3BKRA

Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
b'ALKTDQILDKLNEKLAQVDRSKRSFTVILFVHLRQEGKVVRSVVLDFNDLKISEIELAVTSTADYPAERIDASITIDDNDFYLVATKETSFAALIEQGKVDITGNKQAFLTLDEKFRNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol Carrier Protein-2 like-3
publication title Characterization of the yellow fever mosquito sterol carrier protein-2 like 3 gene and ligand-bound protein structure.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bkrA00
3N7ZA 3R1KA 5AJLA 1QNDA 1PZ4A 3RYOA 5EBVA 3CNUA 5A23A 4MY0A 3BKRA 4UEIA 4AXHA 2KSHA 2CG3A 2OZGA 5AIJA 2NBMA 2I00A 3BKSA 2CFUA 2HV2A 4JD6A 3SXNA 2NBNA 2CX7A 3UY5A 2KSIA 3BN8A 4AV7A 2YHEA 3SXOA 4NURA 2C0LB 1C44A 4QB9A 4PDXA 3BDQA 2CFZA 1WFRA 4JGXA 4MY3A 2CG2A 1IKTA 2QZTA 5IV0A 5EC4A
chains in the Genus database with same CATH superfamily
2NSFA 3N7ZA 3R1KA 5AJLA 1QNDA 1PZ4A 3RYOA 5EBVA 3CNUA 5A23A 4MY0A 3BKRA 4UEIA 4AXHA 2KSHA 2CG3A 2OZGA 5AIJA 2NBMA 2I00A 3BKSA 2NSGA 2CFUA 2HV2A 4JD6A 3SXNA 2NBNA 2CX7A 3UY5A 2KSIA 3BN8A 4AV7A 2YHEA 3SXOA 4NURA 3SSNA 2C0LB 1C44A 4ZY7A 4QB9A 4PDXA 3BDQA 2CFZA 3SSMA 1WFRA 4JGXA 4MY3A 2CG2A 5IV0A 3SSOA 1IKTA 2QZTA 4NSSA 5EC4A
chains in the Genus database with same CATH topology
3N7ZA 3R1KA 5AJLA 1QNDA 1PZ4A 3RYOA 5EBVA 3CNUA 5A23A 4MY0A 3BKRA 4UEIA 4AXHA 2KSHA 2CG3A 2OZGA 5AIJA 2NBMA 2I00A 3BKSA 2CFUA 2HV2A 4JD6A 3SXNA 2NBNA 2CX7A 3UY5A 2KSIA 3BN8A 4AV7A 2YHEA 3SXOA 4NURA 2C0LB 1C44A 4QB9A 4PDXA 3BDQA 2CFZA 1WFRA 4JGXA 4MY3A 2CG2A 1IKTA 2QZTA 5IV0A 5EC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7Z A;  3R1K A;  5AJL A;  1QND A;  1PZ4 A;  3RYO A;  5EBV A;  3CNU A;  5A23 A;  4MY0 A;  3BKR A;  4UEI A;  4AXH A;  2KSH A;  2CG3 A;  2OZG A;  5AIJ A;  2NBM A;  2I00 A;  3BKS A;  2CFU A;  2HV2 A;  4JD6 A;  3SXN A;  2NBN A;  2CX7 A;  3UY5 A;  2KSI A;  3BN8 A;  4AV7 A;  2YHE A;  3SXO A;  4NUR A;  2C0L B;  1C44 A;  4QB9 A;  4PDX A;  3BDQ A;  2CFZ A;  1WFR A;  4JGX A;  4MY3 A;  2CG2 A;  1IKT A;  2QZT A;  5IV0 A;  5EC4 A; 
#chains in the Genus database with same CATH topology
 2NSF A;  3N7Z A;  3R1K A;  5AJL A;  1QND A;  1PZ4 A;  3RYO A;  5EBV A;  3CNU A;  5A23 A;  4MY0 A;  3BKR A;  4UEI A;  4AXH A;  2KSH A;  2CG3 A;  2OZG A;  5AIJ A;  2NBM A;  2I00 A;  3BKS A;  2NSG A;  2CFU A;  2HV2 A;  4JD6 A;  3SXN A;  2NBN A;  2CX7 A;  3UY5 A;  2KSI A;  3BN8 A;  4AV7 A;  2YHE A;  3SXO A;  4NUR A;  3SSN A;  2C0L B;  1C44 A;  4ZY7 A;  4QB9 A;  4PDX A;  3BDQ A;  2CFZ A;  3SSM A;  1WFR A;  4JGX A;  4MY3 A;  2CG2 A;  5IV0 A;  3SSO A;  1IKT A;  2QZT A;  4NSS A;  5EC4 A; 
#chains in the Genus database with same CATH homology
 3N7Z A;  3R1K A;  5AJL A;  1QND A;  1PZ4 A;  3RYO A;  5EBV A;  3CNU A;  5A23 A;  4MY0 A;  3BKR A;  4UEI A;  4AXH A;  2KSH A;  2CG3 A;  2OZG A;  5AIJ A;  2NBM A;  2I00 A;  3BKS A;  2CFU A;  2HV2 A;  4JD6 A;  3SXN A;  2NBN A;  2CX7 A;  3UY5 A;  2KSI A;  3BN8 A;  4AV7 A;  2YHE A;  3SXO A;  4NUR A;  2C0L B;  1C44 A;  4QB9 A;  4PDX A;  3BDQ A;  2CFZ A;  1WFR A;  4JGX A;  4MY3 A;  2CG2 A;  1IKT A;  2QZT A;  5IV0 A;  5EC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...