3SSMA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
390
structure length
387
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
molecule keywords Methyltransferase
total genus 126
structure length 387
sequence length 390
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssmA02
3LKZA 4FT4A 2GA9A 3THSA 2B78A 1EJ6A 1R74A 5K0CA 2GPYA 3LL7A 2CWWA 2WA2A 3LCUA 3NMUF 4GQBA 3LPMA 3VC2A 3PX2A 3PFHA 4GC5A 3EVFA 5EMJA 5FHRA 3I58A 2BM8A 1RI4A 4MQ4A 3R6TA 2UYCA 2LD4A 4QVKA 3LX6A 2AOVA 1JR4A 3E7PA 1XDSA 5DRTA 5DX8A 2BR5A 4PONA 4CKBA 4KIFA 5K09A 3BKXA 5D1HA 1EJ0A 2OBFA 5E1BA 2XBMA 2E5WA 3QOWA 3TMAA 1IY9A 5E8RA 3BGDA 3FTCA 1Z3CA 3BT7A 1L3IA 2YUIA 3TQSA 1T43A 2YXDA 3HCBA 3GRZA 3MGGA 2UYOA 1NW7A 2NYUA 1RI5A 3F4KA 3OU7A 2O07A 3H2BA 3GRUA 5T67A 4YMGA 1YFLA 1EG2A 2UYQA 5LQKA 2B2CA 3X0DA 1AV6A 2IBTA 4C04A 3B3JA 4NECA 1XXLA 1D2HA 2XVMA 5DX0A 4DA4A 3GJYA 4RTLA 3PLAE 2ZBPA 2Y1WA 1L9KA 2HNKA 3DMFA 1KIAA 3O4FA 3OPNA 3SSOA 1NV9A 4R05A 3M33A 4V0QA 1KHHA 5EIFA 2PX8A 2PGXA 4PCLA 4RYLA 3FUXA 4FR0A 2YXEA 4C4AA 3DOUA 5K03A 3LSTA 4AZTA 1Q0TA 3M6XA 3ER9A 2P1DA 3C6MA 3G2QA 4PYIA 3KQYA 3OU6A 3HVHA 1MHTA 1KPIA 5K05A 5FA5A 2JH8A 3HVIA 3AY0A 3PT9A 4QVGA 3ELDA 1G8AA 2AS0A 3PS9A 1EAMA 1NW3A 5K0NA 1N7IA 1UWVA 3UJDA 3HCDA 5EGSA 3FRHA 3R3HA 3OU2A 4R6XA 5EMMA 2PLWA 1VBFA 1XCLA 2O06A 5LR6A 2EFJA 4X41A 3Q7EA 1D2GA 2OB1A 3ELWA 1FP2A 2C7OA 4DZRA 3RW9A 3IV6A 3NDJA 5LQCA 4P7GA 4YV1A 1WY7A 2IPXA 1TW2A 4YUZA 5EEGA 4LECA 2ZZNA 3UJ7A 1NW8A 3HA5A 3KQWA 4HRAA 1R8XA 3SGLA 4LWOA 4X63A 4OA8A 2B25A 2PT6A 1N7JA 2YX1A 5M5BA 4C06A 2HMYB 2PBFA 2YTZA 1XJ5A 5K0LA 1N2XA 1L1EA 1WS6A 3KPYA 5LQAA 5HOQA 10MHA 3MCZA 1M6EX 3KPWA 5FULA 5HZMA 4B17A 4LG1A 2NNWB 3G8AA 4FGZA 3C3YA 4F85A 1O9HA 2UZ4A 1WG8A 1YZ3A 3QV2A 3REOA 1X1DA 3HTXA 4PYNA 3LDFA 5BP7A 5CVVA 3TOSA 1AF7A 1M0EA 2VS1A 2YR0A 3MB5A 5FCDA 2ZBQA 3I5UA 4YUYA 1BC5A 3V97A 5JUWA 3PFGA 4QQKA 1EIZA 4X1OA 5EEHA 3V8VA 3BWMA 2GH1A 4WXHA 3KQMA 4AZVA 3EGEA 3HVKA 3BZBA 1JQEA 5P8WA 4R8SA 2XVAA 2ZIGA 4E30A 2JHAA 1SVUA 3GNLA 2G1PA 1KP9A 4M7RA 1ZKDA 3OZSA 3JWIA 4KDRA 1VQ1A 3SM3A 4BLUA 3KHKA 3B7PA 3NW9A 3G2OA 4RVGA 3E8SA 4FS8A 2ZBRA 5C1IA 5MHTA 4XUDA 5DSXA 4WVLA 1YF3A 1L3CA 1JTFA 4AUKA 5T6BA 1TW3A 2H1RA 3FPFA 2ZCJA 1YZHA 2FRXA 3CJRA 4OA5A 3R24A 4P7JA 1PJZA 1R18A 3CJTA 3LBYA 1KPGA 5DXJA 2PX5A 3TKYA 1Y8CA 2CKDA 2NXJA 5HIKA 2I7CA 1QAMA 1VIDA 2KW5A 2O05A 3HP7A 4GOMD 4C07A 3R9XB 2QYOA 2P8JA 5FWAA 2HWKA 1BKYA 4DM3A 4FT2A 3GCZA 2EX4A 2H00A 3CC8A 1Q0SA 4IV8A 4JXJA 4P7KA 1PRYA 2FPOA 1BHJA 1RJFA 3JWGA 3RIEA 3CVOA 4RTJA 3DMGA 3WSTA 2UYHA 4V0RA 3I64A 4ISCA 1RJEA 2ZTHA 3EVDA 2OYRA 5FQOA 1OR8A 2JJQA 4ER0A 3EEOA 2EJUA 4E2YA 4EKGA 3UJ9A 3DULA 2QY6A 3BWYA 5BW4A 3G7UA 2P3QA 1X1CA 3I53A 3P9CA 3JWJA 1XDZA 3GU3A 2C7RA 4EK9A 3L8DA 3DR5A 3EMBA 4A6EA 3P97A 5DPMA 2OPBA 4QTTB 4G56A 4IV0A 4RTKA 3K0BA 4PNEA 2R6ZA 3ANXA 4HH4A 4QDKA 2AZTA 1ZHFA 2BZGA 4GEKA 5FADA 1WZNA 1P1CA 4CKEA 4XCXA 1SQGA 5DWQA 1G60A 2AOWA 1QAQA 4M38A 3EVAA 3GGDA 2BR3A 3GRYA 3FUTA 4CTKA 1RJGA 2GLUA 4ZTBA 1SG9A 3HM2A 3TLJA 5K0EA 3UJ8A 1QANA 3KPJA 4R6WA 1NBIA 2PKWA 1DL5A 2OZVA 1FBNA 3LBFA 4PYQA 3PTAA 2ZLBA 1VP3A 2PXAA 2V7EA 5LQRA 3PX3A 4YUVA 2PT9A 2IDKA 4U7TB 5DT2A 3MHTA 3HNRA 5EC8A 1AQIA 1QYRA 3DLIA 3BKWA 2VP3A 2DPMA 3EVCA 1U2ZA 1NKVA 4AZSA 3TFWA 4EVIA 2WK1A 2C7PA 3NDIA 1ZQ9A 5EHGA 3SX0A 4EQZA 5GWXA 1M6YA 3PVCA 2NXEA 4AX8A 1KXZA 5KQRA 4OBXA 5BXYA 3FPHA 1SUSA 4RSRA 4O29A 1JG4A 2JHCA 3LDUA 3R0QA 4GOLD 4KDCA 4QPPA 4QQNA 5CVJA 4UOEA 5KS2A 5GIOE 5KVAA 1XVAA 2PSSA 3GDHA 5DXAA 3KR1A 5KQSA 3A27A 1G55A 2ESRA 3BGVA 3FPGA 2IGTA 3KR9A 5FWDA 5FHQA 3IYLW 1B42A 4H0NA 4MIKA 4ATNA 4GUAA 5D1NA 9MHTA 5DLYA 1I1NA 5EPEA 5HIJA 3G5TA 2GS9A 3C6KA 1IXKA 5HFJA 2EJTA 2YXLA 5EMKA 4E70A 2ONZA 2OO3A 3RODA 5GM2A 5ICGA 3OFJA 3M70A 5EG5A 4A6DA 4POOA 3UBTA 4ER7A 3AXTA 2PV0A 1YB2A 3KPVA 2CMGA 4MWZA 3GIWA 4OQEA 3SSNA 5CVUA 2PX4A 2FCAA 4Y2HA 5ICEA 3ER8A 2JH9A 3SR4A 4PYLA 3T7RA 4ER6A 3B3FA 2ZIEA 2AOTB 4HGZA 1O9GA 1R8YA 3PB3A 4R8RA 3EGVA 4E33A 3I9FA 5E2AA 2PXXA 2Y1XA 3G8BA 3HA7A 3VYWA 1FJXA 5E2BA 3U81A 8MHTA 3FUUA 2AOTA 3OFKA 4QPNA 4DKJA 4MHTA 1EQAA 2BR4A 3O31A 3FPJA 1VE3A 5HILA 4RTOA 3CCFA 3HEMA 4RTPA 3G89A 5EIWA 2P7HA 2GAFA 1BOOA 3A26A 3A25A 5LQJA 2YQZA 3FPEA 2A14A 4DQ0A 3NVKI 3LHDA 3KU1A 3KQQA 2IH4A 5E9QA 4RX1A 2P40A 3GRVA 4YUXA 4BP3A 3OE4A 4PYJA 4HTFB 4RTNA 4BY9E 4RWZA 1JTEA 4PGGA 2C7QA 3B89A 1KPHA 5GP1A 3UJCA 5K01A 2I62A 1XDUA 4PYMA 4GC9A 1RI1A 1ZGJA 3FYCA 3HVJA 5DM1A 4E32A 5DM4A 2AR0A 2EG5A 4DCMA 5U4XA 4RVHA 1NT2A 1UIRA 3CGGA 3MCTA 3HCEA 2VZ9A 2VDUE 4KW7A 1NBHA 2HV9A 3MTIA 3MAGA 2P3OA 2Z6UA 5C9ZA 3EVZA 5EKXA 2ZVJA 5IH3A 1KR5A 4Z2YA 1F38A 2AVDA 2JHPA 3EVGA 1NV8A 5DTQA 3BUSA 3EGIA 5B1SA 3A7DA 4U7PB 1I9GA 3GRRA 1KYZA 3HA3A 4PIPA 4M36A 4PCAA 2ONYA 4P7FA 1V39A 3G2PA 2I9KA 1JG2A 3TPZA 1NW6A 1ORHA 4HTFA 2QM3A 2NP7A 1R6AA 1JQ3A 3THRA 4RTQA 4HGYA 3CBGA 5LQUA 3LDGA 4FSXA 4PGHA 4YMHA 3SSMA 2ADMA 2G71A 4IKPA 5CCXA 4RTSA 5CIYA 3TRKA 2OY0A 2AN5A 3FUWA 3T7TA 4GF5A 4HSGA 4YV0A 4BLVA 1G6Q1 1VL5A 3DH0A 3K6RA 3FTFA 3P2EA 3VC1A 5DX1A 3S68A 4C08A 4ER3A 2PY6A 3ELYA 4HG2A 5DM2A 3C3PA 3KQOA 3P9KA 3NWEA 3KPUA 3CKKA 5ERGB 1ZGAA 4QTUB 4YV2A 2NP6A 4FSDA 5F2OA 3B5IA 1X1AA 1YUBA 2AVNA 2CMHA 2YVLA 4GBED 5K0GA 4PYOA 3DXXA 4GOND 1VPTA 1MJFA 3FRIA 3AWIA 3NJRA 3NVMB 4X60A 5EZSA 3UWPA 5HIMA 4F86A 3DP7A 5EMLA 4YUWA 2PVCA 4CTJA 4DMGA 3EMDA 4K6MA 3BXOA 2K4MA 1G38A 4F84A 3DMHA 2AOXA 2PX2A 2ZWVA 1XTPA 4GOOD 2IFTA 2PWYA 3EVEA 3FZGA 3SVZA 3FTDA 4FZVA 4XUCA 3ERCA 3OZTA 5CVDA 3A4TA 1G8SA 1RJDA 4KVZA 1JSXA 5LQNA 2G72A 2IH5A 5GM1A 3ELUA 1NW5A 1WXXA 3MTEA 5EOVA 3TR6A 1HNNA 2ZULA 4E2WA 5CCBA 1P91A 2B9EA 2G70A 3LCCA 5EZQA 2HTEA 3AXSA 1O54A 1YFJA 2QRVB 4PINA 4CWAA 4RTRA 2CL5A 1HMYA 2O57A 2WA1A 5JR3A 3OCJA 4KRGA 5DTRA 2XYRA 3M6UA 5EVJA 3T7SA 2AN3A 5EQJB 5BW5A 1P1BA 3P9IA 4BP1A 5LSAA 4OX9Y 2QE6A 5KYGA 2OB2A 2ORED 3MQ2A 1D2CA 3M4XA 3BWBA 2P35A 3KQVA 4M37A 4QDJA 3GO4A 5E8JA 4C03A 4EMSA 2AOUA 4ER5A 2IDJA 1SUIA 5T64A 1I4WA 3EVBA 3FTEA 3VSEA 5FTWA 5FUBA 2I6GA 3ID6C 4OBWA 3OE5A 5K0BA 1KYWA 3KR0A 3IEIA 2P7IA 1WXWA 3KR2A 4RVDA 1F3LA 3B3GA 3GWZA 3NWBA 1QZZA 4CKCA 3G2MA 5H02A 2Z6QA 5K0FA 4Y30A 1RI3A 3M6VA 2BH2A 1XCJA 3LECA 2H11A 3G88A 3MERA 2P3LA 1X19A 5CM2Z 3E23A 5F2KA 3TKAA 3UZUA 2AOUB 3EEYA 5DM0A 4E2XA 2JG3A 3ORHA 5IKMA 3UA3A 2Z6AA 2V74B 3IHTA 3D2LA 5CVEA 3E05A 2ZSUA 3GXOA 3TM5A 2FYTA 2PXCA 1AQJA 3KQTA 5FA8A 5K0JA 4LWPA 5E1DA 7MHTA 5GIPE 5E1MA 5DRYA 3O7WA 4KIGA 3P71T 3C0KA 3UJ6A 2QRVA 5K8VA 5GINE 2OKCA 2ZFUA 1X1BA 3HCCA 3DLCA 3SMQA 4PWYA 1ORIA 1FPQA 3M6WA 5ICFA 2AN4A 3P2IA 4L7VA 2XYVA 3FUVA 2PWPA 3OZRA 5HEKA 3UJBA 1JG3A 4E2ZA 4C05A 5FQNA 3NTVA 5DSTA 2ZW9A 1UFKA 2FK7A 3JWHA 1VP9A 4RTMA 2O0LA 4XUEA 4CXMA 3BWCA 2VDWA 2ZWAA 4MTLA 3KQSA 4IWNA 2DULA 3HCAA 2G8NA 3DXYA 2BM9A 3FYDA 2B3TA 2N47A 4PIMA 3BGIA 2IIPA 2NXNA 3KKZA 2NXCA 3HCFA 1DCTA 5DTMA 2ZZMA 3SXJA 3DXZA 3QOXA 5EHIA 2IBSA 2ZIFA 4RVFA 4OQDA 4P58A 2GB4A 3DTNA 5ICCA 1H1DA 1QAOA 3LKDA 4E31A 1NE2A 3UA4A 3P9NA 2F8LA 4RV9A 5E1OA 4DCGA 5HIIA 1ZG3A 2FHPA 3P8ZA 2OXTA 3A7EA 1JSZA 3ME5A 3DUWA 3P2KA 4PYKA 4EKIA 1INLA 1JG1A 1R00A 4X61A 3TM4A 1IM8A 3KQPA 1FP1D 1L3BA 2R3SA 4FP9A 5EKUA 3CJQA 3UJAA 4DF3A 1SQFA 3G5LA 4HC4A 5CD1A 2Q41A 3Q87B 5F2NA 1DUSA 1TPYA 2IP2A 2IH2A 1VLMA 3UFBA 5E9JA 2ERCA 5GOZA 3EPPA 2VDVE 2XYQA 3LCVB 2P41A 3T0IA 1RI2A 1P39A 3AJDA 5CUQA 1SKMA 2HR1A 3LGAA 2PJDA 1JQDA 4BLWA 4AZWA 5C0OE 2ZZKA 2FK8A 5E9WA 4KWCA 5G02A
chains in the Genus database with same CATH superfamily
3GJ4A 4F2DA 3IUYA 3B52X 1E98A 4P2GA 1OH8A 1IJKA 1CUSA 1FRVA 4FDVA 4JJ7A 4KJXA 3O83A 4PQRA 4FOLA 3ML1A 1L8QA 3P0HA 3TIXB 4D82A 4LTMA 2VL7A 2OBXA 5FHRA 4MRMB 4HWSA 2CEAA 1VPWA 2AR9A 2G5TA 2OORC 1NXXA 4K2AA 3CNQS 1HR0B 3LX6A 4KHZA 3ZEAA 4XEHA 1GNVA 4WY5A 5J2TF 1C4WA 4KZPA 1I13A 3IMKA 3P9RA 4Y18A 4IGIA 5CH8A 3VNSA 4EPXA 1JDNA 4NCIA 4Q9KA 1TJ3A 2GETA 3UAGA 1Z0FA 3GLUA 3FGPA 3SMVA 4WASA 1TJ5A 4S1OA 1JPVA 5BN5A 3FJYA 1Q57A 1JAIA 5K0TA 2A6PA 4EYKA 3KELA 3M4JA 4QRHA 3GRZA 2FMUA 3OIGA 3DKRA 1K0FA 4ZVOA 1X15A 4AXBA 3P7MA 4YMGA 2ENWA 3F97A 3GRUA 3VO9A 2ZUSA 2AW5A 3AEQB 4DV3B 1E3JA 4YAKA 2HDHA 5FH9A 1WHTB 1ACJA 2GM9A 3HZZA 5AUOB 2I7VA 3PWSA 3FVRA 4DA4A 3GJYA 2ZDHA 4X94A 1GAEO 4GSKA 4QX6A 2QGNA 1THZA 2W0MA 3IH5A 1ZM2A 4MX8A 4XCVA 5DTJA 1LZKA 4FFPA 4NG5A 5UKDA 1CJBA 1E9FA 1ECFA 4RYLA 2OD2A 3A36A 3N7AA 5DBFA 3B9RA 3FM9A 3KDPA 2C5GA 2VI5A 5K03A 1Q0TA 1SXJE 3K0CA 1DJOA 2W83A 4NG4A 3NAGA 3OU6A 3KZOA 1OPXA 4YHBA 2P6MA 1F2UB 3SEAA 1H4QA 2GQ0A 1BG6A 3ITDA 3Q3JB 2BCJQ 2UKDA 4RYDA 2GD2A 2JAHA 3H9BA 2F3UA 3L2OB 3QVTA 4LEIA 4YNBA 1D04A 3JARA 1A2QA 5AVZA 5KNDD 3PL5A 5ALIA 1RW4A 4JLMA 4WADA 4BVFA 4D99A 2IC5A 4UM5A 3KB1A 5IABA 3GOQA 4I4TF 2QRUA 3BHIA 4D1YA 2BHLA 1KVSA 4WESA 5BVHA 3R7FA 2E21A 3V80A 1GZ7A 1BX3A 2XSZA 3KUKA 1AN9A 1TEXA 2OC9A 4WSOA 2R85A 5FPTA 3W7VA 3UHAA 2A3RA 3KV3O 1WW8A 1DKPA 2G67A 4P7GA 4BE4A 4DIKA 2IGBA 1R4AA 2H18A 2CHVA 3I2IA 3U3RA 5EIAA 1NLMA 3GLHA 3IV9A 1PTJA 1SKYE 1W47A 4HDMB 5DLDA 4CV0A 1M83A 1R8XA 3AUSA 1I4EB 1LFAA 2OHVA 1YE3A 2YNMA 5JROA 3SLKA 2FZEA 4UBOA 4YAUA 4P3OA 2NN3C 1EVIA 1GZHB 1R64A 2Q1YA 3L7JA 4O5AA 3DTTA 4PZZA 4WLNA 3TI9A 3TOZA 5HOQA 3T9BA 1CQJA 3DW3X 4CQNA 5JCJA 4EY6A 4WV3A 2VBIA 1YGPA 4NU6A 3GGOA 3EQ9A 3T3EA 4MKXA 4FPXA 2QTAA 4HZUA 4YUXA 3PKIA 1W9HA 3DB1A 4XVUA 2UZ4A 4CCYB 3MTAA 4K7JA 5F1KA 2F62A 4JY7A 1MVNA 2AQKA 5BURA 1I30A 2CHQA 2EZ9A 3AEZA 4KMSA 5DN6A 4QZVA 1Q3TA 3KYIB 3AY3A 1D4OA 3KM0A 3LHKA 3G1UA 2ZIAA 5FCDA 3T52A 4BKOA 1BC5A 1U3GA 221PA 3AJ8A 3PHGA 3PFGA 4FYJA 3GJTA 2J9GA 1EIZA 5TMBA 3H9JA 3ZX5A 1LBEA 2HO4A 3NCHA 4II2A 4ONEA 1LI4A 2W8BB 1KTIA 3QPWA 4C4PA 1EYZA 3WTBA 4QU0A 3WGIA 1A9ZA 1WV1A 1K3FA 3TKYA 4HNQA 2OECA 3GT4A 1EFLA 1G8GA 1U90A 3BSFA 2JJ1A 5IKOA 4J0JA 4M1KA 2N0SA 3T0FA 5KEIA 2R1UA 1PZGA 3HUUA 4G01B 1MUUA 1XPJA 4MYRA 5JS2A 1FNMA 1BWRA 4PLTA 4B3HA 4DR5B 3EWNA 3U2QA 2CNLA 4AWBA 2PO7A 2W6CX 2GZDA 4E5PA 1JAYA 2JPDA 2VTVA 3DE1X 1M6WA 3H19A 5D00A 5F9MA 4YPFA 4WY2A 1Y3IA 5ABPA 2IPLA 2JFGA 4L02A 3S8YA 4UHKA 3STWA 2QTLA 4JLOA 2WICA 1XZDA 3I1JA 5FUQA 3WKCA 4MSUA 5FUVA 5T3YA 3TSYA 4PZ9A 4JGXA 2ZT5A 3NS7A 1TC2A 4L76A 1KI9A 1J1IA 1XJWA 4M53A 4OQ4A 3UFXA 3SYTA 3I8OA 4MPJA 2Q4RA 1RJFA 2VHTA 5K0SA 2I2FA 3QKRB 5DYTA 3PCRB 3GMSA 2UYHA 3C3EA 1T34A 4ZVMA 1RJEA 2XGMA 4ITRC 4CF7A 2IOFA 2V7WA 3CVYA 3LPCA 2EJUA 4R69A 1NURA 3EDMA 3ROFA 9LDBA 3GEMA 3GBSA 3ZQUA 1O89A 2EP8A 2W6QA 2OSVA 4UCQA 1UFQA 4COKA 4EW1A 2C7RA 3BIOA 3L8DA 3NOOA 2VBCA 3DR5A 4H1TA 3TD9A 3MXTA 3P97A 4GL4A 3VFDA 2G7ZA 4IZOA 4PC2A 2PD6A 1YC2A 4HH4A 5T5QA 3P5BA 4UU0A 2AZTA 4B45A 5DYNA 5IBCA 1WZNA 2P6RA 2YYZA 3IBFA 1B6RA 4I3GA 2XDQA 3DPUA 1C7FA 1DKNA 2X1VA 1H4TA 1R12A 2VQ6A 4TMTA 3TECE 1EM8A 3BULA 3RT1A 1QRUA 4IXWA 5COQA 4ETMA 5AHOA 1HETA 1HPLA 1PJBA 1U8CB 2B2NA 3D6MA 3PJDA 3CUWA 1OXUA 1T1EA 4G5YA 2RHRA 1FLAA 1PBTA 1FK8A 3DYBA 2CZQA 2Z5FA 4Y2PA 2A78A 4F04A 4GGPA 4DJDC 4DJFC 3I9V6 1J90A 1XR3A 3RRFA 1F2VA 1QYRA 2ZR8A 3LL4A 5KTPA 4XVRA 1ITZA 2QE7D 4OMUA 4YRLA 2E37A 1U2ZA 1VTKA 3EZYA 1DKLA 4JJ6A 1KI4A 4Y6PA 5ALVA 3L02A 4DQUA 4RZHA 1YULA 5CTJA 1YIAA 4RMIA 3D6HA 1PFQA 3MELA 5BXYA 3WGLA 2YMMA 1XTBA 3HB9A 4AXHA 3STHA 3R0QA 4X7MA 3BRQA 1B4DA 2VF5X 3CEHA 5H5JA 1FFCA 5KVAA 4DA0A 2OD9A 2IS2A 1KAGA 2HYDA 4OXQA 4AJLA 1QIMA 1M73E 3DV0B 4RANA 1GA6A 4ZXFA 5TV2A 1MGPA 4FEAA 2BMEA 1WUJS 1JMVA 1KI7A 2POQX 4YRMA 2DBRA 4B3TB 1VG1A 3NBQA 5TT1A 1C9JA 1P1FA 5EMKA 2DG2A 3NBXX 4K88A 5LP6A 5TE9A 3BK1A 3O8DA 1J4AA 2CE7A 1CYDA 1DQRA 3R0ZA 4IF4A 4WGFA 2HO5A 2ZVPX 5JMTA 3AXTA 4L16A 3ZIUA 3Q9SA 2PV7A 1I33A 3A3KA 5FB3A 1XEWX 3L7LA 1XXHE 3BIJA 4WEQA 3WB0A 4JBYA 4DNFA 5JRJA 2YRWA 4EUSA 1X3SA 3AEUB 3Q9LA 4ITVA 1AHIA 1MP0A 1C7EA 4RGYA 3I9FA 4WWHA 4D4IA 3E70C 1AZWA 4GEGA 3W34A 2JIOA 1XLWA 1PT7A 1ZD2P 4E6PA 4KRFA 4N7BA 3TUZC 1XJ0A 2IUSA 5HRUA 3SLGA 1FCJA 1J00A 1ODJA 3KS9A 4EYEA 4Y1GA 1WB6A 4EHKA 2IUFA 3ELBA 3HCNA 1WMAA 3VJLA 2P9TA 3ZWWA 1IWOA 3OOEA 3W4KA 3OT5A 1P9RA 3E03A 4N0DA 3IUMA 1QBGA 2ZT8A 1ZBDA 3PE6A 3UOWA 4MW1A 3P4XA 3V8EA 3UJHA 4IP0A 3R9KA 4ZREA 3AM4A 4LYEA 4BO2A 2IV2X 4R31A 1NI4B 1HE4A 3EIEA 1V7CA 3SHVA 4DCMA 3F9RA 2J4FA 1NY6A 5KTNA 1QVWA 3NO4A 4Q5IA 3NT4A 2VZ9A 1CCWA 4Q24A 1PWZA 7YASA 4OP3A 4Q9NA 3H11A 3MJDA 3X43A 1KORA 1YDMA 3C6ZA 5AJTA 3WGMA 3NAQA 4CLRB 5IDWA 2VDNB 3ZD6A 1T2UA 4IHJA 2YDYA 4QTZA 1LW6E 5CPBA 1XMJA 4WBSA 5B1SA 5L4NA 1DRKA 1XF1A 1ZS9A 4QU5A 5DE3A 5T8KA 4I4NA 5IANA 5DW0A 2ONYA 3N0RA 4EX6A 4M1TA 2MU1A 4DIMA 4DLNA 5JBIA 1HQYE 4HGYA 3QEMA 1GCOA 4KGXA 3Q6NA 3IIIA 3AVQA 3MRVA 2QLLA 2ZI5A 2VP5A 2WVJA 4YRCA 4GL2A 5CCXA 5ILOA 4Q0MA 3KSUA 1E3IA 1S2DA 1O97D 2XZTA 4YAWA 3MFYA 3TTSA 3WWZA 1FDVA 3W3AD 2ZRNA 2ECOA 4MUJA 2R6FA 3IVCA 4DEXA 2IUTA 3OF3A 2HNAA 4GPBA 4AN0A 5ILGA 2W71A 4XJXA 3AYXB 4XYLA 3OG9A 1FNSA 1VDMA 4QTUB 5CK4A 4FSDA 3D8TA 3HCOA 1BE1A 1RKXA 4GZ5A 3GLVA 2FRDA 3EF0A 1OXMA 1M7BA 3KSMA 5EXTA 3T7AA 5BSWA 1LPNA 3ACBA 4C5CA 4I50B 4BCDA 3DZFA 3QE9Y 4GMGA 4DLAA 4Q4CA 2XYGA 5ARBA 3WLOA 1H6CA 1HSZA 1T2NA 2QAGC 4LRXA 3ZNQA 4J1TC 2CNWD 3DMHA 3D5TA 3IDZA 4M1SA 1ZVQA 1GR0A 1EVEA 2R6GA 3RWBA 5I8PA 2CDAA 3CKMA 3EVEA 2UXCB 3U49A 3IELA 2YWCA 1G8SA 1S2LA 4LCJA 1D1PA 1T36B 1I2DA 1UPCA 4KUEA 2H2GA 2C1ZA 2C04A 3AHIA 3HGQA 4XDHA 5FLEX 5G1OA 1PEDA 4B80A 3H1AA 1ECGA 4D3YA 3K35A 3AL2A 3AZQA 1BQEA 3NT2A 3I6ZA 3N07A 3NTLA 4LJAA 1GRVA 2Q5OA 2JFWA 1E58A 3OD1A 4FQ5A 5H59A 5A1TA 1ZISA 3FWPA 1D1TA 4RLSA 1UBEA 1WEHA 2RJOA 3BWBA 1YQTA 3MJRA 4HNRA 4BVHA 1QTQA 1QWSA 1P7WA 4BN5A 2FX3A 1U0RA 3BKSA 1ZUNA 4DSTA 2I0FA 3ETEA 1FQOA 1UXHA 3LW8A 3D0OA 4X1YB 5SY9A 3T4PA 2V5VA 4ENTA 4F92B 1A96A 4AECA 2GYVA 4OJTA 2G9QA 2ZEJA 3UWMA 2AKEA 2Y0BA 8LDHA 2HRCA 3ENQA 5H02A 1VJ5A 4JL5A 1RXSA 1J2EA 1C7JA 2NZUG 2RGNC 4TKVB 3WOHA 3WLEA 2FJPA 4WHMA 1KQFA 4O3MA 2Q4DA 1K7EB 1YDWA 2FYTA 2QLBA 4JJKA 4NFSA 5HM6A 2CVHA 5JYCA 4I19A 1N1MA 1OCEA 4EGCB 1G21B 4WN9B 5TQVA 1KI6A 5ELXA 7MHTA 2VJKA 3JD2A 4QPDA 2I6QA 3MUFA 1YQXA 3UK6A 3C3BA 1W46A 4TMXA 1T91A 3OJFA 3PCTA 3PUKA 2IDZA 4E15A 5B3JC 1XTRA 2FMXA 4BJ1A 4N40A 3UJBA 3E35A 1T5IA 3H0EA 4GI1A 2I3AA 5JYBA 3IKMB 4PW0A 2AF4C 1DE0A 4DL9A 3TW8A 1KYIA 2AUMA 1BAPA 1FS6A 1JLLA 3BL8A 3KQSA 4FJ2A 4LI0A 4LYFA 3T9AA 3TWOA 1E1DA 1NI3A 2DC1A 3H7AA 3W6PA 4X85A 2YW2A 2ZB8A 4WDRA 3K05A 1WXEA 9ABPA 1KYQA 2H8KA 1ODTC 1GUDA 3GUUA 3EEFA 4EB3A 2QUAA 3OPXA 2NZVG 4C3OB 4XWWA 1NHWA 1OROA 2V45A 3QOXA 5EHIA 3RYIA 3VZQA 2ZM5A 1POWA 3LF1A 4F7WA 1FW6A 2C20A 2Q4OA 3IPLA 4XLZA 5IF3A 2GUGA 3AHFA 4FGUA 5FPQA 4E12A 1HG1A 1U8TA 3C1OA 3D02A 3I01A 2GRAA 3N76A 4NE9A 4GOKA 4MPDA 5KBYA 3MZ0A 3AVTA 5JQGB 1D6NA 1GN9A 2HRQA 2QAIA 3IE0A 1KOFA 2BGJA 4KWHA 2G6BA 4KTVE 4WOPA 1AK9A 1WUHS 5TMDA 1RAEA 2IYLD 3AINA 1A9XB 4G24A 3VYTB 1Q20A 4H4EA 3WGZA 1G3RA 4E4TA 3D3WA 5MGNA 2BRUA 1KEWA 3EH2A 3IHWA 3RADC 4AL4A 3MQ4A 5JJLA 2Q41A 1QV6A 1TPYA 1SAYA 2JGRA 4DV6B 4P22A 3WY9A 4ENVA 1W9MA 2OO7A 1A9OA 3LCVB 2NO1A 3WSWA 3E7FA 4Q4JB 3OCWA 2XMRA 4BLWA 4EZIA 1NQ5A 1TL7C 3CZAA 3OHMA 4PLHA 3F67A 4ND8B 1ZIXA 4KXMA 4QHTA 2YNMD 3PPIA 1I3LA 4Z7QB 1GUFA 1W4LA 4MWTA 3ZE6A 2E5LB 1R74A 3EQ7A 1S2IA 3GB9A 1MAAA 4TTSA 1KSJA 1H3EA 2G9UA 4CQMD 3OPQA 3L5KA 5H0IA 2B36A 3QA9A 5BO5A 1YRHA 2AG0A 5J2UA 2Q5IA 4LNUA 2DCUA 2Q5CA 3HKDA 5WRFA 2Q9AA 3HY3A 5FUXA 4F2HA 1QRDA 5EJ5A 5CTAA 1OYVA 5FUMA 2PUDA 1QR6A 1CKEA 2OLEA 2WPDA 2Y71A 4PLVA 3DKPA 4V0SA 4D2IA 5JDIC 3EIOA 4OHXA 2JFNA 1V35A 2WFMA 2ORIA 1TK3A 1NNEA 3K73O 1F9EA 2F17A 3A11A 4MYDA 2VEDA 1Z5WA 4PX5A 4HKTA 2QL9A 3FF4A 4HXGA 2UXDB 1J22A 4GQAA 3KL2A 3F4KA 1YFLA 3CE9A 5DKFA 2PD4A 1RMYA 3UATA 4CM4A 1WMDA 2UYQA 4C0XA 4G81A 1XZLA 4KXFB 1Z5OA 3EB9A 4HXYA 1GUAA 3G2IA 4KPUA 3VYRB 5KSZA 3VKVA 2JJ2A 2NV0A 4DAEA 3A05A 4M9UA 4NECA 5FI1B 4TVBA 3C3XA 4Q7EA 1GGHA 2EQAA 1MAUA 1UH5A 2XWQA 3FGOA 4TWRA 1CS0A 1JHAA 4MROA 2WTEA 5G41A 5GONA 4BQRA 1GFWA 1M7HA 4JD5A 2ZB3A 3T3DA 2W6PA 4G4JA 1XN4A 5JCOC 2H48A 2JK1A 1WKVA 3HZOA 3FUXA 3EZ9A 4K6GA 2Z9BA 2F1IA 1Y7TA 1DC8A 1U2QA 4XFDA 3UB2A 5TQ2A 1AHPA 4Q3NA 2CXPA 2P1DA 3SQXA 1YZTA 2FPLA 2C57A 2FP4A 4JLJA 2PIAA 2WWYA 3OECA 4CHGA 5LWHA 2AZ4A 4GPZA 3W5HA 1VJCA 5D3KA 2NUAB 1LDMA 4ENQA 1VSBA 1S8AA 2FAXA 4KSBA 1TTPB 3FF1A 1OSNA 2CZCA 1F12A 1PD0A 2PSEA 5BWNA 4FFBA 1N7IA 3Q5GA 3UJDA 1DAIA 2RK4A 3LI2A 5EGSA 5KOIA 1T5OA 1USUA 1XDDA 5THXA 3ORYA 4PHHA 1GG9A 4IFTA 4G5FA 1BJKA 3O8OA 2PMEA 4P3YA 3UXEA 3DQZA 4Z51A 3KQUA 4HLNA 1EUCA 4JQZA 4R81A 4CF4A 1UBSB 4UDYX 2NAPA 3K4QA 3NHSA 2UVPA 1IZ8A 4ZIRA 1UBCA 3VH4A 3DCYA 3N8NA 4XE5A 3CTMA 1RIIA 1DOZA 3FYUB 2JEOA 2QN2A 4G41A 1TW2A 3TTVA 1Z5GA 1F20A 2I54A 2JRLA 3E9EA 3KQWA 3OFND 1MEJA 5CFQA 2V65A 2UVDA 1Q1BA 3X1DA 1N7JA 3AESB 4Z0HO 3U9TA 1JNXX 5JVDB 2YTZA 1Q3KA 3WWEA 3S2FA 2CLCX 1CS4C 2A0WA 4IDDA 4RS4A 2P2DA 4IJ5A 3WADA 3MCZA 3I9MA 5ALNA 1VHJA 1J09A 2QV0A 3JXEA 2ODAA 2BM1A 1GSOA 1QJ4A 2P3SA 4DLUA 4GMDA 4J1QA 4LC9A 4WEOA 1NXPA 3VNRA 1E6KA 4DVJA 3PHBE 1QX4A 5IM4F 4O63O 4IBOA 3O1HB 3PFCA 4PYNA 3HTXA 1OFUX 1SKYB 4F4FA 1S3SA 1N9KA 2BMAA 2PM8A 2UUOA 2ZUBA 1Q77A 3DBVO 4P86A 3L8MA 2FPPB 4ROSA 5EQDA 2Z30A 1JILA 3KQNA 3EW7A 4NKRA 2VSXA 3M4NA 3TGLA 4FM9A 4GX1A 1C1YA 3DG9A 4PNHA 3VTZA 3O93A 5EYPA 2G1PA 4KDRA 4CL0A 1RLUA 3LDAA 2Q0XA 3PC4A 3QA3E 4E21A 4RKYA 1R0ZA 2O2HA 2YIDA 3NW9A 4U6NA 4J43A 3BJEA 1T3SA 5DSXA 1P3Y1 3WLRA 2ZJFA 4A8JB 1SB9A 1ZD5A 4F6RA 1A76A 2OEPA 3PIDA 1ID1A 3TRIA 1OC2A 4ALKA 3CLSC 5HWSA 2IUYA 4P3KA 1EHIA 2HWXA 3KSZO 5D6OA 1Y63A 1IQPA 3PEVA 2I3ZA 2D1SA 2P2YA 5IJXA 5KCMA 3PR3A 4EFDA 4TWAA 2CDBA 5CT4A 4DEVA 1WA5A 2CKDA 4IHKA 2G1JA 1MG0A 1MA3A 3KE9A 3E3MA 2KW5A 4OKNA 4YJHB 1GKUB 1QRRA 2B8EA 2ZJ8A 4JBHA 5A9TA 3FCYA 1PTJC 3D4OA 4M8IA 4C07A 4JDUA 4FB4A 1HI9A 2OAEA 3FSRA 4O4HA 5BSFA 5HRCA 2HV8A 4JLDA 4QBKA 3JWGA 1F14A 2CF6A 2X14A 1FFDA 4S2UA 2JHFA 2NGRA 1U2PA 3U44A 1P1HA 1B6GA 3OZBA 4JLUA 4K6KA 2GMWA 5IYZA 1N3YA 1QWOA 2GUWA 2WT4A 4ODIA 3QG1A 3R3JA 4Y9SA 1E9RA 1ZOIA 1CUVA 5AKHA 5LCXA 3OM8A 3VTFA 2QZSA 4L0QA 1RHUA 4QVIA 1US8A 2EGUA 1XOIA 4G5QA 5J23A 3QU5A 4O4LB 5CURA 3WLPA 2YNMC 4HDAA 4O4HB 4Q37A 1BU5A 2R7MA 1L5HA 1OX4A 4QTTB 4Z5XA 2R6ZA 3ANXA 3FSEA 4RXTA 4EUHA 4CKEA 2VUUA 2NG1A 3JATB 5JZVA 5KSOA 1ETHA 1RAHA 1ZCBA 5BWCA 4Z2AA 4RL6A 4ZZ1A 2R86A 3JQGB 2QAGB 1L7XA 3RUAA 2ZJ6A 3K8QA 3TI7A 4ZDWA 3FVTA 1T35A 4REQA 4EUFA 1SG9A 3OHSX 3TCKA 3KPJA 3PHJA 4R6WA 4IILA 4MZDA 4AJPA 5BWOA 5LQDA 1IZZA 2OBBA 3OZEA 1YR8A 3EPJA 1ZGZA 4KQ9A 1I14A 2ZLBA 1XMPA 4KOAA 4OL9A 4WOBA 2RHDA 5LLTA 1AJEA 3M83A 4EB6B 2W0SA 3CIFA 2EAUA 1KKUA 2YINC 3LO5A 2P9EA 3B6JA 2WQ7A 1ZK2A 4MDYA 1GHTA 1L4GA 3DLIA 2AYZA 4KQFA 3AP1A 3DO5A 3E9CA 5A9SB 1W30A 3PXBA 1A8HA 2DBZA 3VX3A 2V3CC 5A4IS 1MC5A 4WLOA 3IP8A 1TK9A 1Z68A 1YB7A 4IVPA 4LE0A 3TRJA 2ZVQX 5DXFA 5ER6A 1Z8DA 4CLRA 5JCZA 4WCFA 1Q1QA 1WBJB 2E85A 3TZ6A 3MJFA 1MW9X 2B34A 4UM7A 3ZHCA 5I48A 2OCGA 1NI4A 3PXUA 5GMOA 3EA4A 4URXR 3KR9A 2XGJA 5LU9A 3HB1A 2EL9A 4IIEA 1P73A 2FI1A 3ASYA 5ITSA 3P2JA 3TD6A 1TKRA 3H5VA 3W9YA 3C6KA 4R8LA 1GRCA 3RIHA 4K87A 4CEHB 2VCYA 1WQ4A 2ONZA 3R4VA 4LJLA 4OMFG 1H4VB 1QFJA 4NCBA 2XTMA 2PGDA 5EG5A 5IRCD 3MCVA 3ZWAA 5JALA 5ITWA 3FXAA 1WHSA 4HJRA 4O3FA 1RR6A 4PPFA 4M0KA 2Q5LA 1RVV1 4Y1EA 3RIXA 2O3JA 2VHEA 3EFOA 3FNEA 3GAFA 4JUIA 2IU4A 2IY9A 3JASB 5E2IA 4E2FA 4PYLA 2D2XA 1Q92A 4CMGA 3H4TA 1C8BA 4DUZB 4NYMQ 3B3FA 4N4AA 3DKKA 3D4NA 4CIXA 5E2AA 4J4BA 4R2IA 2ZUTA 3WC4A 1AO0A 1XCBA 1A4XA 2YIVX 3IAEA 1NRJB 3AEUA 3OFKA 3SC6A 4BNYA 2CXUA 4CM4B 3V7WA 1FW8A 2GAFA 3LCJA 2GRUA 1PJ2A 3A26A 3A58B 3D4PA 3A25A 2QQGA 2A9JA 2VAXA 3LQ4A 5L7YA 4UJ3A 4EKDA 2B4RO 2O19A 2C9OA 5K3FA 2QN8A 3AR4A 3AVPA 4RIGA 3W1EA 3GJ3A 1UIMA 4D3DA 1VHWA 4RH0A 4MVJF 1W36C 1DUIA 1UJ2A 5DGDA 4DAOA 1V25A 1SVKA 3P1JA 2FCRA 1ESNA 1I5EA 1AKVA 2XD4A 1NR5A 4U00A 3RS3A 3ZJVA 1XHFA 1YOVA 2D59A 4ZOAA 4M9RA 2PX3A 3OFSA 4ZVVA 1QVZA 1COWD 1G5PA 1YHNA 2XNHA 2DTEA 3CLTD 5DULA 4O4IB 1QP4A 2HBRA 2PLRA 3M4ZA 3QY9A 2QLNA 4H6XA 1QP8A 3BMQB 2J0UB 1KR5A 4A0SA 3B2NA 4DLYA 2JHPA 2PFGA 3O2JA 1EK0A 1N2SA 2HEGA 2ZYHA 3QU2A 4JC8A 3VR6H 2NU7A 2Y68A 4N54A 3TXYA 4GX0A 1RXWA 5E6RA 4U9HS 1JFVA 2J5XA 3HU2A 1T9KA 1E2UA 3KUUA 3V3KA 5JYEA 4I1VA 4M36A 4N18A 5T7BA 1FYWA 1EWVA 1FYXA 2NO7A 5TF4A 1BW9B 4YT4A 3L0PA 4W9MC 5FEMA 3RREA 4YRRA 5TF0A 4YMHA 4CNBA 4LYAA 3OOHA 6ADHA 4ZY7A 5F9FA 2AN5A 2PJUA 3V1LA 1UQRA 4Q3OA 2AT1A 3MRTA 5KOHA 4JS0A 1D8TA 2GLXA 3B8EA 3RVDA 2BEVB 3WIDA 1N2BA 3GIDA 4C7MA 3TEFA 3RJ9A 3AOEC 3C3PA 2X76A 4M1EA 1IK6A 4BYGA 4EJSC 3AG6A 1OZAA 2PA0A 4E11A 1GARA 2Q8PA 3HWX1 4QXAA 1L1FA 5C8ZA 1V5IA 3DE5X 5DCLA 1WW2A 4DRXA 1NUHA 1CULC 4JEHA 1QOPB 3EYAA 1RZVA 1ZK4A 2ATCA 4MRRA 2D2VA 4FJ1A 3WMFA 4CEIB 2QXTA 3L7MA 1IHPA 4BB0A 3I72A 4QL3A 5BR4A 4W5RA 2PX2A 2C78A 1XU9A 4EFNA 4UBNA 1C8LA 1ZKMA 3B9QA 3QXXA 4D26A 4DIDA 2Y99A 2DJ5A 3OZTA 4RNCA 1OASA 4AY4A 1JKFA 1F8GA 1FDUA 4OO3A 3MTEA 3PA6A 2AFIB 1A0OA 2ZBGA 5A0TA 1IHOA 1YRAA 1FFYA 3ESYA 2WUDA 3LCCA 3A10A 4Q00A 4AMYA 2BRUC 1C9MA 4QFBA 5DM60 1VCHA 1MNAA 4KRGA 3EC1A 1GWNA 1P6UA 1TVKA 2TECE 4MLDA 4XX1A 4TGLA 3WJAA 3ECCA 3R3VA 3EJ6A 4IL5A 4UQPA 1QFMA 3WBFA 2YS6A 5E8JA 4ER5A 1FFBA 1GZUA 2BLNA 4BV9A 1RC8A 5T64A 2JFFA 4HAVA 3N5CA 4JXKA 2EFYA 3ID6C 3IOCA 3HY4A 2WJHA 3R1KA 5IJAA 3U48A 1TNDA 2O8CB 1DB3A 4P92A 2IU3A 1CDEA 2Z6QA 2QB5A 3CR8A 4GBJA 4OK5A 3QLVA 1QGOA 1XCJA 2RKOA 3EDRA 1VE7A 2ZCUA 3TSCA 1U6JA 3GDOA 3ICVA 3H16A 2Q7DA 2VDKB 4M99A 1DU4A 1WU8A 4L5JA 5EXDA 3KQTA 4YWJA 3IXQA 5ELMA 2JAPA 2VRCA 4RMGA 4W5HA 1M33A 4L6CA 3ZG6A 1G16A 3U4MA 4FFSA 5ALPA 1NJFA 3R7NA 4A8JC 4B33A 4OI4A 3VNVA 1GUBA 3PDJA 4CKEB 1DQZA 2RHOA 1LH0A 1XYYA 1JIXA 1TUEA 1X1BA 4RPJA 1HOTA 1YNSA 1PEAA 3A3OA 4FMCB 3T7CA 5HEKA 3TE7A 3F8WA 3L92A 1SY7A 1XZQA 4JBGA 3BSWA 3MWLA 5CAEA 4ETIA 1U2DC 1UFKA 3JWHA 4QOGA 5TC4A 4GXQA 4R2WA 4X1YA 2IYUA 2N1BA 3HBFA 3TLGA 1ULTA 5DHRA 3V1KA 4XPIB 1ZEJA 2EYQA 4OREX 1L5YA 1OYWA 3KOOA 2OHFA 4PIMA 4RD6A 1PTKA 1EQ2A 2GZMA 5JZ9A 1P4RA 4ZTZB 1XDBA 2YJ4A 1CY2A 5L53A 1K88A 1E6UA 5BMVF 1VRVA 4RCVA 3I4FA 2QTFA 1ZOPA 1QAOA 4YALA 4YJHA 4OUDA 3MLBA 2E4VA 1UP4A 3WBKA 2A5JA 1KJQA 3OLXA 3RABA 4RJLA 1MF7A 1I94B 3G9XA 2XUJA 1GPBA 2IWRA 1B14A 5KI6A 3DEAA 3WGUA 2Z3ZA 3L40A 4I36A 4JMPA 4LSZA 4E7PA 4CDGA 4YAGA 5L3SA 3EEBA 1TZBA 1IEXA 2R3SA 3RAEC 3Q98A 3IAFA 1Y6FA 3EG9A 3S7ZA 1I7QB 3WLTA 1CVIA 1TYDE 3WR5A 3AUFA 1V5FA 5AM0A 4RZXA 4KX3A 1KK1A 1QGZA 4AS2A 3BDIA 3L77A 2P5TB 3LGAA 4JH0A 4C0HA 1ZDMA 1WPGA 2A2ZA 2ZZKA 5EZ5A 1S8OA 2IOHA 4DMFA 3QHPA 2BFAA 2AWNA 2O48X 5E3HA 1FTSA 1WIWA 4LHVA 3RNOA 1N5IA 1CB7A 3CSUA 4MQ6A 2IWHA 1JUDA 3H11B 1IQ0A 5HBRA 1TO2E 2H54A 3KTDA 2Z95A 2VJQA 2H1WA 3R20A 4D3ZA 3TEMA 4HAOA 1IEVA 1MNQA 4M0UA 1BH2A 4HQKA 3ZHXA 3A6DA 3EYWA 4ZQIA 3PUIA 3FYUC 3PUWA 3KQHA 1SIWA 3P26A 2YUTA 1L5OA 2Z83A 3PJFA 1R27A 1I2AA 4Z1OA 1T8SA 2H2IA 5CR9A 4LOLA 4CGZA 4MVCA 4TWJA 2JCYA 1EJ0A 4NZOA 1XRLA 2PH7A 4C0BA 2IPAB 3FW1A 1HDRA 1EX7A 3CZ5A 4W5JA 5E8RA 3RJ5A 3ZHTA 1Z3CA 1UC4B 3TZQA 3VPXA 4WECA 2QTWB 3ABQB 3PUYA 4RLHA 4DA6A 4X7BA 5EIBD 3AF6A 3B1VA 3NUGA 3O8QA 3HFSA 4N7RA 4LCBA 3M3DA 2QQ5A 2XF8A 4BDTA 3FKSD 3DMRA 3CO5A 5GZ6A 1GNTA 1K4KA 1J0EA 5I47A 3MPUA 4TN1A 2EKDA 1SOVA 3GFSA 2QR5A 3EGCA 3OUUA 1P31A 1JB1A 3C2QA 4LA4A 5LQKA 1DCKA 1W1WA 4I5IA 1JZTA 1GPUA 3WJ2A 3H6HA 4UXJA 1AS0A 4DSAA 2GCEA 2CFOA 3L0BA 2B1IA 5BXQC 5AVTA 4GYWA 3QSYA 1SUEA 1K8QA 4ZQCB 1QNLA 3SFVA 3HVUA 1TGVA 4PAQA 4C1NA 1T0PA 4F4HA 2MTBA 1V9CA 3JASA 4M8LA 3E9QA 4N6NA 4BQEA 3WA6A 3I2FA 1EWYA 1JEQB 2PL5A 2VJMA 4OQPA 5D3MA 2HT1A 3CNBA 4BL5A 3D4BA 3RJTA 4AZTA 2R5NA 1NVMB 1PU2A 3FNGA 3IA7A 3PNLA 4UFNA 1P5HA 4MV0A 5DGIA 5BOSB 1GLNA 1HT0A 2QD2A 2PSDA 3ZHBA 5B1IA 1M2EA 1TUBB 1V1JA 1XHLA 4X62B 3RQIA 3NHZA 3PT9A 3IURA 4LF6B 1C30B 5DBEX 4BQIA 5HTKA 5I5EA 1ACLA 4DE5A 2ZI4A 5C81A 1DRJA 4BO4A 3JWEA 2TMDA 3ADCA 3B6ZA 1B2RA 1WZEA 4EL5A 4IH9A 1P9NA 2NOAA 2ZANA 3AFHA 3K16A 4IKEA 1BXGA 4JODA 2FTKE 3KTAB 1WMSA 3TQQA 4K3UA 3LWDA 4TV8F 1AKMA 4IZHA 4A36A 2XOEA 2R4UA 4LOAA 2BFBB 4GI3A 1OXTA 3MMPA 1FP2A 4NBRA 2Q9CA 1U8UA 3JD0A 3U3ZA 4CQMB 4NBTA 3W1WA 2CBGA 2XVZA 3E7DA 3T15A 2FN4A 2OM6A 4EW3A 2J08A 1FSSA 2XODA 1Y8ZA 1EB8A 4UXHA 4RK1A 4QSHA 5BSMA 1JIIA 1RZRD 1BGXT 1T0UA 2WHPA 4ZHSA 3B85A 4OA8A 3LKBA 3SJAA 3V00A 4E22A 2NADA 4HYTA 3FR8A 3JAWA 5E6SA 8AT1A 4B84A 1X8KA 2DQ4A 1X7ZA 3IKVA 1C29B 1Y34E 2JGKA 3AR6A 4FGZA 3BREA 3FTNA 4ZAGA 5KNLA 4M1YA 5L95A 4XM1A 2HWWA 5AK6A 1RYMA 3PDHA 3UBMA 2RJ3A 4MRSA 4UCXA 5BSKA 4ON9A 5EFZA 3UWOA 1YVDA 2XTJA 3DDZX 3D3JA 4JP5A 3PFWO 2VPXA 3K2EA 3MB5A 2BONA 3HRKA 3SF8B 1YBHA 3RARA 4YUYA 3IS3A 2RIRA 1TM5E 2CD7A 3ZS8A 1MX3A 1JIQA 2B0JA 4B3JA 5CITA 2HIGA 1GLVA 1T9ZA 3IAAA 1G4UR 2ZCVA 1UAGA 2FV8A 4Q15A 1BIFA 2GLTA 1DV1A 1ODFA 4HAXA 5BQXA 1JG6A 2O52A 4Y0NA 4MCJA 1ZKDA 2I3BA 3DL7A 3RRMA 2YFKA 2ZI9A 1VB3A 1ZK0A 3ZE7A 4J0HA 4IIJF 4CZ2A 3GLGA 1Z8NA 1HE5A 2YMLA 2G9NA 1TW3A 1UPFA 3EC2A 3WKAA 3HABA 4R3UC 3A04A 3NOXA 4GT1A 1JJAA 2NU6B 4P7JA 2I4OA 4DSNA 4EMTA 4BFSA 3UW3A 2J3EA 3CZPA 2FR0A 1VG9B 3RG2A 1M10A 2I65A 2PX5A 4C7JA 4MUEA 2ZROA 4GOMD 4R54A 2D0OB 3WQHA 1JJVA 1WW3A 3V48A 2YVUA 2CHFA 3MOSA 1WNTA 1Q0SA 2B8NA 3D7LA 4YLGA 4M0EA 3B3AA 2R8EA 3ZY2A 1TZ2A 1SBCA 3BS4A 3DMGA 2QU7A 3F7NA 3KAPA 3WBJA 4RTJA 4ZKEA 3V4LA 2C96A 4CM9A 5H9WA 1K2VN 2YZNA 3GLFE 2X19A 3DULA 1L4MA 1GQSA 1KXJA 3VDMA 3RS0A 3K1AB 1ENOA 3KKMA 3P52A 4F21A 1O96A 4A6EA 3OFNA 3HB7A 3UK7A 4P4TA 1A4RA 1ZHFA 3KNZA 1RQRA 1YA4A 1SXQA 4IQ0A 5DWQA 3CUYA 2QN9A 4J7UA 5IJWA 1G8PA 5D51S 5T41A 1CF4A 1ZA1A 2IT1A 3EE6A 3UC5A 3LP8A 4M38A 3O73A 4JN6B 3GGDA 4MQLA 4O08A 4XYBA 1SD5A 1Y80A 2BR3A 5T6MA 1W4BA 2DE0X 1QO9A 2PKYX 2INGX 4YP9A 5KWIA 4DB2A 3PT5A 4ESVA 5JVDF 2WVAA 2IZ5A 2VRWA 3KFXA 3C4JA 3UJPA 3WIEA 2ST1A 3L1KA 1P0MA 3PUJA 2GNAA 2HLDD 3E3OA 3A3NA 3X1ZA 1UDWA 1L4HA 2J3IA 4LZWA 3E18A 2OMKA 1OZ0A 3TVYA 2H2WA 2VHUA 1F06A 2VAMA 3L8EA 2VF8A 4DKXA 4HX9A 2OBYA 2VWGA 2NSLA 2X7HA 4O2AB 4HDMA 1BE6A 1KFBB 5EC8A 4CUJA 3ZDXB 3ROXA 4M1MA 4MLPA 1ZUNB 4U39A 5ALJA 4EITA 3RVKA 4NURA 3EVCA 2O8BA 4U6SA 1VCMA 2E49A 5IMBA 3TD2A 1TMYA 4F3RA 2R8XA 3LHFA 2MYTA 4WGGA 1JT9A 4ZO9A 4A26A 4MUXA 2QENA 4MNTA 4RM3A 5E3JA 1GPKA 2UVPB 1N5RA 3F98A 4OGLA 2LIVA 4KNVA 1NUTA 1V8BA 4LRSB 1WPXA 3NRCA 3GUZA 4XM0A 2H5JA 2PMFA 4ZGGA 3OQOA 3QGMA 4UOEA 2BTEA 3LRXA 3IESA 1NF8A 3K9BA 3ZZNA 2G83A 3LXMA 4Y6GB 2DLDA 3Q10A 3K6SA 3LM8A 1CE8B 2FPGB 1YZQA 4JUBA 1GAXA 1H3NA 1U28A 2DHDA 1JFFB 5ALUA 5HE9A 4H0NA 5MN4A 3AHEA 3TE6A 2GPBA 2B5VA 1E1RA 1O94A 3UK2A 5HFJA 2EJTA 2Q45A 2YXLA 1RBZA 1HOXA 1NP7A 4RF3A 5ALDA 3GPDG 3RODA 3Q2IA 1F6WA 3SG0A 2GN4A 3H5TA 3JYQA 4LMAA 5H80A 1DAMA 4LDJA 1RE0A 1U7PA 2K7ZA 1NX6A 3ETDA 1SR8A 3KPVA 5JRZA 3UYKA 2Q8NA 3ZU5A 2FCAA 2FMHA 5EE0A 2F1JA 2HMUA 1OLXB 3LQFA 2PD3A 3DZIA 2X3FA 1QONA 3OOSA 3GLTA 4LRWA 4DRXB 1YJ8A 5ENVA 4GE3A 2V97A 3GI1A 4J4HA 4M9CA 4N5NA 4JI4B 4FW9A 1U4SA 1IQUA 2EG9A 3QTTA 1IEQA 2AOTA 3D3KA 1A9YA 4QPNA 3NEYA 1EQAA 2HPHA 2XQIA 4BNVA 3FPJA 2PJRA 3CCFA 2PO5A 4EUNA 3I1YA 5LJLA 2I6XA 3B82A 3DZJA 4B73A 2OYSA 2A14A 3KDSE 3OBBA 2KQUA 4LJ7A 1YASA 4DG8A 4AQ7A 5AW1A 2O8FA 1RXCA 2PYDA 4I55A 1E2BA 1N5JA 3FCEA 5IJZA 2WTXA 1GZVA 1BW9A 4BEVA 3ZY5A 1E2QA 4XOUA 1G2OA 5K01A 3LH5A 4TM7A 2J8ZA 3BBPA 1MO2A 4S3MA 4ARAA 1RI1A 4QREA 2XXAB 2PKCA 3PIIA 2OR3A 2NU9B 3B2EA 5TNXA 3V2GA 3ZN2A 2DR2A 2WZCA 3HA2A 1THGA 4DQXA 3GD5A 1TVEA 3K2QA 1JEEA 3AEKB 2BGIA 3PEEA 1VKNA 2D1YA 4PZDA 4QNMA 4Z4EA 1QIDA 3LZDA 3RLFA 1QQ7A 3HEBA 3ZXYA 4M89A 3KLMX 1EVJA 4HP8A 2NU8A 3T5DA 1IN1A 2I34A 3A06A 2XUGA 2I1VB 3CW2A 4EG5A 5DTQA 3A1NA 2IUUA 2EKBA 4D4HA 1LC0A 1SHLA 3HXTA 1AU9A 4EMUA 1LLUA 1QO0A 4B6GA 1B74A 1YZFA 2WV7A 2XZPA 4PYRA 2HEIA 5FOVA 4YT8A 3BC1A 3EWAA 2OBMA 3MMZA 3DSRA 3PDCA 4HTFA 4MVJM 2CD9A 2OUIA 1ZP6A 1G8HA 4J16A 1OOEA 4Y8VA 3LDGA 1BDHA 3HKEB 4OHRA 4RY2A 4MS3B 1U4OA 5EJ2A 4NP6A 4BX8A 1RXEA 3I1FA 4L50A 1IPHA 1IY2A 4IINA 2GEBA 4BRZA 3C3WA 4P1ZA 1Y1RA 4RQTA 4C08A 4WXMA 4L8YA 2O2DA 1GRRA 5H68A 3P0IA 3USZA 2YV1A 1M2WA 2E3JA 4AV7A 1ISMA 1MVLA 4FFNA 4K46A 5IEBA 2JAOA 4TV8B 1E0KA 5F2OA 4D8XA 4B3MB 4GBED 4UCFA 4QPJC 2QU8A 5I3ZA 3NJRA 2RAVA 3IAM1 5AK3A 1OH7A 1CIPA 4TQ9A 1EDDA 1FOEB 4U7DA 5FOUA 5KVSA 3IHLA 3QI7A 3QF7A 2WWIA 3GQBA 4DBZA 5HQTA 2GK3A 3GEEA 4QDZA 4FJ0A 4I1OA 4Q1VA 4DCCA 2DH5A 3I62A 5CJJA 4UHJA 5LQNA 5LP6B 1U3DA 1ZD3A 3UKJA 4ZYZA 2AK3A 2PZJA 3DNFA 1HNNA 3GJQA 2GBGA 4TL6A 4JGIA 2C07A 1T6YA 5FO1A 4UE3S 2Y05A 4Y2TA 4YLYA 4UAJA 1CUJA 3G8YA 1SHKA 3R5TA 3D1LA 4K9SA 4KXLA 1QRSA 2PR2A 2FEWB 4JEMA 5DZSA 1L7NA 2AN3A 4ARZA 4OYHA 4YP0A 3RVRA 4YCNA 5LSAA 4MA4A 4A8PA 2O9JA 3V4OA 3HL0A 5TJ9A 1U8EA 3WISA 3D3QA 3M6FA 1V96A 4EMSA 2ZAIA 1LBHA 1SK9A 4YRSA 2HHAA 4QWMA 2ONJA 4MB6A 4WJZA 1ZZGA 1Y5RA 3HV2A 2QM8A 2WF9A 3AKCA 3IOEA 4OHFA 4WK2B 1WMFA 5CBPA 3WAKA 2EP5A 1VIAA 1D4ZA 1K7CA 2EVWX 3C5EA 4GWLA 1W0KD 1NMEA 1OJLA 1XRQA 4P3NA 3SS7X 1CUFA 4V1CI 1WXWA 1PV1A 1QZZA 4DR3B 5JSHA 3CLKA 4BQOA 3ZE9A 5BV0A 2ZPUA 4WY8A 3SF8A 1TEVA 2QPAA 1KK2A 3BZWA 1NQAO 3MERA 5A7GA 1NDUA 3TL6A 3KJFA 1FNBA 4JJZA 5C7YA 4OGGA 1TQ4A 1ECCA 1ZWLA 2HIMA 3C8ZA 3FE2A 4IDPA 3N0XA 4QIHA 1SK8A 3OPVA 2Z8YA 1H2RS 1X7HA 2OZEA 2Q9UA 3IHTA 4MXDA 1UDCA 1ZC3A 2SKEA 2PXCA 2WUFA 1PUJA 1WSBA 3OZUA 3I2KA 1S5PA 4GNKA 4JUFA 1UBFA 4C43A 1KJYA 2BFEA 1X8XA 1BWSA 4FDUA 4WA7A 4KIGA 3P71T 1V11A 4L4ZA 4PLFA 3PC8A 5LYJA 5KINB 3GFBA 5TY0A 3D6VA 5GINE 5KHLB 1JDPA 2DTXA 2J33A 4D8TA 1K08A 3LXUX 3O2QB 5KSPA 3SBEA 4ZI3A 2YC2C 5KWVA 1QH1B 1W6RA 4O4LA 2DQSA 1Z8HA 3WI7A 1JVNA 1EXVA 1H9CA 5G4LA 4QPCA 3DVQX 2O2GA 3BRSA 4DG5A 3B6KA 2YV3A 3RQSA 4MTLA 3F73A 3L1HA 4O4JF 4INAA 3I04M 4IIHA 5I8WA 1AMUA 5IT0A 1JDJA 3PGKA 3W2HA 1K6JA 3VR4D 1VYTA 2MR5A 4IIDA 3C5CA 1QPZA 1REQB 2R60A 4M0PA 2N3ZA 1JSLA 2WLSA 3HCFA 3KWFA 1H0RA 5DTMA 4LJRA 3NM5A 4A73A 2ZIFA 3DBLA 3OC6A 4RVFA 1RC0A 1XPUA 3KL4A 1OFVA 1CJVC 3FNHA 3IBSA 3QFRA 3FZEA 2WUVA 3CVJA 1OVMA 3JQQA 2GBIA 3PE3A 3FSJX 4DCGA 1SHZA 3TTWA 3BH7A 5JRDS 2J46A 1U5BA 2GBPA 4UC0A 1SBTA 3RJZA 1INLA 3K4PA 1NJ8A 1C1XA 3TR0A 3K8YA 2G36A 3CLRD 2WMDA 3GFTA 4FXOA 3RVMA 3TQCA 3ZHSA 4GGOA 5HSGA 4GKJB 2J6CA 3DFFA 1M2JA 4NNOA 2A30A 5KNDA 4HC4A 4FMCF 3CQ9A 3U6KA 3ANSA 3S1SA 1P1RA 3Q12A 1OZHA 1YTUA 4J6EA 3TUIC 1PG5A 2HJWA 3ZY3A 1QTRA 1M8JA 2IEYA 2VDVE 4O8CA 3RUDA 4U3JB 2IQIA 4QICA 3CRW1 2VP0A 2PAAA 3OQHA 3Q3EA 3W8DA 4I9GA 3KSDO 3FZYA 3FCOA 4OHYA 1ZGHA 1QF9A 4K9PA 1UP6A 4XB6B 4A8JA 1S7GA 2CK3A 2R1ZA 4AZWA 1VIMA 2GESA 2Q1XA 1F0PA 3DEKA 3ND9A 3SPXA 4EM6A 2XUZA 2OK8A 2B61A 2XB9A 3CCBA 4UEQA 3VJRA 3TGPA 1WZ2A 5CG2A 1TGYA 2EJBA 3LL7A 4QOEA 4NESA 3PLNA 4TMVA 3LVQE 4JJIA 2GEVA 4I6EA 4OXYA 3O8LA 2YY7A 4QVKA 4LV6A 1N6RA 1PFYA 4F06A 5MFPA 1B93A 4B6RA 4TX1A 2A33A 2CBZA 2O3QA 4AJJA 5ADVA 1VL6A 4KVFA 3ZJUA 1VMAA 4GYKA 1VSTA 2A58A 3MGCA 5HGXA 3E6AA 1S2GA 4OPMA 4GLOA 4QG7A 4ZANA 3VAYA 3ND7A 2ZRBA 4BP8A 3V32A 3QJGA 1MFZA 3OX3A 2PMKA 4A92A 3L0DA 4MJ7A 3AFNA 3TTTA 2YHIA 3O26A 3ESAA 3PXEA 4M6WA 1QUFA 1F4LA 2B7LA 2X2PA 4F4UA 2WIAA 5LPNA 3X0DA 4WI1A 3DVSX 3T1NA 5HHTA 5CFOA 3FB4A 4MGKR 1HNXB 3BHNA 1I7LA 5AW6A 5L3RA 1AZLA 1IXRC 3MTJA 1ZA2A 4LJSA 4J3JA 4RF4A 1HMPA 1RRMA 3O4FA 5TX7A 1KIAA 4BU0A 2QTZA 4QSMA 2OP0A 4R05A 1IPEA 2JJ1D 2HQBA 4OJQA 4XYGA 2VNJA 5FTLA 5IJ9A 3Q7PA 3MWDA 4QKQA 3ER9A 1PGOA 1E77A 2J6HA 4A03A 5LBTA 5EXEA 3B13B 3RF7A 2CEKA 3SJUA 3EOBI 1JH8A 4NMHA 1ILEA 1U1FA 2JIZA 4BN0A 5GADl 1NF9A 2AS0A 4NYJR 4K8RB 2Z8YM 2NVUA 2SCUA 4R0NA 1M2VA 3VOBA 2K2WA 4I99A 1JFLA 1MABA 1YZVA 5EUMA 5KKAA 5JH7B 3PXXA 4PANA 4EHFA 3CT6A 5HNKA 4BE9A 4IJMA 2WJJA 1LSUA 3OFVA 4IUYA 1KO1A 1XCLA 3I61A 1B1AA 1A4IA 1FU4A 1OIWA 4GVPA 1GIAA 1C14A 1QU3A 2C9MA 4DM3A 4YI3A 3S99A 4TXHA 4C3VA 1GOTA 4YJGB 2GPJA 4DZRA 4E2WA 1U0BB 4YV1A 2ZITA 4KQWA 4GD3Q 5D01A 3ULKA 4B8YA 2BFPA 2WWRA 3H18A 3GV0A 4YXFA 4RFSB 4AJEA 1S7CA 4CM1A 5IUNC 3U16A 4W4TA 1A8UA 3MN1A 4LHWA 2VDWB 1Q50A 5HDBB 5KMGB 1Y48E 1EDEA 4FE4A 3E58A 4TN5A 3UJ7A 3C3KA 4YYEA 3ZDRA 5FWNA 5F4BA 3OP4A 2OWEA 4BQPA 4X63A 1ODSA 1LRKA 2Y2VA 4E5SA 2ANBA 2HMYB 3EXHB 1XJ5A 4BNHA 3KPYA 3UHOA 1MR3F 4NZMA 4QPZA 1Z08A 3BAFA 4L07A 2Q3JA 4BZWA 5LYJB 4D25A 3OESA 2V7QA 4LK2A 4EI8A 1V1RA 3K96A 1G3UA 3SBDA 2Q6KA 4B6FA 2FEAA 4BNFA 3FGNA 3FDJA 2HA7A 1SXIA 1KVTA 3R09A 2ORVA 3IJEB 4KU4A 5A6SB 2NNLD 1VOTA 1IM2A 3GCGA 4H31A 2XCLA 5AOCA 1U9ZA 1EXMA 3D31A 4JQCA 3FKSA 2X41A 3F4LA 3VPAA 3K6KA 5DYYA 5CNIA 4W1SA 2BKEA 3UMYA 4J49A 1Z2PX 4QQKA 3WK6A 1GQOA 1PT8A 2WYOA 3V4FA 4WXHA 3AVWA 3KQMA 2J3MA 4K6OA 4O2AA 4CKCB 3ABSB 1HYEA 4E30A 4IXDA 2ZB7A 4R5HA 3CPEA 2QNRA 1U0LA 1IOLA 1GV0A 4H2DA 2XRZA 2IITA 2JLVA 3DEIA 2KB0A 3T1VA 5EBVA 3ZI0A 3H6GA 3HO1A 4YJ2A 4PG8A 5ISMA 5HF6A 1NRXA 1TK2A 1GQYA 1TU3A 3FNBA 4BLQA 3GJ0A 4AU1A 2BKAA 1YV9A 1AHNA 2GA8A 3CG0A 3GYBA 4LSWA 3ROTA 1IZ7A 1J39A 3QYFA 2E6UX 1R50A 1ZEMA 2DKNA 3FFTA 4OB6A 3ZWQA 1Y7HA 3C97A 5CA1B 3L6EA 4BX2A 3BQ9A 4ROTA 1BKSB 4BN4A 1AV6A 1GDTA 3N2IA 3RSQA 1OKKD 3PC6A 2UVQA 2XVXA 3WL5A 4IEFB 1BDMA 3L0YA 1OFTA 2VR1A 4G25A 4UUMA 1EXNA 4WCVA 1AHHA 3UGKA 1GL7A 2IHYA 1PRYA 3C24A 4CI9A 4CVNA 3EZNA 1E7YA 3CVOA 3ESBA 1MFPA 4HGRA 3TCXB 1G3IA 1SUDA 2Y1FA 3FWNA 3FZQA 3IT3A 3M5DA 3W5JA 3EVDA 5SY4A 2JFZA 4EVRA 1FFHA 1P0PA 1Y33E 2A7QA 2W43A 2C99A 3NHAA 3ORFA 3WYCA 3ZVRA 3R77A 1VG0B 5BW4A 2X5JO 2P3QA 3FAZA 3GARA 5JFOA 3LT2A 4CEIA 3GUCA 2JLRA 3JWJA 3L41A 3FMOB 4IH4A 3N28A 4MUHA 4DBLE 2XY4A 2GAIA 3R40A 3ZDCA 1VKHA 1XRRA 4HRXA 2ZYUX 4M1ZA 1YGYA 3VGJA 3H9EO 1GPAA 1PVOA 2BZGA 3MWFA 1AIPA 2X8AA 1CUGA 3E8MA 1Z8FA 3OC0A 4HH3C 4HMPA 4JBWA 5CYGA 3LCMA 4P0QB 1TRKA 2O5RA 1FVHA 1OXVA 4I4CA 4KMRA 1JZQA 3FKQA 4KX5A 2P90A 1G9XA 5A4JA 3T5BA 3HM2A 2X77A 1DARA 2W2MA 4GYYA 4HZIA 2B7CA 1NBOA 4TT8A 4OLAA 3C41J 2KMLA 3AUYA 4MPRA 4QGGA 2WJIA 1R0YA 2JHGA 3KP1A 3LZ6A 2DB3A 2XTAA 5KX5A 1OWMA 4C6RA 4RHXA 3PX3A 1T0BA 3JALB 3KLBA 1UT8A 1UEXC 2BMJA 3LX4A 1KI1A 4GXNA 5DT2A 3TLYA 1DJPA 1DHRA 1V8PA 3CF0A 3CUEF 2G5GX 5EJFA 1QO0D 1R6BX 3NDIA 4G1CA 4OK6A 1KR2A 3BMQA 5AO9A 1NBMA 2QROA 4BJHB 2YZGA 4ND3A 5JO0A 5KCZA 3DM5A 4KMMA 5B2ZA 2DU8A 2O50A 4Q4AA 3INYA 4KPEC 1CW2B 4C0JA 1DKUA 4PQEA 4Q7JB 2R62A 1TUIA 4GPEA 4J16C 1DMRA 3LWBA 4S0XA 1NMSA 4PHTA 2ZE8A 2G80A 1CHNA 2ODWA 1PNVA 4RSMA 2XXAA 1EGMB 3EF1A 4MIKA 3O91A 3FRJA 4WPGA 3JAWB 2WMNB 2KBFA 2HJ9A 3IALA 1TQ6A 4RF2A 5E6SB 1PNRA 2FN3A 3QLUC 5FBZA 3SZOA 4B6OA 4ZMSA 3C87A 4HUQB 1EP1B 1AB6A 4Z7OB 4TYPA 2OZPA 4G97A 1SH7A 1JWBB 1YFKA 1B6SA 4NZ9A 2W4QA 4KWTA 1FFXA 3OZCA 3FWZA 9ATCA 1R8JA 1P4HA 2IYTA 3AJAA 3GJ7A 4FZJA 3S40A 4RPGA 4FW8A 1SHTX 1SXHA 3B1ZA 1GTSA 1WZUA 3IPCA 1T26A 4PZLA 1SIOA 2DFTA 1PS0A 3F1KA 4GG1A 3VHLB 4AN4A 3ZW9A 2QR3A 1FQKA 3IIMA 3CUKA 1TUGA 5TGZA 4B7UA 3DP9A 4EJFA 4F2WA 3COJA 4XQ0A 2QZ9A 2JGEA 1JXAA 5F1OA 3W8EA 3G8BA 5LA6A 3VYWA 1E7SA 5E2BA 4X65B 1QU2A 1ZNZA 2BGRA 1P2BA 4B4DA 3WLAA 2Q3BA 1NNLA 3R6LA 4F60A 2V1XA 1E64A 1SCDA 1N6IA 1YL5A 4FWBA 5C31A 5C51B 4GI2A 4L6AA 3ZIDA 2PL1A 1WCIB 5GAJA 4L8VA 1T6ZA 2NTYC 2XIQA 5A23A 2ZJ7A 3FPEA 4BYMA 4MTCA 5BN5B 4KIWA 5BOSA 5LKAA 3OKAA 4G23A 3MT7A 1NQUA 3QEMB 3AETB 4JEIA 4RSHA 3ZZUA 2PKXA 2COUA 1H2BA 2NVOA 1WXDA 4G9EA 3KT0A 4M54A 4MVJH 4RWZA 4MQMA 5L4LA 5ED4A 1A3CA 1DAFA 2ZS7A 2Z2IA 4US2R 3H5WA 1X7YB 5CW2A 1RWKA 1VL1A 4GC9A 3CGWA 3PYMA 2C4NA 2ZP1A 5TPZD 3LK6A 3OEYA 5IF9A 1NU6A 3RRBA 3PSAA 1CUWA 4A7PA 3IKLA 3BB1A 3CUSA 5BN4A 2ZR9A 3Q8MA 3H5IA 4MRVA 4L78A 2HHCA 4GS5A 4HDRA 4KW7A 4TVOA 1UKZA 4I5GA 3SIRA 4BVEA 1BXRB 5KDLA 5T57A 3QUSA 4RIEA 2HX1A 3EAGA 2AFHA 2GPNA 2LGJA 2QUHA 3L7BA 3M9XA 3HBNA 4UEKA 1WUIS 3ONEA 5ESWA 1XEFA 3DF9A 1C7ZA 4Z2YA 1VE6A 2TMGA 1NRIA 3B6EA 4JI8B 2XUFA 3EGIA 4M0FA 5C1DA 1M5UA 2BKLA 4IIVA 4U7PB 4WTOA 1S8FA 1SJ9A 4A2WA 1FYVA 2DWUA 3BORA 1ZZEA 3HXMA 3L84A 1C4XA 1OAOC 3DR3A 1DG9A 2VJOA 3KUCA 4O33A 4BV2A 1UQUA 3RT9A 4S12A 9LDTA 2ZRMA 1NHGA 3KWJA 1KAEA 1EK5A 1NXVA 1D3AA 1Z6ZA 4LYJA 4LY3A 4C4TA 1XVUA 5FLKA 2R47A 2OOSA 1RMQA 2HV2A 1WCIA 5BR8B 4URHA 1F2DA 3HSSA 2LRHA 1NBWB 4N12A 4YPOA 2IOFK 6NULA 1P2UA 1X9GA 5ECGC 2EWMA 1DKQA 3C8UA 4MI1A 1AD2A 5J3JA 1W2GA 3OSZA 4ZI2A 4UTZA 1OI2A 2O6HA 2XE7A 3Q3IA 4I1YA 5K3CA 5JSZA 1JFSA 1NXTA 4MS4B 1GYQA 3WK9A 1GAJA 3HH8A 3EHEA 1BD3A 4UEIA 4FNAA 5L3QA 3DXXA 4OIFA 4Q1DA 5F7XA 4XIIA 4AYWA 4JYPA 5AW9A 1PDWA 1ESZA 1OTHA 2O14A 3BL5A 1UBTS 4I3FA 2K4MA 3OJLA 3HSYA 3NNDA 1YQGA 1MJGM 2XQVA 1ESEA 5EUCA 3T9FA 3ZQJA 1EFAA 2I6SA 3ITNA 4HH1A 2XCUA 1RJDA 4D8YA 1SHJA 2IH5A 1MO6A 2O1XA 2WDZA 4GXTA 3DLAA 3GRFA 4GICA 3QX9A 5DCWA 4BZQA 5I7UA 3HM9A 2ZWIA 2ZULA 3D3EA 4UTVA 3RC7A 1XJQA 5CD9A 1XRMA 2Q9BA 2FW7A 4FC7A 2GN0A 4RBNA 4E4RA 4IUBS 3ZOZA 1WF6A 3GVPA 4P4SB 3EZFA 1Z7YA 2EIHA 3IP3A 4Q3BA 1X14A 1YUMA 2WYIA 2XYRA 2HSEA 4LBYA 4R2XA 4LS3A 4ZEOA 3VKFA 1FY2A 3G2JA 4QGSA 3OI7A 5KYGA 1A1VA 2GSDA 2GI4A 4XIJA 1KZHA 4NCHA 2FSPA 4KO4S 3WQRA 4QDUA 3GO4A 2NUPB 4D6PA 1QDEA 2QX7A 2DUJA 5B1DA 4BMNA 2ZAMA 5H3LA 1YMQA 3QVSA 5FADA 5BW8A 5IN4A 3HJTA 2DHCA 4AROA 3ED1A 1CUBA 4L3VA 3VSEA 4J0FA 3PHLA 2G5PA 4CDNA 1C1HA 1SA0A 3TYXA 3NYQA 5C3MA 1P5RA 4W6ZA 1R0BA 4AJIA 4ZRMA 2C58A 2QLJA 3NP9A 3G2MA 5LOVA 4TM8A 3CFYA 3C5HA 4YN3A 1OZFA 1AXRA 1VE1A 1ZGGA 1G41A 2AG6A 4FX2A 5J4HA 2FPKA 4BO0A 1EUYA 2V59A 2IUEA 4MUMA 2HQSA 4Q6BA 4RD3A 4KVAA 2DFDA 5D85A 2Z2XA 4L1KA 5FWXA 2DLCX 1FJHA 1PAUA 3AKEA 4MW5A 3K30A 2WJAA 4I6JA 3ZE8A 1L6RA 4X1KA 3ABRB 3OJXA 1KDYA 1IONA 1KY5A 3DDCA 3NUQA 1G20E 3A4LA 2W2TA 4IYRA 4PTLA 1SKUA 5CVTA 1G1AA 4URFA 4ZP1A 3EGOA 3VR0A 1RFGE 2JEYA 3MJSA 3N8HA 4KO2S 4MVYA 4B46A 3GQVA 1Z12A 1O95C 4HB4A 5FQNA 1U7HA 2ZW9A 3EUWA 5DLQC 1OBVA 2YQ4A 4S35A 4XUEA 3TZHA 1P6QA 5CBPB 4BMOB 5E4YA 2HF2A 3WK4A 1ICIA 2DULA 3I9LA 3T9DA 2YBDA 1I6KA 1R0LA 4QJ3A 1I4OA 4CM5A 1COZA 5ESXA 1GU7A 2A5GA 3VRHA 4NV0A 2WSIA 3HKCA 5DNCA 5ALYA 1P9LA 2E1RA 4J76A 2KX7A 3FNRA 3S5JA 1HFWA 4TTJA 5D7BA 4X93A 121PA 5ALMA 3YASA 1I5RA 3MAJA 3ENKA 4DLRA 1GL6A 4L22A 3RC2A 4MS4A 3QVWA 4KXVA 4MVJG 1U9YA 2PTGA 3CRZA 3A9WA 2JIZD 3GT0A 4IIYA 5BUSA 4BB5A 4AX4A 1QFSA 4TTVA 1F8FA 3K9NA 4PCVA 4QUIA 1XL0A 5TB5A 3UJ3X 5IVKA 2PUEA 3KFVA 1H5NA 4Y2VA 2VSOA 4CFYA 4DNPA 2BIFA 4FFLA 1WKBA 3KQPA 2NUAA 2XBUA 4K9OA 2ZWMA 4Z54A 2Q3CA 1L9XA 4P82A 4RUKA 2WABA 1MJNA 1SQFA 3FIJA 4NV1A 4YLEA 3HFRA 2GN6A 3KZNA 3SFTA 3BE4A 4BV3A 4F8YA 2GCGA 5BYKA 2WHEA 2ODQA 2B1RA 4WINA 3HP1A 3VPFA 5BQ3A 1TC1A 2PJDA 3MWJA 2OLKA 3AUAA 4JLVA 3LLSA 2ZIXA 3UGQA 2FK8A 4KWCA 3U56A 3OZ7A 1ZH8A 1QG4A 4FT4A 2VQDA 3U7FB 1GDDA 1UPTA 2PGIA 4KI0A 3VR5H 1LCIA 2UU9B 2A86A 2R00C 4L4SA 3KAJA 2QBYA 4B09A 2KWIA 2H4HA 2XMGA 3OWOA 1K98A 1DJMA 2R9VA 4HV4A 5HIAA 2QX6A 3EDCA 2BM8A 1V1RB 5F78A 1IHYA 3ZWMA 3JQCA 3R6TA 4C1BA 3UUGA 1RWQA 2AOVA 1TKAA 3BHMA 1WXIA 3I9OA 1P1JA 2P4HX 4IDOA 1ODLA 2SICE 1N57A 1DX4A 2OAQ1 1U2GC 2D0DA 1H93A 1U4NA 3F6CA 3M6IA 4R1QA 4MA0A 4AZ0A 5JFTA 1T1RA 4YHHB 1IY0A 2E5WA 3N1UA 5E9AA 4DPLA 3GLHB 3BT7A 1L3IA 3CG4A 2PJZA 3MA0A 1KOLA 3OAAD 5AW4A 2LTAA 3VU1A 2BZ0A 3IOBA 1AG9A 2QLFA 1PSWA 3UT5A 3WYEA 2F4NA 5K3OA 4NJOA 3RCBA 2JD0A 1RKVA 4RHEA 5TMEA 4BFTA 3ZGNA 4BMXA 4OQNA 3ZLBA 4BEJA 4BZZA 1E3QA 1QVAA 2IBTA 3TRHA 4MP3A 3C8MA 1N0IA 3B3JA 4IEEA 2EZ8A 1Q0UA 1K27A 1U0HC 4N9WA 2JLXA 2BFDB 4XSVA 3WFJA 5JNRA 2XQGA 5CDFA 4RTLA 4BNTA 1J21A 2ZS8A 4FWTA 2VRBA 2HNKA 4MINA 4KK3A 5ADHA 3SSOA 1M2VB 4FLFA 1EAYA 3Q5DA 1M66A 1KHHA 2FUNB 2PX8A 3ND6A 3T99A 4FBGA 3U7JA 4MV7A 1ELOA 3DBRB 2FVXA 7REQA 5CVCA 3GUVA 3THXA 4MQ5A 5K3FB 4O2BB 1P72A 2O8FB 5M34A 1MHTA 2YDXA 1N75A 2XGSA 3JPWA 1CZNA 4CL2A 1HE1C 4HGPA 2YASA 3GG9A 4D4JA 3QYAA 3LV8A 1UZNA 4QOHA 3ODGA 5FD8A 5B5SA 1G8AA 3ZWDA 3OLZA 5B7QA 1PJ4A 4EEXA 3KKQA 2DM6A 4LYYA 2QV7A 3C1AA 3HCDA 4MKHA 1O58A 3BIFA 3RBZA 4M83A 3OCXA 1I0LA 4ZYVA 5BT8A 3WYBA 1EP9A 2ECFA 1NZJA 1SBNE 3CXRA 4MZXA 1OW3B 3CS3A 1SCUA 3L7NA 3ZWBA 4TUYB 2FFJA 4F3KA 1W88A 1ZRMA 2EFJA 4NULA 4LFBB 1Y6QA 3LG2A 2MT9A 1IWPB 5ITZA 1OV6A 1J97A 2EWWA 3NDJA 4JU9A 3FNFA 4IJKA 3RASA 5JAZA 1VXOA 3KYBA 4OXKA 1WHSB 3A6ZA 2X7JA 2P0YA 1O08A 3L1IA 2I9PA 3O82A 5DN6D 2F43B 2XA9A 4JZYA 1HYBA 3S2ZA 1QIKA 4RV5A 1N8SA 1P7PA 2PT6A 4YP7A 2JAWA 3X2SA 4QD3A 2ISQA 5BSTA 2ISSD 5J58A 4B6QA 2A0FA 2RHBA 2Y4NA 3TSOA 2WD8A 3UCEA 6LDHA 1II8B 3A2KA 2FPGA 5IU6A 4MVJE 4B35A 5AKXA 1AKEA 3RS4A 4B17A 5SYAA 3PZBA 3DL2A 4MRMA 3T9CA 2W2NA 4B8ZA 3U5ZB 4LZNA 1TYAE 4DV7B 1Y7IA 1QF7A 3QV2A 3MJEA 3LPAA 4UMDA 2QBYB 4R83A 1H6AA 2PL3A 2W6ZA 2RKWA 2GD1O 4PZEA 2DR3A 3D4IA 3K9GA 1H8EA 4YMIA 2ZBQA 4N5DA 3X1MA 2BGNA 3LQKA 2DUUA 5CLLA 1Z4LA 2RHHA 4AZVA 1O6GA 3GJ5A 3UH1A 1KZ1A 1ZJWA 1FXWA 1R88A 3GEIA 4EF5A 4QU8A 4R8SA 1RAFA 3VC3A 2IYNA 3PNYA 3ONVA 3ZEIA 3OZSA 3ROZA 3WIVA 2ZREA 1VQ1A 4D9HA 4Y1RA 1Z4NA 1CR6A 1QLWA 2VHVA 3OUTA 1IBRA 1K92A 2E4UA 2ONCA 2CLFB 2X9LA 3E8SA 2ZBRA 3EXFA 3FTQA 3FKJA 4TV9B 5C1IA 4K6FA 2HBYA 4L9RA 4WOJA 5D2CA 4AUKA 3ESRA 1V8DA 3NH9A 5KTSA 3U1TA 1JQJC 5K4AA 3DDHA 1G20B 1XALA 3N6VA 4GWGA 4HOYA 1YRBA 4C6TA 5F3WB 3CJRA 4JQYA 4PFQA 4F5EA 1CQXA 1BGWA 2NZWA 3L4EA 3JSXA 2QAGA 3W6UA 1G3QA 1Q21A 2HY7A 2Q1UA 3WGJA 4JXZA 1SBHA 3HG7A 2WD9A 3VZRA 2QHXA 1J20A 5EMNA 4RFVA 3T3GA 2PGOA 4ABTA 2QYOA 1O96B 3H5LA 2HI0A 1G6OA 2HWKA 5FWAA 3LGXA