1IKTA

Liganded sterol carrier protein type 2 (scp-2) like domain of human multifunctional enzyme type 2 (mfe-2)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
LQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the liganded SCP-2-like domain of human peroxisomal multifunctional enzyme type 2 at 1.75 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
total genus 40
structure length 115
sequence length 115
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1iktA00
4JD6A 4PDXA 2KSIA 3R1KA 4UEIA 5EC4A 1PZ4A 1IKTA 2QZTA 1C44A 2CG3A 2CFZA 2HV2A 5AIJA 2NBNA 5EBVA 3BDQA 3UY5A 2CFUA 2OZGA 3BN8A 2C0LB 3BKRA 4NURA 4QB9A 4JGXA 3RYOA 4MY0A 3SXNA 2CX7A 5AJLA 3BKSA 2YHEA 4AXHA 2KSHA 2I00A 2NBMA 3CNUA 3N7ZA 5IV0A 4MY3A 1WFRA 3SXOA 5A23A 1QNDA 2CG2A 4AV7A
chains in the Genus database with same CATH superfamily
4JD6A 4PDXA 2KSIA 3R1KA 4UEIA 5EC4A 1PZ4A 1IKTA 2QZTA 1C44A 2CG3A 2CFZA 3SSOA 2HV2A 5AIJA 2NBNA 5EBVA 3BDQA 3UY5A 2CFUA 2OZGA 3SSMA 3BN8A 2C0LB 2NSGA 3BKRA 4NURA 4JGXA 4QB9A 4MY0A 3RYOA 3SXNA 2CX7A 4NSSA 3BKSA 2YHEA 5AJLA 4AXHA 2KSHA 2I00A 2NBMA 3CNUA 3N7ZA 3SSNA 5IV0A 4MY3A 1WFRA 3SXOA 5A23A 2NSFA 1QNDA 2CG2A 4ZY7A 4AV7A
chains in the Genus database with same CATH topology
4JD6A 4PDXA 2KSIA 3R1KA 4UEIA 5EC4A 1PZ4A 1IKTA 2QZTA 1C44A 2CG3A 2CFZA 2HV2A 5AIJA 2NBNA 5EBVA 3BDQA 3UY5A 2CFUA 2OZGA 3BN8A 2C0LB 3BKRA 4NURA 4QB9A 4JGXA 3RYOA 4MY0A 3SXNA 2CX7A 5AJLA 3BKSA 2YHEA 4AXHA 2KSHA 2I00A 2NBMA 3CNUA 3N7ZA 5IV0A 4MY3A 1WFRA 3SXOA 5A23A 1QNDA 2CG2A 4AV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD6 A;  4PDX A;  2KSI A;  3R1K A;  4UEI A;  5EC4 A;  1PZ4 A;  1IKT A;  2QZT A;  1C44 A;  2CG3 A;  2CFZ A;  2HV2 A;  5AIJ A;  2NBN A;  5EBV A;  3BDQ A;  3UY5 A;  2CFU A;  2OZG A;  3BN8 A;  2C0L B;  3BKR A;  4NUR A;  4QB9 A;  4JGX A;  3RYO A;  4MY0 A;  3SXN A;  2CX7 A;  5AJL A;  3BKS A;  2YHE A;  4AXH A;  2KSH A;  2I00 A;  2NBM A;  3CNU A;  3N7Z A;  5IV0 A;  4MY3 A;  1WFR A;  3SXO A;  5A23 A;  1QND A;  2CG2 A;  4AV7 A; 
#chains in the Genus database with same CATH topology
 4JD6 A;  4PDX A;  2KSI A;  3R1K A;  4UEI A;  5EC4 A;  1PZ4 A;  1IKT A;  2QZT A;  1C44 A;  2CG3 A;  2CFZ A;  3SSO A;  2HV2 A;  5AIJ A;  2NBN A;  5EBV A;  3BDQ A;  3UY5 A;  2CFU A;  2OZG A;  3SSM A;  3BN8 A;  2C0L B;  2NSG A;  3BKR A;  4NUR A;  4JGX A;  4QB9 A;  4MY0 A;  3RYO A;  3SXN A;  2CX7 A;  4NSS A;  3BKS A;  2YHE A;  5AJL A;  4AXH A;  2KSH A;  2I00 A;  2NBM A;  3CNU A;  3N7Z A;  3SSN A;  5IV0 A;  4MY3 A;  1WFR A;  3SXO A;  5A23 A;  2NSF A;  1QND A;  2CG2 A;  4ZY7 A;  4AV7 A; 
#chains in the Genus database with same CATH homology
 4JD6 A;  4PDX A;  2KSI A;  3R1K A;  4UEI A;  5EC4 A;  1PZ4 A;  1IKT A;  2QZT A;  1C44 A;  2CG3 A;  2CFZ A;  2HV2 A;  5AIJ A;  2NBN A;  5EBV A;  3BDQ A;  3UY5 A;  2CFU A;  2OZG A;  3BN8 A;  2C0L B;  3BKR A;  4NUR A;  4QB9 A;  4JGX A;  3RYO A;  4MY0 A;  3SXN A;  2CX7 A;  5AJL A;  3BKS A;  2YHE A;  4AXH A;  2KSH A;  2I00 A;  2NBM A;  3CNU A;  3N7Z A;  5IV0 A;  4MY3 A;  1WFR A;  3SXO A;  5A23 A;  1QND A;  2CG2 A;  4AV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...