1IKTA

Liganded sterol carrier protein type 2 (scp-2) like domain of human multifunctional enzyme type 2 (mfe-2)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
b'LQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
publication title Crystal structure of the liganded SCP-2-like domain of human peroxisomal multifunctional enzyme type 2 at 1.75 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 115
sequence length 115
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1iktA00
4MY0A 2NBNA 3N7ZA 4AXHA 2YHEA 2I00A 2HV2A 3UY5A 3BKRA 3R1KA 3BN8A 4MY3A 4UEIA 2C0LB 3BKSA 5EBVA 3SXOA 1QNDA 2CX7A 4JGXA 4PDXA 2OZGA 2CFUA 5AJLA 2CG3A 4JD6A 2KSIA 3BDQA 3CNUA 4AV7A 5A23A 4NURA 3RYOA 3SXNA 1PZ4A 2CG2A 2NBMA 1WFRA 5AIJA 1IKTA 2CFZA 5IV0A 2KSHA 4QB9A 5EC4A 1C44A 2QZTA
chains in the Genus database with same CATH superfamily
4MY0A 2NBNA 3SSNA 3N7ZA 3SSOA 4AXHA 2YHEA 2I00A 2HV2A 3UY5A 4NSSA 3BKRA 3R1KA 3BN8A 4ZY7A 4MY3A 4UEIA 2C0LB 3BKSA 5EBVA 3SXOA 1QNDA 2CX7A 4JGXA 4PDXA 2OZGA 2CFUA 5AJLA 2CG3A 4JD6A 2KSIA 3BDQA 3CNUA 4AV7A 5A23A 4NURA 3RYOA 3SXNA 2NSFA 1C44A 1PZ4A 2CG2A 3SSMA 2NBMA 1WFRA 5AIJA 1IKTA 2CFZA 5IV0A 2KSHA 4QB9A 5EC4A 2NSGA 2QZTA
chains in the Genus database with same CATH topology
4MY0A 2NBNA 3N7ZA 4AXHA 2YHEA 2I00A 2HV2A 3UY5A 3BKRA 3R1KA 3BN8A 4MY3A 4UEIA 2C0LB 3BKSA 5EBVA 3SXOA 1QNDA 2CX7A 4JGXA 4PDXA 2OZGA 2CFUA 5AJLA 2CG3A 4JD6A 2KSIA 3BDQA 3CNUA 4AV7A 5A23A 4NURA 3RYOA 3SXNA 1PZ4A 2CG2A 2NBMA 1WFRA 5AIJA 1IKTA 2CFZA 5IV0A 2KSHA 4QB9A 5EC4A 1C44A 2QZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY0 A;  2NBN A;  3N7Z A;  4AXH A;  2YHE A;  2I00 A;  2HV2 A;  3UY5 A;  3BKR A;  3R1K A;  3BN8 A;  4MY3 A;  4UEI A;  2C0L B;  3BKS A;  5EBV A;  3SXO A;  1QND A;  2CX7 A;  4JGX A;  4PDX A;  2OZG A;  2CFU A;  5AJL A;  2CG3 A;  4JD6 A;  2KSI A;  3BDQ A;  3CNU A;  4AV7 A;  5A23 A;  4NUR A;  3RYO A;  3SXN A;  1PZ4 A;  2CG2 A;  2NBM A;  1WFR A;  5AIJ A;  1IKT A;  2CFZ A;  5IV0 A;  2KSH A;  4QB9 A;  5EC4 A;  1C44 A;  2QZT A; 
#chains in the Genus database with same CATH topology
 4MY0 A;  2NBN A;  3SSN A;  3N7Z A;  3SSO A;  4AXH A;  2YHE A;  2I00 A;  2HV2 A;  3UY5 A;  4NSS A;  3BKR A;  3R1K A;  3BN8 A;  4ZY7 A;  4MY3 A;  4UEI A;  2C0L B;  3BKS A;  5EBV A;  3SXO A;  1QND A;  2CX7 A;  4JGX A;  4PDX A;  2OZG A;  2CFU A;  5AJL A;  2CG3 A;  4JD6 A;  2KSI A;  3BDQ A;  3CNU A;  4AV7 A;  5A23 A;  4NUR A;  3RYO A;  3SXN A;  2NSF A;  1C44 A;  1PZ4 A;  2CG2 A;  3SSM A;  2NBM A;  1WFR A;  5AIJ A;  1IKT A;  2CFZ A;  5IV0 A;  2KSH A;  4QB9 A;  5EC4 A;  2NSG A;  2QZT A; 
#chains in the Genus database with same CATH homology
 4MY0 A;  2NBN A;  3N7Z A;  4AXH A;  2YHE A;  2I00 A;  2HV2 A;  3UY5 A;  3BKR A;  3R1K A;  3BN8 A;  4MY3 A;  4UEI A;  2C0L B;  3BKS A;  5EBV A;  3SXO A;  1QND A;  2CX7 A;  4JGX A;  4PDX A;  2OZG A;  2CFU A;  5AJL A;  2CG3 A;  4JD6 A;  2KSI A;  3BDQ A;  3CNU A;  4AV7 A;  5A23 A;  4NUR A;  3RYO A;  3SXN A;  1PZ4 A;  2CG2 A;  2NBM A;  1WFR A;  5AIJ A;  1IKT A;  2CFZ A;  5IV0 A;  2KSH A;  4QB9 A;  5EC4 A;  1C44 A;  2QZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...