2CX7A

Crystal structure of sterol carrier protein 2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
b'ELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2
publication title Crystal structure of sterol carrier protein 2
rcsb
source organism Thermus thermophilus
molecule tags Lipid transport
total genus 38
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2cx7A00
3UY5A 3BKSA 4MY3A 2CX7A 2QZTA 3R1KA 4NURA 4MY0A 3CNUA 2CG3A 5AIJA 3BN8A 2I00A 2OZGA 5EBVA 2CFZA 2HV2A 5EC4A 5AJLA 1WFRA 2KSHA 3RYOA 2KSIA 2YHEA 1C44A 1IKTA 4JD6A 4QB9A 3BDQA 5IV0A 2NBMA 2NBNA 5A23A 1PZ4A 1QNDA 2C0LB 3N7ZA 3SXOA 3BKRA 4PDXA 4UEIA 3SXNA 4AXHA 4JGXA 4AV7A 2CG2A 2CFUA
chains in the Genus database with same CATH superfamily
3UY5A 3BKSA 4MY3A 2CX7A 2QZTA 3R1KA 4NURA 4MY0A 3CNUA 3SSOA 3SSNA 2CG3A 5AIJA 3BN8A 2I00A 2OZGA 5EBVA 2CFZA 2HV2A 5EC4A 5AJLA 1WFRA 2KSHA 3RYOA 2KSIA 2YHEA 4NSSA 1C44A 1IKTA 2NSGA 4JD6A 4QB9A 3BDQA 5IV0A 2NBMA 2NBNA 5A23A 1PZ4A 1QNDA 2C0LB 3N7ZA 3SXOA 3BKRA 4PDXA 4UEIA 3SXNA 4AXHA 2NSFA 4JGXA 4AV7A 3SSMA 2CG2A 2CFUA 4ZY7A
chains in the Genus database with same CATH topology
3UY5A 3BKSA 4MY3A 2CX7A 2QZTA 3R1KA 4NURA 4MY0A 3CNUA 2CG3A 5AIJA 3BN8A 2I00A 2OZGA 5EBVA 2CFZA 2HV2A 5EC4A 5AJLA 1WFRA 2KSHA 3RYOA 2KSIA 2YHEA 1C44A 1IKTA 4JD6A 4QB9A 3BDQA 5IV0A 2NBMA 2NBNA 5A23A 1PZ4A 1QNDA 2C0LB 3N7ZA 3SXOA 3BKRA 4PDXA 4UEIA 3SXNA 4AXHA 4JGXA 4AV7A 2CG2A 2CFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UY5 A;  3BKS A;  4MY3 A;  2CX7 A;  2QZT A;  3R1K A;  4NUR A;  4MY0 A;  3CNU A;  2CG3 A;  5AIJ A;  3BN8 A;  2I00 A;  2OZG A;  5EBV A;  2CFZ A;  2HV2 A;  5EC4 A;  5AJL A;  1WFR A;  2KSH A;  3RYO A;  2KSI A;  2YHE A;  1C44 A;  1IKT A;  4JD6 A;  4QB9 A;  3BDQ A;  5IV0 A;  2NBM A;  2NBN A;  5A23 A;  1PZ4 A;  1QND A;  2C0L B;  3N7Z A;  3SXO A;  3BKR A;  4PDX A;  4UEI A;  3SXN A;  4AXH A;  4JGX A;  4AV7 A;  2CG2 A;  2CFU A; 
#chains in the Genus database with same CATH topology
 3UY5 A;  3BKS A;  4MY3 A;  2CX7 A;  2QZT A;  3R1K A;  4NUR A;  4MY0 A;  3CNU A;  3SSO A;  3SSN A;  2CG3 A;  5AIJ A;  3BN8 A;  2I00 A;  2OZG A;  5EBV A;  2CFZ A;  2HV2 A;  5EC4 A;  5AJL A;  1WFR A;  2KSH A;  3RYO A;  2KSI A;  2YHE A;  4NSS A;  1C44 A;  1IKT A;  2NSG A;  4JD6 A;  4QB9 A;  3BDQ A;  5IV0 A;  2NBM A;  2NBN A;  5A23 A;  1PZ4 A;  1QND A;  2C0L B;  3N7Z A;  3SXO A;  3BKR A;  4PDX A;  4UEI A;  3SXN A;  4AXH A;  2NSF A;  4JGX A;  4AV7 A;  3SSM A;  2CG2 A;  2CFU A;  4ZY7 A; 
#chains in the Genus database with same CATH homology
 3UY5 A;  3BKS A;  4MY3 A;  2CX7 A;  2QZT A;  3R1K A;  4NUR A;  4MY0 A;  3CNU A;  2CG3 A;  5AIJ A;  3BN8 A;  2I00 A;  2OZG A;  5EBV A;  2CFZ A;  2HV2 A;  5EC4 A;  5AJL A;  1WFR A;  2KSH A;  3RYO A;  2KSI A;  2YHE A;  1C44 A;  1IKT A;  4JD6 A;  4QB9 A;  3BDQ A;  5IV0 A;  2NBM A;  2NBN A;  5A23 A;  1PZ4 A;  1QND A;  2C0L B;  3N7Z A;  3SXO A;  3BKR A;  4PDX A;  4UEI A;  3SXN A;  4AXH A;  4JGX A;  4AV7 A;  2CG2 A;  2CFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...