3BKSA

Crystal structure of sterol carrier protein-2 like-3 (scp2-l3) from aedes aegypti
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
b'ALKTDQILDKLNEKLAQVDRSKRSFTVILFVHLRQEGKVVRSVVLDFNDLKISEIELAVTSTADYPAERIDASITIDDNDFYLVATKETSFAALIEQGKVDITGNKQAFLTLDEKFRNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol Carrier Protein-2 like-3
publication title Characterization of the yellow fever mosquito sterol carrier protein-2 like 3 gene and ligand-bound protein structure.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
total genus 35
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bksA00
2CG3A 3UY5A 2C0LB 3RYOA 3BKRA 3SXNA 5EBVA 2CG2A 2HV2A 5EC4A 4MY3A 2OZGA 4QB9A 4UEIA 2CX7A 2YHEA 2KSHA 2KSIA 5A23A 3SXOA 3BDQA 2CFUA 4JGXA 5IV0A 5AIJA 1C44A 2CFZA 1IKTA 4AXHA 1QNDA 3BKSA 3R1KA 3CNUA 4MY0A 4PDXA 1PZ4A 4NURA 5AJLA 2QZTA 3N7ZA 4JD6A 2NBNA 1WFRA 4AV7A 2I00A 3BN8A 2NBMA
chains in the Genus database with same CATH superfamily
2CG3A 3UY5A 2C0LB 2NSGA 2NSFA 3SSMA 3RYOA 3BKRA 3SXNA 5EBVA 2CG2A 3SSNA 2HV2A 5EC4A 3SSOA 4MY3A 2OZGA 4QB9A 4UEIA 2CX7A 2YHEA 2KSHA 2KSIA 5A23A 3SXOA 3BDQA 2CFUA 4JGXA 5IV0A 5AIJA 1C44A 2CFZA 1IKTA 4AXHA 1QNDA 3BKSA 4ZY7A 4NSSA 3R1KA 3CNUA 4MY0A 4PDXA 1PZ4A 4NURA 5AJLA 2QZTA 3N7ZA 4JD6A 2NBNA 1WFRA 4AV7A 2I00A 3BN8A 2NBMA
chains in the Genus database with same CATH topology
2CG3A 3UY5A 2C0LB 3RYOA 3BKRA 3SXNA 5EBVA 2CG2A 2HV2A 5EC4A 4MY3A 2OZGA 4QB9A 4UEIA 2CX7A 2YHEA 2KSHA 2KSIA 5A23A 3SXOA 3BDQA 2CFUA 4JGXA 5IV0A 5AIJA 1C44A 2CFZA 1IKTA 4AXHA 1QNDA 3BKSA 3R1KA 3CNUA 4MY0A 4PDXA 1PZ4A 4NURA 5AJLA 2QZTA 3N7ZA 4JD6A 2NBNA 1WFRA 4AV7A 2I00A 3BN8A 2NBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CG3 A;  3UY5 A;  2C0L B;  3RYO A;  3BKR A;  3SXN A;  5EBV A;  2CG2 A;  2HV2 A;  5EC4 A;  4MY3 A;  2OZG A;  4QB9 A;  4UEI A;  2CX7 A;  2YHE A;  2KSH A;  2KSI A;  5A23 A;  3SXO A;  3BDQ A;  2CFU A;  4JGX A;  5IV0 A;  5AIJ A;  1C44 A;  2CFZ A;  1IKT A;  4AXH A;  1QND A;  3BKS A;  3R1K A;  3CNU A;  4MY0 A;  4PDX A;  1PZ4 A;  4NUR A;  5AJL A;  2QZT A;  3N7Z A;  4JD6 A;  2NBN A;  1WFR A;  4AV7 A;  2I00 A;  3BN8 A;  2NBM A; 
#chains in the Genus database with same CATH topology
 2CG3 A;  3UY5 A;  2C0L B;  2NSG A;  2NSF A;  3SSM A;  3RYO A;  3BKR A;  3SXN A;  5EBV A;  2CG2 A;  3SSN A;  2HV2 A;  5EC4 A;  3SSO A;  4MY3 A;  2OZG A;  4QB9 A;  4UEI A;  2CX7 A;  2YHE A;  2KSH A;  2KSI A;  5A23 A;  3SXO A;  3BDQ A;  2CFU A;  4JGX A;  5IV0 A;  5AIJ A;  1C44 A;  2CFZ A;  1IKT A;  4AXH A;  1QND A;  3BKS A;  4ZY7 A;  4NSS A;  3R1K A;  3CNU A;  4MY0 A;  4PDX A;  1PZ4 A;  4NUR A;  5AJL A;  2QZT A;  3N7Z A;  4JD6 A;  2NBN A;  1WFR A;  4AV7 A;  2I00 A;  3BN8 A;  2NBM A; 
#chains in the Genus database with same CATH homology
 2CG3 A;  3UY5 A;  2C0L B;  3RYO A;  3BKR A;  3SXN A;  5EBV A;  2CG2 A;  2HV2 A;  5EC4 A;  4MY3 A;  2OZG A;  4QB9 A;  4UEI A;  2CX7 A;  2YHE A;  2KSH A;  2KSI A;  5A23 A;  3SXO A;  3BDQ A;  2CFU A;  4JGX A;  5IV0 A;  5AIJ A;  1C44 A;  2CFZ A;  1IKT A;  4AXH A;  1QND A;  3BKS A;  3R1K A;  3CNU A;  4MY0 A;  4PDX A;  1PZ4 A;  4NUR A;  5AJL A;  2QZT A;  3N7Z A;  4JD6 A;  2NBN A;  1WFR A;  4AV7 A;  2I00 A;  3BN8 A;  2NBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...