3BKSA

Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
ALKTDQILDKLNEKLAQVDRSKRSFTVILFVHLRQEGKVVRSVVLDFNDLKISEIELAVTSTADYPAERIDASITIDDNDFYLVATKETSFAALIEQGKVDITGNKQAFLTLDEKFRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the yellow fever mosquito sterol carrier protein-2 like 3 gene and ligand-bound protein structure.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords Sterol Carrier Protein-2 like-3
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bksA00
4NURA 4UEIA 3RYOA 2HV2A 2NBNA 5EC4A 4PDXA 3N7ZA 5IV0A 3BN8A 3BDQA 3CNUA 5A23A 3R1KA 2CG2A 2CX7A 2CFUA 4QB9A 2KSHA 5AIJA 2KSIA 1QNDA 3BKRA 5AJLA 2QZTA 2YHEA 1C44A 2NBMA 2CG3A 1WFRA 3BKSA 4JD6A 4MY3A 2CFZA 4AXHA 3SXOA 2I00A 1PZ4A 3UY5A 1IKTA 5EBVA 4AV7A 4JGXA 2C0LB 4MY0A 3SXNA 2OZGA
chains in the Genus database with same CATH superfamily
4NURA 4UEIA 2NSGA 2HV2A 2NBNA 5EC4A 4PDXA 3RYOA 3N7ZA 4ZY7A 5IV0A 3BN8A 3BDQA 3CNUA 5A23A 3R1KA 2CG2A 2CX7A 2CFUA 4QB9A 2KSHA 5AIJA 2KSIA 1QNDA 3BKRA 4NSSA 5AJLA 2QZTA 2YHEA 1C44A 3SSOA 2NBMA 2CG3A 1WFRA 3SSMA 3BKSA 4JD6A 4MY3A 2CFZA 4AXHA 3SXOA 2I00A 1PZ4A 3UY5A 1IKTA 5EBVA 2NSFA 4AV7A 4JGXA 2C0LB 4MY0A 3SSNA 3SXNA 2OZGA
chains in the Genus database with same CATH topology
4NURA 4UEIA 3RYOA 2HV2A 2NBNA 5EC4A 4PDXA 3N7ZA 5IV0A 3BN8A 3BDQA 3CNUA 5A23A 3R1KA 2CG2A 2CX7A 2CFUA 4QB9A 2KSHA 5AIJA 2KSIA 1QNDA 3BKRA 5AJLA 2QZTA 2YHEA 1C44A 2NBMA 2CG3A 1WFRA 3BKSA 4JD6A 4MY3A 2CFZA 4AXHA 3SXOA 2I00A 1PZ4A 3UY5A 1IKTA 5EBVA 4AV7A 4JGXA 2C0LB 4MY0A 3SXNA 2OZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUR A;  4UEI A;  3RYO A;  2HV2 A;  2NBN A;  5EC4 A;  4PDX A;  3N7Z A;  5IV0 A;  3BN8 A;  3BDQ A;  3CNU A;  5A23 A;  3R1K A;  2CG2 A;  2CX7 A;  2CFU A;  4QB9 A;  2KSH A;  5AIJ A;  2KSI A;  1QND A;  3BKR A;  5AJL A;  2QZT A;  2YHE A;  1C44 A;  2NBM A;  2CG3 A;  1WFR A;  3BKS A;  4JD6 A;  4MY3 A;  2CFZ A;  4AXH A;  3SXO A;  2I00 A;  1PZ4 A;  3UY5 A;  1IKT A;  5EBV A;  4AV7 A;  4JGX A;  2C0L B;  4MY0 A;  3SXN A;  2OZG A; 
#chains in the Genus database with same CATH topology
 4NUR A;  4UEI A;  2NSG A;  2HV2 A;  2NBN A;  5EC4 A;  4PDX A;  3RYO A;  3N7Z A;  4ZY7 A;  5IV0 A;  3BN8 A;  3BDQ A;  3CNU A;  5A23 A;  3R1K A;  2CG2 A;  2CX7 A;  2CFU A;  4QB9 A;  2KSH A;  5AIJ A;  2KSI A;  1QND A;  3BKR A;  4NSS A;  5AJL A;  2QZT A;  2YHE A;  1C44 A;  3SSO A;  2NBM A;  2CG3 A;  1WFR A;  3SSM A;  3BKS A;  4JD6 A;  4MY3 A;  2CFZ A;  4AXH A;  3SXO A;  2I00 A;  1PZ4 A;  3UY5 A;  1IKT A;  5EBV A;  2NSF A;  4AV7 A;  4JGX A;  2C0L B;  4MY0 A;  3SSN A;  3SXN A;  2OZG A; 
#chains in the Genus database with same CATH homology
 4NUR A;  4UEI A;  3RYO A;  2HV2 A;  2NBN A;  5EC4 A;  4PDX A;  3N7Z A;  5IV0 A;  3BN8 A;  3BDQ A;  3CNU A;  5A23 A;  3R1K A;  2CG2 A;  2CX7 A;  2CFU A;  4QB9 A;  2KSH A;  5AIJ A;  2KSI A;  1QND A;  3BKR A;  5AJL A;  2QZT A;  2YHE A;  1C44 A;  2NBM A;  2CG3 A;  1WFR A;  3BKS A;  4JD6 A;  4MY3 A;  2CFZ A;  4AXH A;  3SXO A;  2I00 A;  1PZ4 A;  3UY5 A;  1IKT A;  5EBV A;  4AV7 A;  4JGX A;  2C0L B;  4MY0 A;  3SXN A;  2OZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...