3BKRA

Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
ALKTDQILDKLNEKLAQVDRSKRSFTVILFVHLRQEGKVVRSVVLDFNDLKISEIELAVTSTADYPAERIDASITIDDNDFYLVATKETSFAALIEQGKVDITGNKQAFLTLDEKFRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the yellow fever mosquito sterol carrier protein-2 like 3 gene and ligand-bound protein structure.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords Sterol Carrier Protein-2 like-3
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bkrA00
3N7ZA 1PZ4A 1C44A 5AJLA 4MY3A 5EBVA 3R1KA 2NBNA 4JGXA 3BN8A 5EC4A 2CG3A 3BKSA 2I00A 3BDQA 3RYOA 1QNDA 4QB9A 3UY5A 2OZGA 2KSHA 4UEIA 2QZTA 2CG2A 4PDXA 4AXHA 2CFUA 2NBMA 2CX7A 3CNUA 3SXNA 1IKTA 4AV7A 2CFZA 4JD6A 5A23A 5AIJA 1WFRA 5IV0A 2C0LB 2KSIA 3SXOA 2YHEA 4MY0A 2HV2A 4NURA 3BKRA
chains in the Genus database with same CATH superfamily
3N7ZA 1PZ4A 1C44A 2NSFA 2NSGA 5AJLA 4MY3A 5EBVA 3R1KA 2NBNA 4JGXA 3BN8A 5EC4A 2CG3A 3BKSA 2I00A 3BDQA 3RYOA 1QNDA 4QB9A 3UY5A 2OZGA 2KSHA 4UEIA 2QZTA 2CG2A 4PDXA 4ZY7A 4AXHA 2CFUA 2NBMA 2CX7A 3CNUA 3SSMA 1IKTA 3SSNA 2CFZA 3SXNA 4AV7A 4JD6A 5A23A 5AIJA 1WFRA 4NSSA 5IV0A 2C0LB 2KSIA 3SXOA 2YHEA 3SSOA 4MY0A 2HV2A 4NURA 3BKRA
chains in the Genus database with same CATH topology
3N7ZA 1PZ4A 1C44A 5AJLA 4MY3A 5EBVA 3R1KA 2NBNA 4JGXA 3BN8A 5EC4A 2CG3A 3BKSA 2I00A 3BDQA 3RYOA 1QNDA 4QB9A 3UY5A 2OZGA 2KSHA 4UEIA 2QZTA 2CG2A 4PDXA 4AXHA 2CFUA 2NBMA 2CX7A 3CNUA 3SXNA 1IKTA 4AV7A 2CFZA 4JD6A 5A23A 5AIJA 1WFRA 5IV0A 2C0LB 2KSIA 3SXOA 2YHEA 4MY0A 2HV2A 4NURA 3BKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7Z A;  1PZ4 A;  1C44 A;  5AJL A;  4MY3 A;  5EBV A;  3R1K A;  2NBN A;  4JGX A;  3BN8 A;  5EC4 A;  2CG3 A;  3BKS A;  2I00 A;  3BDQ A;  3RYO A;  1QND A;  4QB9 A;  3UY5 A;  2OZG A;  2KSH A;  4UEI A;  2QZT A;  2CG2 A;  4PDX A;  4AXH A;  2CFU A;  2NBM A;  2CX7 A;  3CNU A;  3SXN A;  1IKT A;  4AV7 A;  2CFZ A;  4JD6 A;  5A23 A;  5AIJ A;  1WFR A;  5IV0 A;  2C0L B;  2KSI A;  3SXO A;  2YHE A;  4MY0 A;  2HV2 A;  4NUR A;  3BKR A; 
#chains in the Genus database with same CATH topology
 3N7Z A;  1PZ4 A;  1C44 A;  2NSF A;  2NSG A;  5AJL A;  4MY3 A;  5EBV A;  3R1K A;  2NBN A;  4JGX A;  3BN8 A;  5EC4 A;  2CG3 A;  3BKS A;  2I00 A;  3BDQ A;  3RYO A;  1QND A;  4QB9 A;  3UY5 A;  2OZG A;  2KSH A;  4UEI A;  2QZT A;  2CG2 A;  4PDX A;  4ZY7 A;  4AXH A;  2CFU A;  2NBM A;  2CX7 A;  3CNU A;  3SSM A;  1IKT A;  3SSN A;  2CFZ A;  3SXN A;  4AV7 A;  4JD6 A;  5A23 A;  5AIJ A;  1WFR A;  4NSS A;  5IV0 A;  2C0L B;  2KSI A;  3SXO A;  2YHE A;  3SSO A;  4MY0 A;  2HV2 A;  4NUR A;  3BKR A; 
#chains in the Genus database with same CATH homology
 3N7Z A;  1PZ4 A;  1C44 A;  5AJL A;  4MY3 A;  5EBV A;  3R1K A;  2NBN A;  4JGX A;  3BN8 A;  5EC4 A;  2CG3 A;  3BKS A;  2I00 A;  3BDQ A;  3RYO A;  1QND A;  4QB9 A;  3UY5 A;  2OZG A;  2KSH A;  4UEI A;  2QZT A;  2CG2 A;  4PDX A;  4AXH A;  2CFU A;  2NBM A;  2CX7 A;  3CNU A;  3SXN A;  1IKT A;  4AV7 A;  2CFZ A;  4JD6 A;  5A23 A;  5AIJ A;  1WFR A;  5IV0 A;  2C0L B;  2KSI A;  3SXO A;  2YHE A;  4MY0 A;  2HV2 A;  4NUR A;  3BKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...