3BKSA

Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
ALKTDQILDKLNEKLAQVDRSKRSFTVILFVHLRQEGKVVRSVVLDFNDLKISEIELAVTSTADYPAERIDASITIDDNDFYLVATKETSFAALIEQGKVDITGNKQAFLTLDEKFRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the yellow fever mosquito sterol carrier protein-2 like 3 gene and ligand-bound protein structure.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords Sterol Carrier Protein-2 like-3
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bksA00
4JGXA 2NBNA 4MY3A 3BDQA 4UEIA 4QB9A 4NURA 3BN8A 2I00A 5EC4A 1C44A 1WFRA 2QZTA 1QNDA 2HV2A 2YHEA 4AXHA 5AIJA 4MY0A 3R1KA 3BKSA 3N7ZA 5EBVA 5A23A 3BKRA 3UY5A 4JD6A 2NBMA 1PZ4A 2OZGA 2CG2A 2CFUA 4PDXA 3SXNA 2C0LB 2CX7A 5AJLA 1IKTA 4AV7A 3CNUA 2KSHA 3SXOA 3RYOA 5IV0A 2KSIA 2CG3A 2CFZA
chains in the Genus database with same CATH superfamily
4JGXA 2NBNA 4MY3A 2NSFA 3BDQA 4UEIA 4QB9A 4NURA 3BN8A 2I00A 5EC4A 1C44A 1WFRA 2QZTA 1QNDA 2HV2A 2YHEA 4AXHA 5AIJA 3SSMA 4MY0A 3SSNA 3R1KA 3BKSA 3N7ZA 5EBVA 5A23A 3BKRA 3UY5A 4JD6A 2NBMA 1PZ4A 2OZGA 2CG2A 2CFUA 4PDXA 3SXNA 2C0LB 2CX7A 5AJLA 1IKTA 2NSGA 3CNUA 2KSHA 4AV7A 3SXOA 3SSOA 3RYOA 4NSSA 5IV0A 2KSIA 2CG3A 4ZY7A 2CFZA
chains in the Genus database with same CATH topology
4JGXA 2NBNA 4MY3A 3BDQA 4UEIA 4QB9A 4NURA 3BN8A 2I00A 5EC4A 1C44A 1WFRA 2QZTA 1QNDA 2HV2A 2YHEA 4AXHA 5AIJA 4MY0A 3R1KA 3BKSA 3N7ZA 5EBVA 5A23A 3BKRA 3UY5A 4JD6A 2NBMA 1PZ4A 2OZGA 2CG2A 2CFUA 4PDXA 3SXNA 2C0LB 2CX7A 5AJLA 1IKTA 4AV7A 3CNUA 2KSHA 3SXOA 3RYOA 5IV0A 2KSIA 2CG3A 2CFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGX A;  2NBN A;  4MY3 A;  3BDQ A;  4UEI A;  4QB9 A;  4NUR A;  3BN8 A;  2I00 A;  5EC4 A;  1C44 A;  1WFR A;  2QZT A;  1QND A;  2HV2 A;  2YHE A;  4AXH A;  5AIJ A;  4MY0 A;  3R1K A;  3BKS A;  3N7Z A;  5EBV A;  5A23 A;  3BKR A;  3UY5 A;  4JD6 A;  2NBM A;  1PZ4 A;  2OZG A;  2CG2 A;  2CFU A;  4PDX A;  3SXN A;  2C0L B;  2CX7 A;  5AJL A;  1IKT A;  4AV7 A;  3CNU A;  2KSH A;  3SXO A;  3RYO A;  5IV0 A;  2KSI A;  2CG3 A;  2CFZ A; 
#chains in the Genus database with same CATH topology
 4JGX A;  2NBN A;  4MY3 A;  2NSF A;  3BDQ A;  4UEI A;  4QB9 A;  4NUR A;  3BN8 A;  2I00 A;  5EC4 A;  1C44 A;  1WFR A;  2QZT A;  1QND A;  2HV2 A;  2YHE A;  4AXH A;  5AIJ A;  3SSM A;  4MY0 A;  3SSN A;  3R1K A;  3BKS A;  3N7Z A;  5EBV A;  5A23 A;  3BKR A;  3UY5 A;  4JD6 A;  2NBM A;  1PZ4 A;  2OZG A;  2CG2 A;  2CFU A;  4PDX A;  3SXN A;  2C0L B;  2CX7 A;  5AJL A;  1IKT A;  2NSG A;  3CNU A;  2KSH A;  4AV7 A;  3SXO A;  3SSO A;  3RYO A;  4NSS A;  5IV0 A;  2KSI A;  2CG3 A;  4ZY7 A;  2CFZ A; 
#chains in the Genus database with same CATH homology
 4JGX A;  2NBN A;  4MY3 A;  3BDQ A;  4UEI A;  4QB9 A;  4NUR A;  3BN8 A;  2I00 A;  5EC4 A;  1C44 A;  1WFR A;  2QZT A;  1QND A;  2HV2 A;  2YHE A;  4AXH A;  5AIJ A;  4MY0 A;  3R1K A;  3BKS A;  3N7Z A;  5EBV A;  5A23 A;  3BKR A;  3UY5 A;  4JD6 A;  2NBM A;  1PZ4 A;  2OZG A;  2CG2 A;  2CFU A;  4PDX A;  3SXN A;  2C0L B;  2CX7 A;  5AJL A;  1IKT A;  4AV7 A;  3CNU A;  2KSH A;  3SXO A;  3RYO A;  5IV0 A;  2KSI A;  2CG3 A;  2CFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...