2NBMA

Solution nmr structure of ligand free sterol carrier protein 2 like 2 from aedes aegypti
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
MSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVIHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Nuclear Magnetic Resonance Studies of Sterol Carrier Protein 2 Like 2 (SCP2L2) Reveal the Insecticide Specific Structural Characteristics of SCP2 Proteins in Aedes aegypti Mosquitoes
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2-like 2
total genus 24
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2nbmA00
2HV2A 3RYOA 4JGXA 4UEIA 2NBNA 3SXNA 3CNUA 4MY0A 1PZ4A 1C44A 2CG3A 2CFUA 5A23A 2CX7A 1QNDA 2C0LB 2KSHA 2CG2A 4PDXA 5AIJA 3BKSA 1IKTA 2I00A 5AJLA 4AXHA 3R1KA 4AV7A 5EC4A 3UY5A 2OZGA 3BN8A 5IV0A 4QB9A 4JD6A 3N7ZA 1WFRA 3BKRA 4NURA 5EBVA 2CFZA 2YHEA 3SXOA 3BDQA 2KSIA 2NBMA 4MY3A 2QZTA
chains in the Genus database with same CATH superfamily
2HV2A 3RYOA 4JGXA 4UEIA 2NBNA 3SSMA 3SXNA 3CNUA 4MY0A 1PZ4A 1C44A 2CG3A 2CFUA 5A23A 2CX7A 2NSGA 1QNDA 2C0LB 2KSHA 2CG2A 4PDXA 5AIJA 3BKSA 1IKTA 2I00A 5AJLA 4AXHA 3R1KA 4AV7A 5EC4A 4NSSA 2OZGA 3BN8A 3UY5A 5IV0A 4QB9A 4JD6A 3N7ZA 3SSNA 2NSFA 1WFRA 3BKRA 3SSOA 4NURA 5EBVA 2CFZA 2YHEA 3SXOA 3BDQA 4ZY7A 2KSIA 2NBMA 4MY3A 2QZTA
chains in the Genus database with same CATH topology
2HV2A 3RYOA 4JGXA 4UEIA 2NBNA 3SXNA 3CNUA 4MY0A 1PZ4A 1C44A 2CG3A 2CFUA 5A23A 2CX7A 1QNDA 2C0LB 2KSHA 2CG2A 4PDXA 5AIJA 3BKSA 1IKTA 2I00A 5AJLA 4AXHA 3R1KA 4AV7A 5EC4A 3UY5A 2OZGA 3BN8A 5IV0A 4QB9A 4JD6A 3N7ZA 1WFRA 3BKRA 4NURA 5EBVA 2CFZA 2YHEA 3SXOA 3BDQA 2KSIA 2NBMA 4MY3A 2QZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV2 A;  3RYO A;  4JGX A;  4UEI A;  2NBN A;  3SXN A;  3CNU A;  4MY0 A;  1PZ4 A;  1C44 A;  2CG3 A;  2CFU A;  5A23 A;  2CX7 A;  1QND A;  2C0L B;  2KSH A;  2CG2 A;  4PDX A;  5AIJ A;  3BKS A;  1IKT A;  2I00 A;  5AJL A;  4AXH A;  3R1K A;  4AV7 A;  5EC4 A;  3UY5 A;  2OZG A;  3BN8 A;  5IV0 A;  4QB9 A;  4JD6 A;  3N7Z A;  1WFR A;  3BKR A;  4NUR A;  5EBV A;  2CFZ A;  2YHE A;  3SXO A;  3BDQ A;  2KSI A;  2NBM A;  4MY3 A;  2QZT A; 
#chains in the Genus database with same CATH topology
 2HV2 A;  3RYO A;  4JGX A;  4UEI A;  2NBN A;  3SSM A;  3SXN A;  3CNU A;  4MY0 A;  1PZ4 A;  1C44 A;  2CG3 A;  2CFU A;  5A23 A;  2CX7 A;  2NSG A;  1QND A;  2C0L B;  2KSH A;  2CG2 A;  4PDX A;  5AIJ A;  3BKS A;  1IKT A;  2I00 A;  5AJL A;  4AXH A;  3R1K A;  4AV7 A;  5EC4 A;  4NSS A;  2OZG A;  3BN8 A;  3UY5 A;  5IV0 A;  4QB9 A;  4JD6 A;  3N7Z A;  3SSN A;  2NSF A;  1WFR A;  3BKR A;  3SSO A;  4NUR A;  5EBV A;  2CFZ A;  2YHE A;  3SXO A;  3BDQ A;  4ZY7 A;  2KSI A;  2NBM A;  4MY3 A;  2QZT A; 
#chains in the Genus database with same CATH homology
 2HV2 A;  3RYO A;  4JGX A;  4UEI A;  2NBN A;  3SXN A;  3CNU A;  4MY0 A;  1PZ4 A;  1C44 A;  2CG3 A;  2CFU A;  5A23 A;  2CX7 A;  1QND A;  2C0L B;  2KSH A;  2CG2 A;  4PDX A;  5AIJ A;  3BKS A;  1IKT A;  2I00 A;  5AJL A;  4AXH A;  3R1K A;  4AV7 A;  5EC4 A;  3UY5 A;  2OZG A;  3BN8 A;  5IV0 A;  4QB9 A;  4JD6 A;  3N7Z A;  1WFR A;  3BKR A;  4NUR A;  5EBV A;  2CFZ A;  2YHE A;  3SXO A;  3BDQ A;  2KSI A;  2NBM A;  4MY3 A;  2QZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...