2CX7A

Crystal structure of sterol carrier protein 2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
ELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of sterol carrier protein 2
rcsb
source organism Thermus thermophilus
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2
total genus 38
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2cx7A00
5EBVA 4JD6A 5EC4A 3RYOA 5A23A 2KSHA 2I00A 4UEIA 3CNUA 2OZGA 4MY0A 2CX7A 3BDQA 2CG2A 1WFRA 3BN8A 2CFUA 5IV0A 1QNDA 2CG3A 1C44A 2HV2A 3BKRA 1IKTA 3SXOA 2NBNA 4AV7A 2YHEA 2C0LB 2CFZA 4JGXA 5AJLA 2NBMA 3N7ZA 5AIJA 3SXNA 4AXHA 1PZ4A 4MY3A 4NURA 3UY5A 2KSIA 4PDXA 3R1KA 2QZTA 4QB9A 3BKSA
chains in the Genus database with same CATH superfamily
5EBVA 4JD6A 5EC4A 3RYOA 5A23A 2KSHA 2I00A 4UEIA 3CNUA 2OZGA 4MY0A 2CX7A 2NSFA 3BDQA 2CG2A 1WFRA 3BN8A 2CFUA 5IV0A 2NSGA 1QNDA 2CG3A 4ZY7A 1C44A 2HV2A 3BKRA 3SSNA 1IKTA 3SXOA 2NBNA 4AV7A 2YHEA 2C0LB 2CFZA 4JGXA 5AJLA 2NBMA 3SSMA 3N7ZA 4NSSA 5AIJA 3SXNA 4AXHA 3SSOA 1PZ4A 4MY3A 4NURA 3UY5A 2KSIA 4PDXA 3R1KA 2QZTA 4QB9A 3BKSA
chains in the Genus database with same CATH topology
5EBVA 4JD6A 5EC4A 3RYOA 5A23A 2KSHA 2I00A 4UEIA 3CNUA 2OZGA 4MY0A 2CX7A 3BDQA 2CG2A 1WFRA 3BN8A 2CFUA 5IV0A 1QNDA 2CG3A 1C44A 2HV2A 3BKRA 1IKTA 3SXOA 2NBNA 4AV7A 2YHEA 2C0LB 2CFZA 4JGXA 5AJLA 2NBMA 3N7ZA 5AIJA 3SXNA 4AXHA 1PZ4A 4MY3A 4NURA 3UY5A 2KSIA 4PDXA 3R1KA 2QZTA 4QB9A 3BKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBV A;  4JD6 A;  5EC4 A;  3RYO A;  5A23 A;  2KSH A;  2I00 A;  4UEI A;  3CNU A;  2OZG A;  4MY0 A;  2CX7 A;  3BDQ A;  2CG2 A;  1WFR A;  3BN8 A;  2CFU A;  5IV0 A;  1QND A;  2CG3 A;  1C44 A;  2HV2 A;  3BKR A;  1IKT A;  3SXO A;  2NBN A;  4AV7 A;  2YHE A;  2C0L B;  2CFZ A;  4JGX A;  5AJL A;  2NBM A;  3N7Z A;  5AIJ A;  3SXN A;  4AXH A;  1PZ4 A;  4MY3 A;  4NUR A;  3UY5 A;  2KSI A;  4PDX A;  3R1K A;  2QZT A;  4QB9 A;  3BKS A; 
#chains in the Genus database with same CATH topology
 5EBV A;  4JD6 A;  5EC4 A;  3RYO A;  5A23 A;  2KSH A;  2I00 A;  4UEI A;  3CNU A;  2OZG A;  4MY0 A;  2CX7 A;  2NSF A;  3BDQ A;  2CG2 A;  1WFR A;  3BN8 A;  2CFU A;  5IV0 A;  2NSG A;  1QND A;  2CG3 A;  4ZY7 A;  1C44 A;  2HV2 A;  3BKR A;  3SSN A;  1IKT A;  3SXO A;  2NBN A;  4AV7 A;  2YHE A;  2C0L B;  2CFZ A;  4JGX A;  5AJL A;  2NBM A;  3SSM A;  3N7Z A;  4NSS A;  5AIJ A;  3SXN A;  4AXH A;  3SSO A;  1PZ4 A;  4MY3 A;  4NUR A;  3UY5 A;  2KSI A;  4PDX A;  3R1K A;  2QZT A;  4QB9 A;  3BKS A; 
#chains in the Genus database with same CATH homology
 5EBV A;  4JD6 A;  5EC4 A;  3RYO A;  5A23 A;  2KSH A;  2I00 A;  4UEI A;  3CNU A;  2OZG A;  4MY0 A;  2CX7 A;  3BDQ A;  2CG2 A;  1WFR A;  3BN8 A;  2CFU A;  5IV0 A;  1QND A;  2CG3 A;  1C44 A;  2HV2 A;  3BKR A;  1IKT A;  3SXO A;  2NBN A;  4AV7 A;  2YHE A;  2C0L B;  2CFZ A;  4JGX A;  5AJL A;  2NBM A;  3N7Z A;  5AIJ A;  3SXN A;  4AXH A;  1PZ4 A;  4MY3 A;  4NUR A;  3UY5 A;  2KSI A;  4PDX A;  3R1K A;  2QZT A;  4QB9 A;  3BKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...