3CNUA

Crystal structure of the predicted coding region af_1534 from archaeoglobus fulgidus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
110
structure length
110
Chain Sequence
MSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGEEFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted coding region AF_1534
publication title The crystal structure of the predicted coding region AF_1534 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 33
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3cnuA00
1IKTA 2CX7A 1QNDA 5AIJA 3BKRA 2QZTA 3BN8A 3SXNA 5EBVA 2I00A 4AV7A 2KSIA 4JD6A 2KSHA 5A23A 5EC4A 5AJLA 4UEIA 4AXHA 1PZ4A 5IV0A 3BKSA 4NURA 2CG2A 4PDXA 2NBNA 3RYOA 4JGXA 2NBMA 4MY3A 3R1KA 4MY0A 3N7ZA 2OZGA 2HV2A 3UY5A 4QB9A 2C0LB 2CFZA 3CNUA 3BDQA 1C44A 2CG3A 1WFRA 2YHEA 3SXOA 2CFUA
chains in the Genus database with same CATH superfamily
1IKTA 2CX7A 1QNDA 5AIJA 3BKRA 2QZTA 3BN8A 3SXNA 5EBVA 2I00A 4AV7A 2KSIA 4JD6A 2KSHA 5A23A 5EC4A 5AJLA 2NSFA 4UEIA 3SSMA 3SSOA 4AXHA 1PZ4A 4NSSA 5IV0A 3BKSA 4NURA 2CG2A 4PDXA 2NBNA 3RYOA 4JGXA 2NBMA 4MY3A 3R1KA 4MY0A 3N7ZA 2OZGA 2HV2A 3SSNA 3UY5A 4QB9A 2C0LB 4ZY7A 2CFZA 3CNUA 3BDQA 2NSGA 1C44A 2CG3A 1WFRA 2YHEA 3SXOA 2CFUA
chains in the Genus database with same CATH topology
1IKTA 2CX7A 1QNDA 5AIJA 3BKRA 2QZTA 3BN8A 3SXNA 5EBVA 2I00A 4AV7A 2KSIA 4JD6A 2KSHA 5A23A 5EC4A 5AJLA 4UEIA 4AXHA 1PZ4A 5IV0A 3BKSA 4NURA 2CG2A 4PDXA 2NBNA 3RYOA 4JGXA 2NBMA 4MY3A 3R1KA 4MY0A 3N7ZA 2OZGA 2HV2A 3UY5A 4QB9A 2C0LB 2CFZA 3CNUA 3BDQA 1C44A 2CG3A 1WFRA 2YHEA 3SXOA 2CFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKT A;  2CX7 A;  1QND A;  5AIJ A;  3BKR A;  2QZT A;  3BN8 A;  3SXN A;  5EBV A;  2I00 A;  4AV7 A;  2KSI A;  4JD6 A;  2KSH A;  5A23 A;  5EC4 A;  5AJL A;  4UEI A;  4AXH A;  1PZ4 A;  5IV0 A;  3BKS A;  4NUR A;  2CG2 A;  4PDX A;  2NBN A;  3RYO A;  4JGX A;  2NBM A;  4MY3 A;  3R1K A;  4MY0 A;  3N7Z A;  2OZG A;  2HV2 A;  3UY5 A;  4QB9 A;  2C0L B;  2CFZ A;  3CNU A;  3BDQ A;  1C44 A;  2CG3 A;  1WFR A;  2YHE A;  3SXO A;  2CFU A; 
#chains in the Genus database with same CATH topology
 1IKT A;  2CX7 A;  1QND A;  5AIJ A;  3BKR A;  2QZT A;  3BN8 A;  3SXN A;  5EBV A;  2I00 A;  4AV7 A;  2KSI A;  4JD6 A;  2KSH A;  5A23 A;  5EC4 A;  5AJL A;  2NSF A;  4UEI A;  3SSM A;  3SSO A;  4AXH A;  1PZ4 A;  4NSS A;  5IV0 A;  3BKS A;  4NUR A;  2CG2 A;  4PDX A;  2NBN A;  3RYO A;  4JGX A;  2NBM A;  4MY3 A;  3R1K A;  4MY0 A;  3N7Z A;  2OZG A;  2HV2 A;  3SSN A;  3UY5 A;  4QB9 A;  2C0L B;  4ZY7 A;  2CFZ A;  3CNU A;  3BDQ A;  2NSG A;  1C44 A;  2CG3 A;  1WFR A;  2YHE A;  3SXO A;  2CFU A; 
#chains in the Genus database with same CATH homology
 1IKT A;  2CX7 A;  1QND A;  5AIJ A;  3BKR A;  2QZT A;  3BN8 A;  3SXN A;  5EBV A;  2I00 A;  4AV7 A;  2KSI A;  4JD6 A;  2KSH A;  5A23 A;  5EC4 A;  5AJL A;  4UEI A;  4AXH A;  1PZ4 A;  5IV0 A;  3BKS A;  4NUR A;  2CG2 A;  4PDX A;  2NBN A;  3RYO A;  4JGX A;  2NBM A;  4MY3 A;  3R1K A;  4MY0 A;  3N7Z A;  2OZG A;  2HV2 A;  3UY5 A;  4QB9 A;  2C0L B;  2CFZ A;  3CNU A;  3BDQ A;  1C44 A;  2CG3 A;  1WFR A;  2YHE A;  3SXO A;  2CFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...