2NBMA

Solution nmr structure of ligand free sterol carrier protein 2 like 2 from aedes aegypti
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
b'MSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVIHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2-like 2
publication title Solution Nuclear Magnetic Resonance Studies of Sterol Carrier Protein 2 Like 2 (SCP2L2) Reveal the Insecticide Specific Structural Characteristics of SCP2 Proteins in Aedes aegypti Mosquitoes
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
total genus 24
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2nbmA00
2I00A 4AXHA 5AJLA 3RYOA 1QNDA 2CFUA 2KSIA 1IKTA 4JGXA 4UEIA 3UY5A 2CFZA 2CX7A 3BKSA 3SXOA 2YHEA 4JD6A 3BDQA 5EBVA 3R1KA 4AV7A 5IV0A 2HV2A 5A23A 2C0LB 4QB9A 2CG3A 4MY0A 1C44A 3SXNA 2KSHA 5EC4A 4PDXA 2NBNA 5AIJA 2QZTA 3N7ZA 2CG2A 3BN8A 2OZGA 1PZ4A 2NBMA 3BKRA 4MY3A 4NURA 3CNUA 1WFRA
chains in the Genus database with same CATH superfamily
2I00A 4NSSA 4AXHA 5AJLA 3RYOA 1QNDA 2CFUA 2KSIA 1IKTA 3SSMA 4JGXA 4UEIA 3UY5A 2CFZA 2CX7A 3BKSA 3SXOA 2YHEA 4JD6A 3BDQA 5EBVA 3R1KA 4AV7A 5IV0A 2HV2A 2NSGA 5A23A 2C0LB 4QB9A 2CG3A 2NSFA 4MY0A 1C44A 3SXNA 2KSHA 5EC4A 4PDXA 2NBNA 5AIJA 3SSOA 2QZTA 3N7ZA 2CG2A 3BN8A 4ZY7A 2OZGA 1PZ4A 2NBMA 3SSNA 3BKRA 4MY3A 4NURA 3CNUA 1WFRA
chains in the Genus database with same CATH topology
2I00A 4AXHA 5AJLA 3RYOA 1QNDA 2CFUA 2KSIA 1IKTA 4JGXA 4UEIA 3UY5A 2CFZA 2CX7A 3BKSA 3SXOA 2YHEA 4JD6A 3BDQA 5EBVA 3R1KA 4AV7A 5IV0A 2HV2A 5A23A 2C0LB 4QB9A 2CG3A 4MY0A 1C44A 3SXNA 2KSHA 5EC4A 4PDXA 2NBNA 5AIJA 2QZTA 3N7ZA 2CG2A 3BN8A 2OZGA 1PZ4A 2NBMA 3BKRA 4MY3A 4NURA 3CNUA 1WFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I00 A;  4AXH A;  5AJL A;  3RYO A;  1QND A;  2CFU A;  2KSI A;  1IKT A;  4JGX A;  4UEI A;  3UY5 A;  2CFZ A;  2CX7 A;  3BKS A;  3SXO A;  2YHE A;  4JD6 A;  3BDQ A;  5EBV A;  3R1K A;  4AV7 A;  5IV0 A;  2HV2 A;  5A23 A;  2C0L B;  4QB9 A;  2CG3 A;  4MY0 A;  1C44 A;  3SXN A;  2KSH A;  5EC4 A;  4PDX A;  2NBN A;  5AIJ A;  2QZT A;  3N7Z A;  2CG2 A;  3BN8 A;  2OZG A;  1PZ4 A;  2NBM A;  3BKR A;  4MY3 A;  4NUR A;  3CNU A;  1WFR A; 
#chains in the Genus database with same CATH topology
 2I00 A;  4NSS A;  4AXH A;  5AJL A;  3RYO A;  1QND A;  2CFU A;  2KSI A;  1IKT A;  3SSM A;  4JGX A;  4UEI A;  3UY5 A;  2CFZ A;  2CX7 A;  3BKS A;  3SXO A;  2YHE A;  4JD6 A;  3BDQ A;  5EBV A;  3R1K A;  4AV7 A;  5IV0 A;  2HV2 A;  2NSG A;  5A23 A;  2C0L B;  4QB9 A;  2CG3 A;  2NSF A;  4MY0 A;  1C44 A;  3SXN A;  2KSH A;  5EC4 A;  4PDX A;  2NBN A;  5AIJ A;  3SSO A;  2QZT A;  3N7Z A;  2CG2 A;  3BN8 A;  4ZY7 A;  2OZG A;  1PZ4 A;  2NBM A;  3SSN A;  3BKR A;  4MY3 A;  4NUR A;  3CNU A;  1WFR A; 
#chains in the Genus database with same CATH homology
 2I00 A;  4AXH A;  5AJL A;  3RYO A;  1QND A;  2CFU A;  2KSI A;  1IKT A;  4JGX A;  4UEI A;  3UY5 A;  2CFZ A;  2CX7 A;  3BKS A;  3SXO A;  2YHE A;  4JD6 A;  3BDQ A;  5EBV A;  3R1K A;  4AV7 A;  5IV0 A;  2HV2 A;  5A23 A;  2C0L B;  4QB9 A;  2CG3 A;  4MY0 A;  1C44 A;  3SXN A;  2KSH A;  5EC4 A;  4PDX A;  2NBN A;  5AIJ A;  2QZT A;  3N7Z A;  2CG2 A;  3BN8 A;  2OZG A;  1PZ4 A;  2NBM A;  3BKR A;  4MY3 A;  4NUR A;  3CNU A;  1WFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...