2CX7A

Crystal structure of sterol carrier protein 2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
ELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of sterol carrier protein 2
rcsb
source organism Thermus thermophilus
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2
total genus 38
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2cx7A00
4NURA 2I00A 2QZTA 3R1KA 5AJLA 2CG3A 3SXNA 2CG2A 1PZ4A 3CNUA 4AXHA 2C0LB 4QB9A 2OZGA 4MY3A 3BDQA 4JD6A 3N7ZA 4AV7A 2YHEA 5AIJA 5IV0A 4JGXA 3RYOA 2KSIA 3BN8A 3BKSA 3UY5A 1IKTA 2HV2A 2KSHA 3BKRA 5EC4A 5A23A 4UEIA 5EBVA 2CX7A 4PDXA 1C44A 4MY0A 2NBNA 2CFUA 1WFRA 2NBMA 3SXOA 2CFZA 1QNDA
chains in the Genus database with same CATH superfamily
4NURA 2I00A 2QZTA 3R1KA 5AJLA 2CG3A 3SXNA 2CG2A 1PZ4A 3CNUA 4AXHA 2C0LB 4QB9A 2OZGA 4MY3A 3BDQA 4JD6A 3N7ZA 4NSSA 2YHEA 4AV7A 5AIJA 5IV0A 3SSNA 4JGXA 4ZY7A 3RYOA 2KSIA 3BN8A 3SSMA 3BKSA 3UY5A 1IKTA 2HV2A 2KSHA 3BKRA 5EC4A 5A23A 4UEIA 5EBVA 2CX7A 4PDXA 1C44A 4MY0A 2NSFA 2NBNA 2NSGA 2CFUA 3SSOA 1WFRA 2NBMA 3SXOA 2CFZA 1QNDA
chains in the Genus database with same CATH topology
4NURA 2I00A 2QZTA 3R1KA 5AJLA 2CG3A 3SXNA 2CG2A 1PZ4A 3CNUA 4AXHA 2C0LB 4QB9A 2OZGA 4MY3A 3BDQA 4JD6A 3N7ZA 4AV7A 2YHEA 5AIJA 5IV0A 4JGXA 3RYOA 2KSIA 3BN8A 3BKSA 3UY5A 1IKTA 2HV2A 2KSHA 3BKRA 5EC4A 5A23A 4UEIA 5EBVA 2CX7A 4PDXA 1C44A 4MY0A 2NBNA 2CFUA 1WFRA 2NBMA 3SXOA 2CFZA 1QNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUR A;  2I00 A;  2QZT A;  3R1K A;  5AJL A;  2CG3 A;  3SXN A;  2CG2 A;  1PZ4 A;  3CNU A;  4AXH A;  2C0L B;  4QB9 A;  2OZG A;  4MY3 A;  3BDQ A;  4JD6 A;  3N7Z A;  4AV7 A;  2YHE A;  5AIJ A;  5IV0 A;  4JGX A;  3RYO A;  2KSI A;  3BN8 A;  3BKS A;  3UY5 A;  1IKT A;  2HV2 A;  2KSH A;  3BKR A;  5EC4 A;  5A23 A;  4UEI A;  5EBV A;  2CX7 A;  4PDX A;  1C44 A;  4MY0 A;  2NBN A;  2CFU A;  1WFR A;  2NBM A;  3SXO A;  2CFZ A;  1QND A; 
#chains in the Genus database with same CATH topology
 4NUR A;  2I00 A;  2QZT A;  3R1K A;  5AJL A;  2CG3 A;  3SXN A;  2CG2 A;  1PZ4 A;  3CNU A;  4AXH A;  2C0L B;  4QB9 A;  2OZG A;  4MY3 A;  3BDQ A;  4JD6 A;  3N7Z A;  4NSS A;  2YHE A;  4AV7 A;  5AIJ A;  5IV0 A;  3SSN A;  4JGX A;  4ZY7 A;  3RYO A;  2KSI A;  3BN8 A;  3SSM A;  3BKS A;  3UY5 A;  1IKT A;  2HV2 A;  2KSH A;  3BKR A;  5EC4 A;  5A23 A;  4UEI A;  5EBV A;  2CX7 A;  4PDX A;  1C44 A;  4MY0 A;  2NSF A;  2NBN A;  2NSG A;  2CFU A;  3SSO A;  1WFR A;  2NBM A;  3SXO A;  2CFZ A;  1QND A; 
#chains in the Genus database with same CATH homology
 4NUR A;  2I00 A;  2QZT A;  3R1K A;  5AJL A;  2CG3 A;  3SXN A;  2CG2 A;  1PZ4 A;  3CNU A;  4AXH A;  2C0L B;  4QB9 A;  2OZG A;  4MY3 A;  3BDQ A;  4JD6 A;  3N7Z A;  4AV7 A;  2YHE A;  5AIJ A;  5IV0 A;  4JGX A;  3RYO A;  2KSI A;  3BN8 A;  3BKS A;  3UY5 A;  1IKT A;  2HV2 A;  2KSH A;  3BKR A;  5EC4 A;  5A23 A;  4UEI A;  5EBV A;  2CX7 A;  4PDX A;  1C44 A;  4MY0 A;  2NBN A;  2CFU A;  1WFR A;  2NBM A;  3SXO A;  2CFZ A;  1QND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...