3BKSA 2OZGA 1PZ4A 2CX7A 4QB9A 3CNUA 2CG3A 3BN8A 2I00A 4MY0A 3SXOA 1C44A 2NBNA 5EC4A 2QZTA 3BKRA 5EBVA 5A23A 4JD6A
chains in the Genus database with same CATH superfamily
2KSHA 5AIJA 4UEIA 2C0LB 1QNDA 2NBMA 4NSSA 2CG2A 3UY5A 3BDQA 3R1KA 3N7ZA 3RYOA 4AV7A 5IV0A 2NSGA 4NURA 2KSIA 5AJLA 2YHEA 2HV2A 2NSFA 4AXHA 4ZY7A 3SSOA 1WFRA 4JGXA 2CFUA 2CFZA 4MY3A 1IKTA 4PDXA 3SXNA 3BKSA 2OZGA 1PZ4A 2CX7A 4QB9A 3CNUA 2CG3A 3BN8A 2I00A 3SSNA 3SSMA 4MY0A 3SXOA 1C44A 2NBNA 5EC4A 2QZTA 3BKRA 5EBVA 5A23A 4JD6A
chains in the Genus database with same CATH topology
2KSHA 5AIJA 4UEIA 2C0LB 1QNDA 2NBMA 2CG2A 3UY5A 3BDQA 3R1KA 3N7ZA 3RYOA 4AV7A 5IV0A 4NURA 5AJLA 2KSIA 2YHEA 2HV2A 4AXHA 1WFRA 4JGXA 2CFUA 2CFZA 4MY3A 1IKTA 4PDXA 3SXNA 3BKSA 2OZGA 1PZ4A 2CX7A 4QB9A 3CNUA 2CG3A 3BN8A 2I00A 4MY0A 3SXOA 1C44A 2NBNA 5EC4A 2QZTA 3BKRA 5EBVA 5A23A 4JD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSH A;  5AIJ A;  4UEI A;  2C0L B;  1QND A;  2NBM A;  2CG2 A;  3UY5 A;  3BDQ A;  3R1K A;  3N7Z A;  3RYO A;  4AV7 A;  5IV0 A;  4NUR A;  5AJL A;  2KSI A;  2YHE A;  2HV2 A;  4AXH A;  1WFR A;  4JGX A;  2CFU A;  2CFZ A;  4MY3 A;  1IKT A;  4PDX A;  3SXN A;  3BKS A;  2OZG A;  1PZ4 A;  2CX7 A;  4QB9 A;  3CNU A;  2CG3 A;  3BN8 A;  2I00 A;  4MY0 A;  3SXO A;  1C44 A;  2NBN A;  5EC4 A;  2QZT A;  3BKR A;  5EBV A;  5A23 A;  4JD6 A; 
#chains in the Genus database with same CATH topology
 2KSH A;  5AIJ A;  4UEI A;  2C0L B;  1QND A;  2NBM A;  4NSS A;  2CG2 A;  3UY5 A;  3BDQ A;  3R1K A;  3N7Z A;  3RYO A;  4AV7 A;  5IV0 A;  2NSG A;  4NUR A;  2KSI A;  5AJL A;  2YHE A;  2HV2 A;  2NSF A;  4AXH A;  4ZY7 A;  3SSO A;  1WFR A;  4JGX A;  2CFU A;  2CFZ A;  4MY3 A;  1IKT A;  4PDX A;  3SXN A;  3BKS A;  2OZG A;  1PZ4 A;  2CX7 A;  4QB9 A;  3CNU A;  2CG3 A;  3BN8 A;  2I00 A;  3SSN A;  3SSM A;  4MY0 A;  3SXO A;  1C44 A;  2NBN A;  5EC4 A;  2QZT A;  3BKR A;  5EBV A;  5A23 A;  4JD6 A; 
#chains in the Genus database with same CATH homology
 2KSH A;  5AIJ A;  4UEI A;  2C0L B;  1QND A;  2NBM A;  2CG2 A;  3UY5 A;  3BDQ A;  3R1K A;  3N7Z A;  3RYO A;  4AV7 A;  5IV0 A;  4NUR A;  5AJL A;  2KSI A;  2YHE A;  2HV2 A;  4AXH A;  1WFR A;  4JGX A;  2CFU A;  2CFZ A;  4MY3 A;  1IKT A;  4PDX A;  3SXN A;  3BKS A;  2OZG A;  1PZ4 A;  2CX7 A;  4QB9 A;  3CNU A;  2CG3 A;  3BN8 A;  2I00 A;  4MY0 A;  3SXO A;  1C44 A;  2NBN A;  5EC4 A;  2QZT A;  3BKR A;  5EBV A;  5A23 A;  4JD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...