2NBMA

Solution nmr structure of ligand free sterol carrier protein 2 like 2 from aedes aegypti
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
MSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVIHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2-like 2
publication title Solution Nuclear Magnetic Resonance Studies of Sterol Carrier Protein 2 Like 2 (SCP2L2) Reveal the Insecticide Specific Structural Characteristics of SCP2 Proteins in Aedes aegypti Mosquitoes
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
total genus 24
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2nbmA00
1PZ4A 5A23A 2CFZA 2YHEA 4MY0A 4UEIA 1C44A 5AIJA 5AJLA 1WFRA 3CNUA 4QB9A 2I00A 2NBMA 2OZGA 4AV7A 2KSHA 4NURA 1IKTA 4JGXA 2CFUA 3BDQA 2KSIA 2C0LB 1QNDA 5EBVA 2HV2A 3BN8A 3SXOA 3BKSA 4PDXA 4AXHA 3SXNA 3R1KA 5IV0A 2CG3A 3BKRA 2CG2A 3UY5A 4JD6A 2CX7A 2NBNA 4MY3A 2QZTA 3RYOA 5EC4A 3N7ZA
chains in the Genus database with same CATH superfamily
1PZ4A 5A23A 2CFZA 2YHEA 4MY0A 4UEIA 1C44A 5AIJA 5AJLA 1WFRA 3CNUA 4QB9A 2I00A 4NSSA 2NSFA 2NBMA 2OZGA 3SSMA 4AV7A 2KSHA 4NURA 1IKTA 4JGXA 2CFUA 3BDQA 3SSNA 2KSIA 3SSOA 2C0LB 1QNDA 5EBVA 4ZY7A 2HV2A 3BN8A 3SXOA 3BKSA 4PDXA 4AXHA 3SXNA 2NSGA 3R1KA 5IV0A 2CG3A 3BKRA 2CG2A 3UY5A 4JD6A 2CX7A 2NBNA 4MY3A 2QZTA 3RYOA 5EC4A 3N7ZA
chains in the Genus database with same CATH topology
1PZ4A 5A23A 2CFZA 2YHEA 4MY0A 4UEIA 1C44A 5AIJA 5AJLA 1WFRA 3CNUA 4QB9A 2I00A 2NBMA 2OZGA 4AV7A 2KSHA 4NURA 1IKTA 4JGXA 2CFUA 3BDQA 2KSIA 2C0LB 1QNDA 5EBVA 2HV2A 3BN8A 3SXOA 3BKSA 4PDXA 4AXHA 3SXNA 3R1KA 5IV0A 2CG3A 3BKRA 2CG2A 3UY5A 4JD6A 2CX7A 2NBNA 4MY3A 2QZTA 3RYOA 5EC4A 3N7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZ4 A;  5A23 A;  2CFZ A;  2YHE A;  4MY0 A;  4UEI A;  1C44 A;  5AIJ A;  5AJL A;  1WFR A;  3CNU A;  4QB9 A;  2I00 A;  2NBM A;  2OZG A;  4AV7 A;  2KSH A;  4NUR A;  1IKT A;  4JGX A;  2CFU A;  3BDQ A;  2KSI A;  2C0L B;  1QND A;  5EBV A;  2HV2 A;  3BN8 A;  3SXO A;  3BKS A;  4PDX A;  4AXH A;  3SXN A;  3R1K A;  5IV0 A;  2CG3 A;  3BKR A;  2CG2 A;  3UY5 A;  4JD6 A;  2CX7 A;  2NBN A;  4MY3 A;  2QZT A;  3RYO A;  5EC4 A;  3N7Z A; 
#chains in the Genus database with same CATH topology
 1PZ4 A;  5A23 A;  2CFZ A;  2YHE A;  4MY0 A;  4UEI A;  1C44 A;  5AIJ A;  5AJL A;  1WFR A;  3CNU A;  4QB9 A;  2I00 A;  4NSS A;  2NSF A;  2NBM A;  2OZG A;  3SSM A;  4AV7 A;  2KSH A;  4NUR A;  1IKT A;  4JGX A;  2CFU A;  3BDQ A;  3SSN A;  2KSI A;  3SSO A;  2C0L B;  1QND A;  5EBV A;  4ZY7 A;  2HV2 A;  3BN8 A;  3SXO A;  3BKS A;  4PDX A;  4AXH A;  3SXN A;  2NSG A;  3R1K A;  5IV0 A;  2CG3 A;  3BKR A;  2CG2 A;  3UY5 A;  4JD6 A;  2CX7 A;  2NBN A;  4MY3 A;  2QZT A;  3RYO A;  5EC4 A;  3N7Z A; 
#chains in the Genus database with same CATH homology
 1PZ4 A;  5A23 A;  2CFZ A;  2YHE A;  4MY0 A;  4UEI A;  1C44 A;  5AIJ A;  5AJL A;  1WFR A;  3CNU A;  4QB9 A;  2I00 A;  2NBM A;  2OZG A;  4AV7 A;  2KSH A;  4NUR A;  1IKT A;  4JGX A;  2CFU A;  3BDQ A;  2KSI A;  2C0L B;  1QND A;  5EBV A;  2HV2 A;  3BN8 A;  3SXO A;  3BKS A;  4PDX A;  4AXH A;  3SXN A;  3R1K A;  5IV0 A;  2CG3 A;  3BKR A;  2CG2 A;  3UY5 A;  4JD6 A;  2CX7 A;  2NBN A;  4MY3 A;  2QZT A;  3RYO A;  5EC4 A;  3N7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...