4JGXA

The structure of sterol carrier protein 2 from the yeast yarrowia lipolytica
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
SLKVDGFTSSIIFDVIRDGLNDPSQAKQKAESIKKANAIIVFNLKNKAGKTESWYLDLKNDGDVGKGNKSPKGDADIQLTLSDDHFQQLVEGKANAQRLFMTGKLKVKGNVMKAAAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of sterol carrier protein 2 from Yarrowia lipolytica and the evolutionary conservation of a large, non-specific lipid-binding cavity.
pubmed doi rcsb
source organism Yarrowia lipolytica
molecule tags Lipid binding protein
molecule keywords Fatty acid-binding protein
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 4jgxA00
3R1KA 2NBNA 2CG3A 2I00A 2NBMA 5A23A 5IV0A 5AJLA 2CX7A 2HV2A 3BKSA 3SXNA 2CG2A 4JGXA 3BN8A 5AIJA 2C0LB 2OZGA 3BKRA 1QNDA 4PDXA 3RYOA 1IKTA 3SXOA 1C44A 2CFZA 3N7ZA 3BDQA 4NURA 2KSHA 4JD6A 3CNUA 5EC4A 2CFUA 2QZTA 5EBVA 4AXHA 4MY3A 4QB9A 4UEIA 1WFRA 4MY0A 2YHEA 3UY5A 4AV7A 2KSIA 1PZ4A
chains in the Genus database with same CATH superfamily
3R1KA 3SSMA 2NBNA 2CG3A 2I00A 2NBMA 5A23A 5IV0A 5AJLA 2CX7A 2HV2A 3BKSA 3SXNA 2CG2A 4JGXA 3BN8A 3SSOA 5AIJA 2C0LB 2OZGA 4ZY7A 3BKRA 1QNDA 4PDXA 3RYOA 1IKTA 3SXOA 1C44A 2CFZA 3N7ZA 3BDQA 4NURA 2KSHA 2NSGA 4JD6A 3CNUA 5EC4A 3SSNA 2CFUA 2QZTA 4NSSA 5EBVA 4AXHA 4MY3A 4QB9A 4UEIA 1WFRA 2NSFA 4MY0A 2YHEA 3UY5A 4AV7A 2KSIA 1PZ4A
chains in the Genus database with same CATH topology
3R1KA 2NBNA 2CG3A 2I00A 2NBMA 5A23A 5IV0A 5AJLA 2CX7A 2HV2A 3BKSA 3SXNA 2CG2A 4JGXA 3BN8A 5AIJA 2C0LB 2OZGA 3BKRA 1QNDA 4PDXA 3RYOA 1IKTA 3SXOA 1C44A 2CFZA 3N7ZA 3BDQA 4NURA 2KSHA 4JD6A 3CNUA 5EC4A 2CFUA 2QZTA 5EBVA 4AXHA 4MY3A 4QB9A 4UEIA 1WFRA 4MY0A 2YHEA 3UY5A 4AV7A 2KSIA 1PZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1K A;  2NBN A;  2CG3 A;  2I00 A;  2NBM A;  5A23 A;  5IV0 A;  5AJL A;  2CX7 A;  2HV2 A;  3BKS A;  3SXN A;  2CG2 A;  4JGX A;  3BN8 A;  5AIJ A;  2C0L B;  2OZG A;  3BKR A;  1QND A;  4PDX A;  3RYO A;  1IKT A;  3SXO A;  1C44 A;  2CFZ A;  3N7Z A;  3BDQ A;  4NUR A;  2KSH A;  4JD6 A;  3CNU A;  5EC4 A;  2CFU A;  2QZT A;  5EBV A;  4AXH A;  4MY3 A;  4QB9 A;  4UEI A;  1WFR A;  4MY0 A;  2YHE A;  3UY5 A;  4AV7 A;  2KSI A;  1PZ4 A; 
#chains in the Genus database with same CATH topology
 3R1K A;  3SSM A;  2NBN A;  2CG3 A;  2I00 A;  2NBM A;  5A23 A;  5IV0 A;  5AJL A;  2CX7 A;  2HV2 A;  3BKS A;  3SXN A;  2CG2 A;  4JGX A;  3BN8 A;  3SSO A;  5AIJ A;  2C0L B;  2OZG A;  4ZY7 A;  3BKR A;  1QND A;  4PDX A;  3RYO A;  1IKT A;  3SXO A;  1C44 A;  2CFZ A;  3N7Z A;  3BDQ A;  4NUR A;  2KSH A;  2NSG A;  4JD6 A;  3CNU A;  5EC4 A;  3SSN A;  2CFU A;  2QZT A;  4NSS A;  5EBV A;  4AXH A;  4MY3 A;  4QB9 A;  4UEI A;  1WFR A;  2NSF A;  4MY0 A;  2YHE A;  3UY5 A;  4AV7 A;  2KSI A;  1PZ4 A; 
#chains in the Genus database with same CATH homology
 3R1K A;  2NBN A;  2CG3 A;  2I00 A;  2NBM A;  5A23 A;  5IV0 A;  5AJL A;  2CX7 A;  2HV2 A;  3BKS A;  3SXN A;  2CG2 A;  4JGX A;  3BN8 A;  5AIJ A;  2C0L B;  2OZG A;  3BKR A;  1QND A;  4PDX A;  3RYO A;  1IKT A;  3SXO A;  1C44 A;  2CFZ A;  3N7Z A;  3BDQ A;  4NUR A;  2KSH A;  4JD6 A;  3CNU A;  5EC4 A;  2CFU A;  2QZT A;  5EBV A;  4AXH A;  4MY3 A;  4QB9 A;  4UEI A;  1WFR A;  4MY0 A;  2YHE A;  3UY5 A;  4AV7 A;  2KSI A;  1PZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...