3BKRA

Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
ALKTDQILDKLNEKLAQVDRSKRSFTVILFVHLRQEGKVVRSVVLDFNDLKISEIELAVTSTADYPAERIDASITIDDNDFYLVATKETSFAALIEQGKVDITGNKQAFLTLDEKFRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the yellow fever mosquito sterol carrier protein-2 like 3 gene and ligand-bound protein structure.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords Sterol Carrier Protein-2 like-3
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bkrA00
2OZGA 3BN8A 4JD6A 2C0LB 1WFRA 2QZTA 2CG2A 2HV2A 5EC4A 4QB9A 4AV7A 5AJLA 1QNDA 3SXOA 2CG3A 3BDQA 5EBVA 3SXNA 3BKSA 5IV0A 2YHEA 4JGXA 3RYOA 5A23A 3N7ZA 2NBNA 4UEIA 1C44A 2KSIA 2NBMA 5AIJA 4AXHA 3CNUA 3R1KA 1PZ4A 2CX7A 1IKTA 4PDXA 2KSHA 2CFZA 2I00A 4NURA 3UY5A 3BKRA 4MY3A 2CFUA 4MY0A
chains in the Genus database with same CATH superfamily
2OZGA 3SSNA 3SSMA 3BN8A 4JD6A 2C0LB 1WFRA 2QZTA 3UY5A 2CG2A 2HV2A 5EC4A 4QB9A 4AV7A 5AJLA 1QNDA 3SXOA 2NSFA 2CG3A 3BDQA 5EBVA 3SXNA 3BKSA 5IV0A 2YHEA 4JGXA 3RYOA 5A23A 3N7ZA 2NBNA 4UEIA 4NSSA 1C44A 2KSIA 2NBMA 4ZY7A 5AIJA 4AXHA 3CNUA 3R1KA 1PZ4A 2CX7A 1IKTA 2NSGA 2KSHA 2CFZA 2I00A 4NURA 4PDXA 3BKRA 4MY3A 2CFUA 3SSOA 4MY0A
chains in the Genus database with same CATH topology
2OZGA 3BN8A 4JD6A 2C0LB 1WFRA 2QZTA 2CG2A 2HV2A 5EC4A 4QB9A 4AV7A 5AJLA 1QNDA 3SXOA 2CG3A 3BDQA 5EBVA 3SXNA 3BKSA 5IV0A 2YHEA 4JGXA 3RYOA 5A23A 3N7ZA 2NBNA 4UEIA 1C44A 2KSIA 2NBMA 5AIJA 4AXHA 3CNUA 3R1KA 1PZ4A 2CX7A 1IKTA 4PDXA 2KSHA 2CFZA 2I00A 4NURA 3UY5A 3BKRA 4MY3A 2CFUA 4MY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZG A;  3BN8 A;  4JD6 A;  2C0L B;  1WFR A;  2QZT A;  2CG2 A;  2HV2 A;  5EC4 A;  4QB9 A;  4AV7 A;  5AJL A;  1QND A;  3SXO A;  2CG3 A;  3BDQ A;  5EBV A;  3SXN A;  3BKS A;  5IV0 A;  2YHE A;  4JGX A;  3RYO A;  5A23 A;  3N7Z A;  2NBN A;  4UEI A;  1C44 A;  2KSI A;  2NBM A;  5AIJ A;  4AXH A;  3CNU A;  3R1K A;  1PZ4 A;  2CX7 A;  1IKT A;  4PDX A;  2KSH A;  2CFZ A;  2I00 A;  4NUR A;  3UY5 A;  3BKR A;  4MY3 A;  2CFU A;  4MY0 A; 
#chains in the Genus database with same CATH topology
 2OZG A;  3SSN A;  3SSM A;  3BN8 A;  4JD6 A;  2C0L B;  1WFR A;  2QZT A;  3UY5 A;  2CG2 A;  2HV2 A;  5EC4 A;  4QB9 A;  4AV7 A;  5AJL A;  1QND A;  3SXO A;  2NSF A;  2CG3 A;  3BDQ A;  5EBV A;  3SXN A;  3BKS A;  5IV0 A;  2YHE A;  4JGX A;  3RYO A;  5A23 A;  3N7Z A;  2NBN A;  4UEI A;  4NSS A;  1C44 A;  2KSI A;  2NBM A;  4ZY7 A;  5AIJ A;  4AXH A;  3CNU A;  3R1K A;  1PZ4 A;  2CX7 A;  1IKT A;  2NSG A;  2KSH A;  2CFZ A;  2I00 A;  4NUR A;  4PDX A;  3BKR A;  4MY3 A;  2CFU A;  3SSO A;  4MY0 A; 
#chains in the Genus database with same CATH homology
 2OZG A;  3BN8 A;  4JD6 A;  2C0L B;  1WFR A;  2QZT A;  2CG2 A;  2HV2 A;  5EC4 A;  4QB9 A;  4AV7 A;  5AJL A;  1QND A;  3SXO A;  2CG3 A;  3BDQ A;  5EBV A;  3SXN A;  3BKS A;  5IV0 A;  2YHE A;  4JGX A;  3RYO A;  5A23 A;  3N7Z A;  2NBN A;  4UEI A;  1C44 A;  2KSI A;  2NBM A;  5AIJ A;  4AXH A;  3CNU A;  3R1K A;  1PZ4 A;  2CX7 A;  1IKT A;  4PDX A;  2KSH A;  2CFZ A;  2I00 A;  4NUR A;  3UY5 A;  3BKR A;  4MY3 A;  2CFU A;  4MY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...