1IKTA

Liganded sterol carrier protein type 2 (scp-2) like domain of human multifunctional enzyme type 2 (mfe-2)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
LQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the liganded SCP-2-like domain of human peroxisomal multifunctional enzyme type 2 at 1.75 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17 BETA-DEHYDROGENASE 4
total genus 40
structure length 115
sequence length 115
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1iktA00
5EC4A 2KSHA 2CX7A 3BN8A 4PDXA 2HV2A 3SXNA 5AIJA 4AV7A 2OZGA 2CFZA 2CG3A 4MY3A 2CG2A 3UY5A 2NBMA 3CNUA 2QZTA 5IV0A 2I00A 4QB9A 3BDQA 1PZ4A 5EBVA 4AXHA 4JD6A 2C0LB 2KSIA 3BKRA 5A23A 3BKSA 4JGXA 1C44A 1IKTA 4NURA 3N7ZA 2NBNA 1QNDA 1WFRA 4UEIA 2CFUA 3R1KA 4MY0A 3SXOA 3RYOA 5AJLA 2YHEA
chains in the Genus database with same CATH superfamily
5EC4A 2KSHA 4ZY7A 2CX7A 3BN8A 4PDXA 2HV2A 3SXNA 5AIJA 3SSMA 2OZGA 4AV7A 2CFZA 2CG3A 4MY3A 2CG2A 3UY5A 2NBMA 3CNUA 3SSNA 2QZTA 5IV0A 2I00A 4QB9A 3BDQA 1PZ4A 5EBVA 4AXHA 4JD6A 2C0LB 2KSIA 3BKRA 5A23A 3BKSA 4JGXA 1C44A 1IKTA 4NURA 2NSGA 3N7ZA 2NBNA 1QNDA 1WFRA 4UEIA 2CFUA 3R1KA 4NSSA 4MY0A 3SSOA 3SXOA 3RYOA 5AJLA 2YHEA 2NSFA
chains in the Genus database with same CATH topology
5EC4A 2KSHA 2CX7A 3BN8A 4PDXA 2HV2A 3SXNA 5AIJA 4AV7A 2OZGA 2CFZA 2CG3A 4MY3A 2CG2A 3UY5A 2NBMA 3CNUA 2QZTA 5IV0A 2I00A 4QB9A 3BDQA 1PZ4A 5EBVA 4AXHA 4JD6A 2C0LB 2KSIA 3BKRA 5A23A 3BKSA 4JGXA 1C44A 1IKTA 4NURA 3N7ZA 2NBNA 1QNDA 1WFRA 4UEIA 2CFUA 3R1KA 4MY0A 3SXOA 3RYOA 5AJLA 2YHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC4 A;  2KSH A;  2CX7 A;  3BN8 A;  4PDX A;  2HV2 A;  3SXN A;  5AIJ A;  4AV7 A;  2OZG A;  2CFZ A;  2CG3 A;  4MY3 A;  2CG2 A;  3UY5 A;  2NBM A;  3CNU A;  2QZT A;  5IV0 A;  2I00 A;  4QB9 A;  3BDQ A;  1PZ4 A;  5EBV A;  4AXH A;  4JD6 A;  2C0L B;  2KSI A;  3BKR A;  5A23 A;  3BKS A;  4JGX A;  1C44 A;  1IKT A;  4NUR A;  3N7Z A;  2NBN A;  1QND A;  1WFR A;  4UEI A;  2CFU A;  3R1K A;  4MY0 A;  3SXO A;  3RYO A;  5AJL A;  2YHE A; 
#chains in the Genus database with same CATH topology
 5EC4 A;  2KSH A;  4ZY7 A;  2CX7 A;  3BN8 A;  4PDX A;  2HV2 A;  3SXN A;  5AIJ A;  3SSM A;  2OZG A;  4AV7 A;  2CFZ A;  2CG3 A;  4MY3 A;  2CG2 A;  3UY5 A;  2NBM A;  3CNU A;  3SSN A;  2QZT A;  5IV0 A;  2I00 A;  4QB9 A;  3BDQ A;  1PZ4 A;  5EBV A;  4AXH A;  4JD6 A;  2C0L B;  2KSI A;  3BKR A;  5A23 A;  3BKS A;  4JGX A;  1C44 A;  1IKT A;  4NUR A;  2NSG A;  3N7Z A;  2NBN A;  1QND A;  1WFR A;  4UEI A;  2CFU A;  3R1K A;  4NSS A;  4MY0 A;  3SSO A;  3SXO A;  3RYO A;  5AJL A;  2YHE A;  2NSF A; 
#chains in the Genus database with same CATH homology
 5EC4 A;  2KSH A;  2CX7 A;  3BN8 A;  4PDX A;  2HV2 A;  3SXN A;  5AIJ A;  4AV7 A;  2OZG A;  2CFZ A;  2CG3 A;  4MY3 A;  2CG2 A;  3UY5 A;  2NBM A;  3CNU A;  2QZT A;  5IV0 A;  2I00 A;  4QB9 A;  3BDQ A;  1PZ4 A;  5EBV A;  4AXH A;  4JD6 A;  2C0L B;  2KSI A;  3BKR A;  5A23 A;  3BKS A;  4JGX A;  1C44 A;  1IKT A;  4NUR A;  3N7Z A;  2NBN A;  1QND A;  1WFR A;  4UEI A;  2CFU A;  3R1K A;  4MY0 A;  3SXO A;  3RYO A;  5AJL A;  2YHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...