3SSMA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
390
structure length
387
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
total genus 126
structure length 387
sequence length 390
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssmA02
3SGLA 2Q41A 2AVDA 3GRUA 5EZQA 3TRKA 4IKPA 3M4XA 1KPHA 3EVFA 1I4WA 5CCXA 4PYIA 2I62A 5EPEA 1NE2A 3CGGA 4YMGA 3VC1A 3UFBA 3OCJA 1EJ0A 2P7IA 2ZBPA 3EMBA 3EMDA 2DULA 4OBXA 3LL7A 3BGVA 5HIIA 1TW3A 4ER5A 3IHTA 4GC5A 3P2IA 2FYTA 1L9KA 5KS2A 3BWYA 1G55A 4LWPA 3P9NA 5F2OA 5GIOE 1YFLA 3MB5A 1X1AA 5KQRA 2AOUB 4BP3A 4QPNA 4A6DA 3UJ8A 2XVMA 3MAGA 1XXLA 1FPQA 1NT2A 1JQEA 4BLVA 2ZBRA 1VPTA 4UOEA 4RTLA 1FJXA 3I5UA 4PYLA 2ONYA 3P8ZA 2WK1A 4CKCA 1ORIA 1NBHA 2JH8A 3HEMA 3LDUA 3DXYA 3JWJA 3BGIA 2GS9A 1X1CA 2FCAA 3I58A 1VP3A 3LCVB 3O4FA 3OU6A 4OX9Y 4CTJA 1TPYA 2ZIEA 3EGVA 2B25A 5E1MA 3QOWA 2C7QA 1YB2A 4P7KA 3QOXA 2NYUA 5E2BA 5DM0A 2G72A 3KR1A 3MTIA 3RODA 4C05A 4AZVA 3BKXA 3WSTA 1H1DA 4M37A 4NECA 4EMSA 5KYGA 3GO4A 3HTXA 1INLA 2O0LA 1P1CA 3SSOA 4RTJA 1M6YA 3NWBA 2PJDA 5LQUA 2PBFA 3DLCA 3FRIA 1DL5A 3K6RA 3EPPA 2P3OA 3HM2A 3KKZA 1XDUA 1Z3CA 3TKAA 4DQ0A 1KPGA 1PRYA 5HILA 5LSAA 2JHAA 1BOOA 2AOTB 5DX1A 2BM8A 5GWXA 4YUYA 2OB1A 4DMGA 4DM3A 5K0JA 4AZWA 2QRVB 5HOQA 2P41A 1YUBA 3DLIA 4KW7A 2UYCA 3UBTA 5EMLA 4M36A 3G5LA 5DXJA 1G8AA 5K0FA 4AZTA 1SKMA 4FT2A 3T0IA 3TPZA 2EX4A 5M5BA 2H00A 2PGXA 4HG2A 1L3CA 3FUWA 3LKZA 2AZTA 3ANXA 2BR4A 3R3HA 4OA5A 4C03A 5BXYA 1NW7A 5ERGB 2EFJA 4C07A 2XVAA 1AV6A 3B3FA 3FZGA 3BT7A 1JG2A 3PX2A 1R8XA 1FBNA 1SUIA 3EVZA 3G8BA 3IYLW 3G2QA 3TOSA 5T64A 3OZSA 5E1OA 4EVIA 5LQKA 5GM1A 5DM2A 2B9EA 3GIWA 3GNLA 4RTMA 4M38A 5DX8A 1EJ6A 1SQFA 3R0QA 1VIDA 1DCTA 4E2YA 4QQKA 3B7PA 3BZBA 3HCDA 4QQNA 3G2MA 3UJCA 4EQZA 4DA4A 1NKVA 2ONZA 4E33A 2PXXA 3KQTA 1EG2A 5F2KA 2EJUA 2QY6A 3MQ2A 2H1RA 2DPMA 3KR9A 3RW9A 2YVLA 1QANA 1SVUA 5DT2A 4AUKA 5DTRA 5EC8A 2FK8A 4X63A 2A14A 4RWZA 4YV1A 1G60A 2G70A 3ELYA 5HIJA 3CJRA 3F4KA 5K03A 2AVNA 2PWPA 5EKUA 4GOLD 3VC2A 3VSEA 2ZZNA 1NV8A 4KVZA 2GLUA 4C04A 4R6XA 2ZSUA 3NDIA 3OZRA 1EQAA 2EG5A 1P1BA 1QAOA 3OE5A 4M7RA 5EHIA 3OE4A 1JQDA 3EGEA 1R00A 1FP1D 1JG1A 1MJFA 1ZQ9A 3NJRA 4HTFA 1QAMA 3G2PA 5D1HA 3FUVA 2CKDA 1NW3A 3FUXA 3FTEA 5FA5A 3H2BA 4RTRA 3KR2A 5CVVA 4PYKA 1M6EX 5H02A 3GXOA 2I7CA 1BC5A 2NXNA 3FUUA 4GC9A 5BW4A 2UYHA 1UIRA 5HFJA 5DRTA 3UJ9A 3I53A 3T7SA 1F38A 2B78A 3C6KA 2AOVA 3BWMA 4RVDA 5DSXA 5EG5A 1QZZA 5K8VA 3LBYA 2C7PA 4AX8A 3JWIA 1WY7A 3GRZA 3JWHA 3OFJA 4CKBA 3P2KA 1VP9A 1WG8A 1L1EA 5EEGA 1XCLA 3LHDA 3KQOA 3LGAA 2Y1XA 5C9ZA 5EIFA 3DXXA 5C1IA 1ZGJA 2V7EA 2AOUA 1V39A 2ZULA 3KQWA 2ERCA 3ORHA 2PV0A 3EVCA 3KPJA 3LPMA 3P9CA 4QDJA 5K0LA 1L3BA 3M6XA 3PFHA 2H11A 5DM4A 2XYRA 2IDKA 1YZ3A 2PXCA 3OZTA 3BXOA 10MHA 1G8SA 1X1DA 2P35A 4R8RA 1X19A 2OZVA 2YR0A 1RJGA 5E9QA 5LQNA 2O06A 3CBGA 1R8YA 5FWAA 1RI1A 3ER9A 1AQJA 4RTSA 1JTEA 4Z2YA 4F84A 2CMGA 2XYVA 1KYWA 1NW5A 3Q87B 2R6ZA 4FSDA 4RSRA 3HA3A 5E9JA 5EOVA 4X1OA 1RJDA 2JHCA 4OQDA 4PCAA 4V0QA 3B3GA 3THSA 4WXHA 2Z6AA 4F86A 4PINA 4E70A 1NV9A 4GOND 3I64A 4KDRA 2NNWB 2PSSA 4FS8A 2HMYB 3MTEA 2JH9A 4Y2HA 2AOTA 3HCCA 3SM3A 4EK9A 3M70A 4U7TB 4RYLA 4FP9A 2NXCA 8MHTA 2PT9A 3G89A 3DR5A 4MHTA 2QRVA 3TFWA 4KIFA 5F2NA 4MIKA 4XUCA 2P40A 3HCEA 5CIYA 3OPNA 3CKKA 3PT9A 4QPPA 1UFKA 2VP3A 5U4XA 3V97A 4DZRA 3MERA 3TLJA 1XTPA 1L3IA 2FRXA 3FYDA 2PXAA 3IEIA 3FPHA 5D1NA 3KQQA 3AXSA 1WZNA 5CVJA 5EIWA 3EVEA 2E5WA 4RVGA 3B89A 5P8WA 4QTTB 4RTPA 1I9GA 2ZIGA 2AN3A 1JSZA 3THRA 2XBMA 2PKWA 1B42A 3SR4A 2OY0A 4PIPA 4C06A 3PX3A 4PYOA 3KQMA 4IV0A 4RTQA 2UZ4A 1XCJA 2IDJA 5KVAA 2IH4A 2ZTHA 2ZZKA 3DOUA 5HZMA 1FP2A 3C3PA 3ELDA 2WA2A 4P7JA 3BUSA 5FHQA 1JR4A 3GCZA 3CVOA 1RJEA 1VLMA 4BLUA 2JJQA 2EJTA 2AOWA 2AOXA 1AQIA 3DULA 4PCLA 2VDWA 3G5TA 1O54A 1R74A 3DXZA 3V8VA 4GOOD 4EKGA 2PX8A 3BKWA 4ER7A 1D2HA 1I1NA 3EEOA 3SXJA 2OPBA 2IH2A 1X1BA 2IBSA 5CM2Z 1EIZA 3HVKA 4PYMA 4GF5A 5CVUA 3KQPA 5ICEA 4PYQA 3SSMA 4BY9E 2YXLA 4MQ4A 3PVCA 4IWNA 2OYRA 4OQEA 5E2AA 3LDFA 3KPYA 3EVBA 4ER3A 1P91A 2YTZA 5DRYA 3TR6A 2C7RA 1Q0TA 3FPJA 4PYNA 3R24A 1D2CA 5JR3A 3PLAE 2V74B 1KHHA 7MHTA 3FPGA 5DSTA 5DX0A 2N47A 4YUWA 4RTOA 4QTUB 4O29A 2PWYA 3DMFA 3LSTA 4CKEA 4BLWA 4G56A 2O05A 3LBFA 1P39A 3X0DA 1KPIA 4ER6A 3PS9A 4YMHA 3REOA 3G8AA 4GEKA 5FQNA 1O9GA 3GGDA 4POOA 2BZGA 2AR0A 3GRVA 2VZ9A 1SG9A 5EQJB 2OXTA 4E31A 2BH2A 2YX1A 3ID6C 2Z6QA 1NW6A 3HVJA 1RI3A 2GAFA 2G71A 4QDKA 1YZHA 3DH0A 4GQBA 1YF3A 4X61A 3VYWA 3GJYA 1VBFA 4E32A 2GH1A 3T7TA 2ZWVA 3NTVA 4DF3A 3HCFA 3SSNA 4RV9A 3A27A 4H0NA 1RI2A 3DTNA 4MTLA 3FTFA 2ORED 2VDVE 5IH3A 5LR6A 5LQCA 3A7EA 3FPFA 3HCAA 4CTKA 5HIKA 3EVDA 1JSXA 3TM4A 5EMMA 5EEHA 1KXZA 2FPOA 1Q0SA 4QVGA 1F3LA 5EHGA 3BWBA 3NMUF 4C4AA 2OO3A 1SUSA 4PNEA 2ZVJA 1PJZA 1WS6A 4HRAA 3KPVA 2GPYA 3UJDA 5MHTA 5B1SA 4EKIA 3L8DA 3A25A 3DMHA 5CCBA 2P3LA 2BR5A 3UZUA 2PT6A 2ESRA 4HSGA 3HA7A 1EAMA 4FT4A 5C0OE 3KPUA 1VL5A 3M33A 3EVAA 4PGHA 3LECA 4HC4A 3S68A 3OU2A 1U2ZA 4RX1A 1NBIA 2B2CA 3GRYA 3ELUA 3ERCA 2ZZMA 1O9HA 1WXWA 1JG3A 3R9XB 2NP7A 5FUBA 5GOZA 3MGGA 4LG1A 1VE3A 4DCMA 1KYZA 2UYQA 2QE6A 3PFGA 1NW8A 3OFKA 3EVGA 2FK7A 3GWZA 1HNNA 4P7GA 4PONA 3TM5A 4X41A 2ZFUA 1G38A 2CL5A 3GRRA 3K0BA 4E2ZA 2PLWA 5DM1A 5EZSA 3NVMB 5FHRA 1XVAA 4AZSA 2P1DA 2YQZA 2FHPA 3MCZA 5LQAA 1WXXA 5DLYA 2CWWA 1KR5A 4PYJA 1RI4A 3ME5A 3QV2A 2R3SA 3DMGA 5DWQA 4XUDA 2Z6UA 1VQ1A 2QM3A 3HCBA 3NVKI 4GBED 2IP2A 3HNRA 2AS0A 2PX5A 3EEYA 3LKDA 4ZTBA 5IKMA 1M0EA 2BR3A 3FTDA 2GB4A 2NXJA 4R8SA 1ZGAA 2ZIFA 1AF7A 1DUSA 3R6TA 5T6BA 3PTAA 2PY6A 3KR0A 4KRGA 4OA8A 5HIMA 3T7RA 2OB2A 4E2XA 3FYCA 1SQGA 3BGDA 3FPEA 3GU3A 2G1PA 5CD1A 3IV6A 2P8JA 3SVZA 2O57A 3A26A 3JWGA 5K0BA 2IPXA 3B3JA 5E8RA 5K09A 2GA9A 4YUXA 4WVLA 5E8JA 3UA3A 3Q7EA 4FR0A 5E1DA 1XDSA 4U7PB 1YFJA 2JHPA 3UJ7A 3D2LA 2KW5A 4PGGA 4YV0A 3M6VA 4KIGA 3LX6A 4QVKA 1ZG3A 2IGTA 4A6EA 4R05A 5GP1A 3C0KA 2VDUE 4YUVA 2Y1WA 4XUEA 5FWDA 1ORHA 1IY9A 2ZWAA 2UYOA 3P9KA 4BP1A 1N7IA 1R6AA 4CWAA 1OR8A 1R18A 5K0GA 3M6UA 1MHTA 3HA5A 3KU1A 2HTEA 4B17A 5ICCA 2HWKA 3FRHA 2ADMA 4RVHA 1JQ3A 2B3TA 3U81A 4LECA 5EVJA 3P2EA 1D2GA 2PVCA 2P3QA 3AXTA 3TMAA 2ZLBA 4IV8A 3AWIA 5CUQA 4RVFA 5FCDA 1IXKA 5EGSA 3NDJA 3O31A 3KHKA 3OU7A 3P97A 4JXJA 4DCGA 1JG4A 1RI5A 3FUTA 3P9IA 4KWCA 2PX2A 1QYRA 2P7HA 2HR1A 2CMHA 3UJAA 1G6Q1 3A4TA 3NWEA 4OBWA 2C7OA 5CVDA 5FADA 3E8SA 1KP9A 2I6GA 3C3YA 2ZCJA 1ZKDA 3PB3A 3E23A 3LDGA 5K01A 1RJFA 2JG3A 1N7JA 5ICFA 2LD4A 4GOMD 5FULA 5FTWA 3O7WA 4K6MA 1BKYA 5K0CA 4YUZA 3DP7A 5ICGA 1N2XA 4P7FA 5KQSA 4FSXA 2XYQA 2IBTA 2ZBQA 3KPWA 5G02A 3KQSA 2VS1A 3LCUA 3ELWA 4Y30A 2AN4A 2BM9A 2QYOA 3DUWA 3I9FA 2IIPA 1TW2A 3HVHA 3KQYA 2PX4A 3M6WA 5K0NA 3UJ6A 3CJQA 3BWCA 3G7UA 5BP7A 2O07A 5DPMA 5K05A 5GIPE 5DTMA 3CCFA 1KIAA 2F8LA 5BW5A 4FGZA 5CVEA 3P71T 5DTQA 3LCCA 1JTFA 4RTKA 2OKCA 2HV9A 2NXEA 3SMQA 4MWZA 2YUIA 4L7VA 3UA4A 4V0RA 9MHTA 3MCTA 1Y8CA 3C6MA 4FZVA 3E05A 3NW9A 4R6WA 5DXAA 2IH5A 4P58A 4KDCA 4HGYA 5K0EA 2NP6A 5EKXA 5E9WA 5FQOA 4C08A 3HP7A 1UWVA 4X60A 3AY0A 3G88A 1QAQA 3EGIA 3GDHA 2YXEA 5FA8A 3HVIA 3ER8A 3TKYA 2IFTA 5GINE 3RIEA 4XCXA 2WA1A 3MHTA 2G8NA 3G2OA 3E7PA 3UJBA 4YV2A 4F85A 4ISCA 4LWOA 3B5IA 4ATNA 1HMYA 2YXDA 4E2WA 4HGZA 3SX0A 3AJDA 5LQJA 1IM8A 2HNKA 5JUWA 5LQRA 2AN5A 3CC8A 4GUAA 4ER0A 4HH4A 3CJTA 4CXMA 1BHJA 1T43A 5T67A 1XJ5A 3KQVA 2OBFA 2K4MA 2ZW9A 3FTCA 4RTNA 4PWYA 1XDZA 1ZHFA 5EMKA 4DKJA 4PIMA 4E30A 5GM2A 3A7DA 3UWPA 5HEKA 2I9KA 5EMJA 4HTFB 5E1BA 3TQSA
chains in the Genus database with same CATH superfamily
3N39C 1P5JA 1XTJA 2QYHA 1YL5A 2C1ZA 4UHHA 2XH8A 4R98A 1EGQA 3HB5X 1A5BB 5JS1A 4ECAA 2ZSDA 2HJ9A 4L85A 3DL4A 4YN3A 1NE2A 3QUAA 4LWZA 1E5LA 2G1UA 3UYLA 2IELA 3LXUX 5KYUB 4RMNA 1LBHA 3C1UA 4WBNB 4FEAA 2ZWMA 1J8MF 4LNAA 2WD7A 5D3QA 1XAJA 2BUBA 2Q5JA 4R68A 1TKBA 3M83A 1FL9A 5IP5A 3T5TA 5CX4A 3UHOA 2G83A 1EVJA 1QSGA 3OOYA 3B5JA 3P9NA 1MC8A 1QDLB 5DYWA 3IKMB 2HQOA 1XWFA 3EJ6A 3FLAA 1O97D 3JRWA 2XD9A 3IT0A 3BE4A 4A6DA 5AOCA 4KAJA 2FG6C 4Q4JB 2NGRA 3HP1A 3INRA 2I3AA 2AWOA 3LQ1A 1EQ2A 3SDBA 2B4QA 3GFRA 1MBZA 2WT4A 1SGWA 3RC2A 1CUBA 2KE5A 4CQLB 1COZA 1TPYA 2R85A 3FROA 4BP9A 3QZUA 4QGAA 1PE0A 1A04A 2X41A 2AXQA 4UPDA 5TB5A 1G21B 3RNLA 4AY2A 4ARZB 1M6VA 2IUSA 4D3FA 3TQCA 1PR1A 2OBMA 4RCYA 1Y9JA 4DDMA 3GD5A 3IDOA 2D5IA 3RVBA 2O8CA 1GYQA 3GO4A 1FNDA 2PPLA 4PHCA 1M6YA 5CW2A 5TPWB 1NBMD 4OGFA 2XMSA 3HL4A 5K0ZA 3WRWA 2REQA 3L06A 3EDQA 3AVQA 2XRYA 3RFFA 3NBUA 2P9HA 3EZ2A 4W7IA 5BN1A 1VECA 2KS6A 2MSLA 2HEIA 4IXTA 2NZWA 3RU2A 1I2ZA 3EDOA 2FLKA 3I8SA 2XWQA 5LMNB 3TQIA 3N7ZA 3A4MA 1YUBA 4KW7A 3IP5A 2PFSA 4J2TA 4WNIA 5KOJA 1KP3A 3AKCA 3KOOA 1CDOA 1E2FA 3IQGX 3VU3A 3IP8A 1S8OA 5CBKA 1FUEA 1EUYA 5B55A 2EX4A 3FBGA 2CYAA 1TZMA 1W35A 3K96A 2AV6A 3FUWA 3LHFA 4B3DA 1R0BA 3DNMA 4PRKA 4CQNA 1VZ2A 3DEZA 3P9QA 2C5BA 2FFHA 2OZGA 1VCOA 2HMUA 4H7FA 2OQ2A 4KIWA 3Q88A 1DFHA 4KJZA 1SNYA 3X43A 5JNLA 4DBLC 1O5IA 3FYUB 1FMTA 1QQAA 4M21A 1KZGB 1GFWA 1PW7A 3K0CA 3MJHA 2JFVA 3PUYA 3NT4A 3K2BA 4IMPA 3SQOA 3GNLA 1EDOA 3GIWA 3QWHA 3CVUA 3A9UA 4REMA 2FI1A 1G6OA 2P6UA 2ZSEA 3ICCA 1YVEI 1ZD8A 1AK9A 2JI7A 4C89A 1THTA 1DAPA 1UBMS 1JAHA 3HYNA 4QQKA 4X00A 4C0HA 3G2MA 1VBKA 2XDQA 3N8IA 1PNTA 5AJZA 5HUHA 3PJEA 5T41A 3RQIA 3VZBA 2BTQA 2QZ9A 4RJKA 2RHBA 1MJHA 4D2IA 1KU6A 2A94A 5BV1A 3JZFA 1KJ8A 3QKSA 3T4EA 4EY8A 3KZNA 3ASVA 4R2MA 4RWZA 4YV1A 2GD0A 2IU3A 2I2AA 3DBLA 3D02A 3KJQA 3CR3C 4PC3A 1IEXA 1UL1X 1SBZA 5HIJA 4EGAA 3CLHA 4L7QA 3KTAA 3FI9A 4R8KA 5L4LA 5DNEA 1X8XA 1D03A 1ACJA 2RIRA 5AKGA 4AMGA 5K99A 4X62B 1W4AA 4DSNA 2R1UA 1Z6PA 1QAOA 3CNUA 1FE8A 4M7RA 4N3AA 3OE4A 3VOTA 1MQAA 3KZOA 4GZ6A 3D0OA 3LBNA 1LH0A 2WSIA 4PEVA 3ILHA 4C88A 5FUYA 3U49A 1L8OA 5DTJA 3GT0A 4FYYA 5DI3B 4RTRA 1FFGA 2GEJA 4JP1A 3DZHA 1VI6A 4LRQA 1DDOA 1YQTA 1FBTA 1FFWA 2AFIB 3SHOA 5DRTA 3T7SA 1Y89A 3C6KA 1JIKA 3FJ1A 3M3PA 2BEVA 3AFOA 1QO0D 3K72B 3LTEA 3ZXIA 1XYVA 2AK2A 2NQ2C 3OP4A 4Y9DA 4CJXA 3TI9A 1QP7A 3P2KA 4US0R 1L1EA 4QELA 5HXAA 1KEVA 1IY1A 1WABA 5B1HA 1KR2A 2JL1A 3EXHC 4RGQA 1WX1A 4AL4A 4G8DA 1B26A 3HVRA 2ZQZA 4FGJA 5DTEA 3Q5GA 4INZA 1HDOA 4N39A 4TN5A 5DZSA 3LPMA 1XZAA 2RAVA 1GDHA 4WA8A 3O8QA 4BN4A 1KVTA 3SLRA 2EDAA 3LP5A 5EJ4A 1MAWA 1NWHA 3P1JA 2Q5OA 4WXEA 2B21A 4R7TA 3RRYA 1Z6GA 4RS4A 3USES 1PYOA 4O4JF 4V03A 4L5CA 3ZLBA 1Y4DE 1H4TA 1WSBA 2ZXEA 1CUEA 5KINB 1ZAKA 1V41E 4UHJA 4YGYA 2FP3A 3R7FA 2VJOA 3B2QA 4K5QA 3EF1A 2G82A 2PH1A 2PXHA 1X1SA 3G1TA 3AL3A 5AUQA 1H2XA 3C7KA 4AP6A 4CDRA 2HKIA 4PFQA 3RSCA 4UQOA 4BNNA 4DLTA 1MDBA 1QLWA 2O0KA 4HDMB 2V9ZA 2Y2UA 3FHCB 1AKTA 1VHQA 2QN9A 4ZCRA 2HJGA 3P32A 1KI6B 2ZIUB 1FYVA 2IA5A 2ZSBA 3BGOS 3LUFA 2CNLA 2QNIA 3IQFA 4BZZA 1J7JA 4XB2A 2CFTA 4Z86A 2OO5C 3MT9A 4YLEA 2NXCA 4ZDWA 3EQZA 1OLUA 4B6FA 2WEKA 1MX1A 2XNHA 4GQAA 2PCLA 3CFYA 1KTVA 3K9FC 4B48A 4ZK2A 4D5GA 2CHVA 2VP3A 3FAKA 1XSEA 4H59A 3IR5A 1HK7A 3JARA 1R0LA 1R6TA 2NWQA 3DE6X 3KQQA 3CUKA 3M1IA 1L6IA 3GB9A 4I2VA 4IS2A 5HKKD 4JBIA 5AWFC 3FDZB 1Z13A 4Z9FA 4IUDS 2VRWA 1RRKA 1JKXA 2DM6A 3ZCVA 4PNHA 1OMOA 2ZKLA 1JDUA 3FGOA 1B42A 1NDUA 3ZWAA 1N0HA 3FMVA 2DRIA 1OIWA 4WGGA 4DR6B 5KVAA 1KFCB 1DBIA 1OI2A 3RBVA 5ES3A 4ZVMA 1ZVJA 2ILTA 1CS0A 1QGAA 1WMDA 3KU4A 5DT9A 5E6SB 4ZGBA 3UAYA 4CF6A 4K87A 3NTRA 1VLMA 2C84A 4DJ5X 5GONF 1I33A 2I6QA 4ESVA 2O1XA 1LPBB 1R0KA 2NU7A 1L8XA 3QX9A 2DJ5A 1KK1A 2VSXA 4NCJA 3D1JA 4IDOA 2P4QA 2HRDA 3SSMA 3T41A 1TA4A 3DCNA 3EDMA 3FGNA 4RPCA 3N7UA 2OGSA 3F2VA 2W6JA 1T0BA 1A69A 4ER3A 1WMBA 4LDQA 4JT4A 2J6CA 3JS5A 1JHRA 1Q7RA 4JKIA 4PM4A 3FPJA 3FX2A 1U28C 1W0JA 3PDJA 4INPA 4PYNA 4NEQA 3U4GA 3W6OA 4QT4A 7REQB 1T2VA 1TZ2A 3SS7X 5D01A 5C1DA 3KEOA 2NVUA 3JQGB 3GFPA 3QWIA 4PTLA 4A1OA 2BWJA 4HB3A 1P80A 2WAMA 1CUCA 1Z0IA 5DK4A 5ED0A 4EGSA 3DL2A 1ATIA 2AK3A 3I1IA 4LZAA 2DTEA 3X0DA 5FTJA 3WLEA 3LVRE 4GMDA 2O9JA 4RK1A 4L8LA 4DYDA 1XPUA 3PC3A 2VP2A 4RVCA 3ZKWA 3B3QA 4ZREA 1XP8A 3RIXA 5K0TA 4HZUA 4M6WB 1ZUNB 1FFBA 2J9GA 4O4IA 4YCMA 2ZBVA 5CXSA 2C57A 4UCWA 3MMZA 3G59A 3U4AA 1JT2A 3WYGA 1X8JA 1T1RA 3H2YA 4PLTA 4E32A 2CXUA 4B4UA 2P9TA 4KSYA 3HPQA 1R4AA 2EBHX 3OT5A 4I3GA 5CNJA 2AZ4A 2GTHA 2ZTMA 3OQ6A 4Q1EA 3A27A 3EXG1 5FOVA 2MT9A 1YGYA 4XLLA 4BZPA 5SYMA 4KO1S 1QGDA 5LQCA 4LFBB 1ETUA 2WVAA 4YMIA 4UD2A 1VC2A 7ADHA 4CF7A 1G5PA 3CH6A 4BNVA 4US2R 3Q2KA 2JLRA 5LZ4A 2M6KA 1KBZA 3LDAA 2QR2A 5AI8A 2FMXA 3VO2A 5AP9A 2R4TA 1E3MA 1DRUA 3MD0A 4GP6A 5B1EA 3NKFA 2ODQA 2IBMA 3A6GA 1BRMA 2HRBA 2RGUA 4O4LB 2X13A 3G0GA 2O7SA 3IXLA 3OC6A 2BI4A 3L8DA 5F9HA 3C8DA 5IFLA 2C5HA 1QHGA 3LA8A 5AVUA 3I32A 2WWFA 1X94A 4TXJA 3WIUA 2BLLA 1EFUA 2QZSA 2IVZA 3LF2A 1E2GA 1NUTA 1YRYE 1H8ED 1R3DA 4L8WB 4KQ2A 1JIJA 3VHXB 3NM4A 4BV3A 1CDEA 3GA7A 3IMFA 4IIDA 5KJCA 2GVNA 1RHQA 2XUFA 3C48A 3G5UA 5BNWA 4ZN6A 1N7GA 2BKEA 3HB1A 4AS3A 1G9TA 2YINC 1BGVA 3ML1A 2E5LB 1XFDA 2BN4A 3OJOA 3QVTA 4OKIA 4PS1A 4YJ3B 4DYVA 3VPDA 5DHFA 1ZH0A 2W2QA 3DBRB 5JAOA 4TLLB 1QWOA 2ZUEA 4EG0A 5DM1A 1YVPA 1KO4A 2OFWA 3FF4A 4LRWA 4H7DA 2CHFA 1P4HA 2NZJA 3RRZA 2CWWA 3VYRB 2I71A 4TSFD 5FLKA 1RI4A 2C96A 1CK4A 1ND5A 2R3SA 3KOXA 5C8ZA 3HJBA 3UPTA 5TARA 2P0YA 1UDXA 2PUWA 1FLVA 3DL0A 3AHIA 3I2YX 2DT8A 4C0QC 3LKDA 4MWOA 3IFSA 5MFPA 4Y6OA 3ETCA 4XARA 1BEZA 2H06A 2YIMA 3DTYA 1HL7A 2E5FA 2PMBA 4MRVA 4MW7A 3DZBA 4TS1A 4NFYA 4K9RA 2PT5A 3R0XA 1B8OA 3DGEC 3NBYC 4OQNA 3RH0A 2VNHA 2BW0A 2ETVA 3F98A 3H7AA 4F6RA 1N1EA 1W88B 3QPVA 5FYQA 1P81A 4L4YA 1KDVA 2D7CA 3IV6A 3WXMA 2XTMA 5IXSA 5LQDA 4D8VA 2BM1A 3VM6A 1W4ZA 2IPXA 1WY5A 2NTEA 3M7IA 3AHGA 1E66A 5K09A 1NJ2A 1JPNA 2MYNA 3IHLA 2I78A 2J4FA 3AV0B 4PCUA 4AIIA 1ZMRA 1RFLA 3DZDA 3QMVA 5LLSA 4REQB 3UJ7A 1FDSA 4QRIA 3CVXA 5B36A 1F2UB 3PRJA 1G20A 4MVWA 4A0SA 3OX4A 2ZUUA 2BFMA 3FDIA 3NHJA 5CPBA 2P62A 3SWWA 4KMSA 1I3MA 1DKLA 1M10A 1LPMA 2C0CA 2DT5A 2NACA 1P4AA 2NV0A 4I14A 4CWAA 2JGMA 1YA6A 4MGEA 5FWYB 3GEIA 1KO8A 4N5HX 5ER9A 1QV9A 2GAOA 2B4YA 3SBOA 5D5HA 3WDMA 3C98A 1W5BA 4IJ6A 2B0JA 3AEQA 4X8LA 5CUQA 3VDMA 1LS1A 2XCSB 3HI6A 3QH4A 3KSAC 4XSVA 1E4EA 4OHKA 5ALLA 4YRNA 4D98A 3STHA 4ZPXA 2PUHA 3L0IB 4OJQA 4ZYTA 1F51E 4G65A 3WNQA 2V4MA 5LOVB 4JI4B 1YHZA 4PZ9A 4JUBA 1X7ZA 3B1WA 5DOZA 2XRZA 1T8YA 4OBWA 3KV1A 2HK9A 1BOFA 2QD1A 3PIDA 3ZCTA 4NLLA 4YQYA 4QD3A 4XTCS 1ESZA 3UOAB 5HNKA 5BQPA 3LPAA 1GU1A 2AG0A 3LUBA 3TTVA 1WCIA 4E5DA 4EB8A 3O8CA 3E0XA 2ZJ7A 3KLOA 1EFCA 1RZVA 3OHMA 4FMCB 1ZSVA 2ZJ8A 5H3CA 3WYFA 4MX8A 5H16A 2O1SA 3HU1A 1SCDA 4MB2A 4ZQIA 5DU2A 2OWDA 4URYR 1Q11A 4YRIA 5DTMA 4EUKA 3E18A 4R0NA 4HWRA 4F97A 1O89A 2XIJA 1F4VA 3LCCA 4DCPA 1LTKA 1XCMA 4MOWA 1ZS9A 2HK6A 1II0A 2II6A 2NP6A 3C15C 3EC1A 4CZ2A 4NZNA 1I94B 3VPSA 2TSYB 1WHSA 2VQSA 13PKA 3MWEB 4IL5A 2C7GA 3C6QA 4OYLA 4WEOA 5CA0B 5BQ3A 5KX5F 1M6NA 4IQFA 3T1QA 1I24A 2C9YA 3H4TA 2X0NA 3S4YA 2IHKA 2FSVA 1RAGA 3WWCA 1MTZA 2ZDHA 4PBSA 3A9VA 4U9HS 3C3JA 2N9UA 4HGZA 5AHRA 3UKDA 1Q0LA 2BZSA 3UUWA 2YHAA 1L6RA 4Q18A 3H9CA 3KQVA 2DGDA 2VJKA 3IODA 1XEFA 1YBFA 2K4MA 1SURA 1VSUA 2BSXA 2XE7A 4YJGB 8ABPA 1L7XA 3N28A 4OHXA 4HLUA 3ESYA 1F0PA 4FGWA 4ROTA 4TMKA 5CYOA 3ZDRA 1UMCB 1YIAA 4E6PA 5AW6A 3H2SA 4OHBA 1T4MA 1Z7BA 4PHTA 4N65A 4LGVA 4XRRA 5CA1B 4JT9A 3M4XA 3O74A 1H9CA 1GZHB 1YB1A 1EJ2A 2D0OB 3D6MA 3IOCA 3AGPA 4JEIA 4DMRA 2D3TA 3DKKA 1T6ZA 4ANFA 1H42A 3PZBA 4LXQA 2KLHA 4NOLA 4CIWA 4QPDA 3G5AA 4PAGA 3BF7A 4KSCA 3EH1A 3P2IA 1L4HA 3WYCA 1QQTA 4JXXA 3MUFA 2QTTA 4D0NA 1J97A 2HMWA 3EUFA 1B6TA 3FMIA 1H66A 1G55A 2WWXA 3D5TA 1KYQA 4GICA 4R1OA 1X1AA 1H6AA 2O5CA 1J4AA 5AKZA 2WJJA 3UHJA 4S35A 1WVGA 3RC1A 1DXYA 4BP3A 4HPXB 3PWZA 4EFDA 1C3VA 3BEOA 3UATA 4JV5B 1T9KA 5CK4A 5FBVB 1M34A 3A4LA 3CIFA 4MQFB 3TGLA 1FJXA 3EG9A 2G6BA 4RA9A 1HSZA 4G0NA 4L2IB 4F3CA 3BG5A 5EGNA 4IJ5A 3ZIAD 1XDWA 1UDBA 3GPBA 4OM7A 3MTBA 1X80A 4U0JA 3W5HA 2QTVA 1PUIA 2GN4A 1PU2A 3OUUA 4TTSA 1UMBA 1KK2A 4D02A 3P0HA 5DM0A 1ZEMA 3F3YA 1GUDA 3BKXA 4M37A 3H1FA 4GO1A 4LY9A 1G19A 2BBWA 3W2EA 2O2CA 4E46A 4TWRA 1IOWA 2NUPA 4P92A 4PQYA 1HDRA 1DL5A 1KYXA 4U2BA 1P2VA 3EPPA 3IX7A 3SF0A 2GHTA 2XE8A 3CEAA 4INOA 4D99A 5A04A 4Z4CA 3D3JA 1E3TA 2HWYA 1P7ZA 2Z9CA 4PPGA 1KE2A 5A5VA 5K0JA 3S7TA 3ZU3A 1CJUC 1B4DA 1L4LA 4HNQA 4WCVA 4C6TA 2QLJA 5C5CA 2XB4A 4D45A 3GRFA 1H8HA 3SR3A 2F43B 2BFPA 4B3BA 1IPEA 4A26A 1R9JA 4FT2A 3TPZA 1DVRA 2FUNB 4RJ2A 3SFVA 2CZGA 1Z2DA 4OA5A 3WJ7A 5BXYA 4MYRA 3X2SA 4BC0A 2KSIA 1G5RA 1A5SB 4ZI3A 2H59A 3WL7A 5AM0A 2DLDA 3E3AA 3B3FA 3BXHA 4GI3A 4QYTA 4RADA 1LSOA 4E4YA 1JG2A 2WHYA 4HX5A 3EVZA 4GYWA 5EL0A 1OBCA 3VDRA 3BXXA 4JYBA 1O4WA 3WIEA 1PGPA 3G82C 2AFHA 3OQNA 2YJTD 1YQUA 2XTJA 3U7HB 1DC3A 4LJSA 1WB9A 3B7PA 4MRMA 1LWNA 3HCDA 3IEXA 2G5CA 3HXTA 3QUBA 3U13A 5BN5A 4XLTA 1GR0A 1KP2A 3M6AA 5K3AA 4FBLA 5JCJA 1I3LA 2IP1A 5E4TA 4C7XA 5ALPA 2DPMA 1TVEA 1RRFA 1DAIA 1LUAA 2LUOA 1DZ3A 2VUHB 2W2LD 3DLTA 4S1NA 4JBNA 4WOCA 2BCJQ 3Q7TA 2GZMA 1V0JA 3GFTA 5KJ1A 1ARZA 1RC0A 2EKLA 3RSQA 4GDMA 1OLXB 3BRWD 4RL4A 4YRKA 5ADWA 4YXWD 5LUAA 2D00A 1NSYA 1MC5A 1A8HA 4XFJA 2NU8A 2CJWA 2P8SA 2K7FA 1EQAA 3I37X 3PXCX 5TQ2B 4O3FA 5E95A 3G9QA 4Q19A 1TVKB 5AOVA 3ZQKA 1K98A 4DIOA 3WR5A 4Y2QA 3WB2A 1MJFA 2VSOA 3G3EA 3CUEF 1ZH8A 4L5IA 3OTOB 4F2GA 2OG1A 2I3BA 2NBMA 3GNTA 3RLFA 3GR6A 4FFOA 3WIVA 3SG0A 4OLBA 1WMSA 1GOTA 1MA3A 1U80A 2VYNA 1M0WA 5DLPA 2I7CA 4AKEA 1SQ6A 4CETA 4ZU1X 5KYUA 3I53A 1C0EA 1DAEA 1DJNA 1LV8A 1PNOA 1YKSA 2R96A 3AYZB 1RKVA 4HN2A 2OPHA 3VO9A 1E9BA 3GRZA 4XD2A 1GTMA 4Q9AA 3OX1A 1JXMA 4NZ9A 4DA6A 1DX6A 2DHEA 4UNQA 3RABA 1XNQB 5C9ZA 1QIGA 4P3OA 1YSCA 2WTEA 4QB9A 4Q66C 2EP7A 2ZULA 2ZIAA 4YPVA 4J3FA 1HOXA 3D4BA 5E0KB 4JHXA 4Q4JA 2QUHA 3X1WA 3R76A 2XKKA 4TUYF 3UHAA 1GCGA 5KNDA 3L7JA 3L7IA 3PPWA 4ZMBA 4QXRA 5SY4A 2J6HA 3EZ7A 4LXYA 1TNDA 1RAFA 1M5UA 4DUGA 4CQLA 5BT8A 2OZVA 2YR0A 3RASA 1AJEA 1RI1A 4ASUA 1G21A 3TFOA 4O2AF 2RI1A 4ARZA 1EGMB 1IB0A 4DLVA 4C78A 2F67A 2JLCA 1Q7EA 2G5GX 1DZIA 4BO5A 5TPWA 2VLBA 2JH3A 1NXXA 1VJ0A 3CNEA 4PINA 4L8FA 4Y3UA 3HBMA 4DV3B 4NR0A 1BJKA 1DDIA 1F4LA 2NNWB 1NW4A 4WZAA 4TYWA 5CLQA 2HV8A 4D1YA 3EPLA 4DV5B 1U63A 1E58A 1N3IA 1QJCA 1XHEA 4ZVLA 4Q3DA 1QIEA 1N6NA 1VM6A 4IVRA 4MPTA 2O54A 2Q8PA 4KYVA 2OP1A 2EGUA 1QZTA 4XX0B 4MIKA 5G1NA 4Z1MD 1GQYA 3BH6A 2RCNA 3AILA 1V8PA 3ZHYA 1W73A 4LC0A 1L7RA 3H2JA 5F5XA 3U7FB 4NWIA 3BPSA 3E8XA 1IIRA 3QPAA 1QQ7A 5JW6A 2IPAB 3H5LA 4J7CA 4BQPA 4DMHA 5B30A 2AMVA 2Y76A 1Z2CA 2HMVA 2ZAYA 3LVBA 5CVJA 2OVBA 4R3UC 3M5DA 2YZKA 4Q3CA 2O5EA 3FYUA 2RGNA 3UAZA 1GA4A 3OOWA 4C06A 2OVFA 3EH2A 1L7BA 3PX3A 1EBUA 3CY6A 1ATZA 1E1NA 1FFXB 1GZ4A 4GGPA 4ALKA 3ZZ1A 1I3NA 3IQZA 2ZRPA 4IYRA 4OL0A 4NBNA 4ZA2A 3EPHA 4I50F 2JJYA 1JPJA 1S8FA 1C7JA 1NUAA 3BUSA 1MVLA 4Q12A 3AUSA 5HF5A 3WK6A 2H9YA 2EJTA 1AQIA 3DULA 1GU7A 4V0ME 2C9BA 4UHDA 4FDUA 4OXIA 4QEZA 4MCJA 4V3BA 4X20B 4EZEA 4RFLA 3RC7A 1Q57A 1I2MA 4JUIA 3X44A 5COBA 4C0LA 4DLKA 3DFZA 4GMFA 4EHKA 4OH7A 3KQPA 3FHOA 4F2WA 2RBKA 2JLSA 5HW0A 1NOKA 1WXQA 3AR4A 1EPUA 1QLHA 1REQB 1EE2A 3T3DA 3PVCA 1E0AA 3R23A 2X14A 1UWLA 4J6EA 1DTSA 1O0BA 4JZYA 1M2NA 3B52X 3QJGA 1PZMA 4JY7A 4W63A 3VR6A 1P7VA 1R0XA 2XODA 3FMOB 1QOZA 2NPIA 3ISVA 3Q3JB 2PL9A 3AJEA 1E3DA 4PC6A 4TMTA 1ULUA 4UAGA 3W4IA 3NALA 1V11A 1WOYA 3C43A 4D9EA 1NC3A 1S3IA 1KHHA 3VYTB 4GFDA 2OK7A 4D4HA 1TYAE 2QN3A 4MKGA 3CWQA 3VO1A 4RTOA 1YL6A 1VLLA 5BNTA 1ZVQA 4PRLA 3DYVA 3LSTA 2PL5A 3VX4A 4DIUA 2R00C 2HCBA 3JQ9A 5DI3A 2VT6A 5KPJA 1OGIA 1JDVA 2O2DA 2DUMA 3KKLA 2H2GA 2FWNA 5BSEA 3PGVA 5BT9A 1VDMA 2AFIA 2VPIA 2XOXA 3DB2A 1FRVA 3IP9A 5IAOA 1JQAA 2BH2A 4OHVA 4RD1A 5AKJA 3FNGA 4LVOA 2WTAA 1AM4D 3G1UA 4PG7A 5EWMB 5T8KA 1UZMA 2CFCA 4RDXA 4EHNA 1IOZA 1T5OA 3OTWA 2ZWVA 4DLNA 3JYOA 4ZQCB 3SSNA 4I5IA 4KV9A 4PZDA 4BBZA 4H0NA 4C4PA 2GRUA 2CB0A 1W8IA 2BRUA 4JBWA 2FOIA 2ENWA 4XGKA 3TKLA 3CO0S 2BCGY 5HIKA 2VT2A 4FHFA 3EVDA 4TLEA 1JSXA 2C42A 2HU2A 1IG0A 2Q4EA 3R3YA 4RK6A 1TK2A 2OXCA 2QU8A 2Y92A 1XCBA 2OCDA 3TDNA 2OV8A 1P44A 2VZ8A 1Z2PX 1Y81A 4FXOA 4CCSA 4BQIA 3GP3A 5KYTA 5SYAA 3UICA 4C1NA 1FRNA 1LBIA 1H5UA 2ZVJA 1XJCA 2F4NA 3KD2A 4Y2PA 3T1YB 1HLFA 1G2QA 3EIQA 2WV7A 2GPYA 4BKMA 1A77A 1T36B 4KDFA 3CKLA 3T54A 3KB8A 1OA0A 5BSVA 5BMOA 2ATXA 5D8DA 3L05A 2OV1A 3HV2A 3F7OA 2QPLA 4KLRA 3QPBA 4ZMRA 2B94A 4HDMA 4E09A 4W1RA 2XGGA 3HA7A 4OHOA 4ZCLA 2I4RA 1EAMA 3UK0A 3PC4A 5AW5A 2VHJA 3CWZA 5TVGA 3STUA 1P9OA 3WLTA 4CRWB 1JNXX 3OWOA 5G0TA 1Y1SA 1ZICA 2B1IA 3IP1A 4TWJA 1W4CA 2JASA 4TYMA 6PFKA 1WXWA 3ICQB 3G0CA 2Q1SA 4X85A 4OPMA 5KU7A 1XTRA 2Q3CA 2DERA 1TYBE 4LZJA 1NUQA 2HXSA 4FDLA 1J7KA 3GWZA 3RPEA 4YQFA 1KQOA 1DJMA 2X8BA 5BNFA 3L9WA 4GE0A 2RJOA 3MPUA 1HTBA 3JD3A 2O52A 3NHUA 2QI9C 3DAHA 4MVJD 5TS2A 2FHPA 3TLBA 4CT0A 2VDMB 4CODB 3FDZA 5I7WA 3ADKA 5G2OA 3F2IA 1TMKA 3G2JA 4LJ7A 3PJFA 4ENPA 2AJBA 1VGVA 4U9IS 1GGFA 3PNBA 4IIVA 5JDCC 2WYVA 2H1OA 1QZXA 3ZWOA 1J0CA 2D1FA 1R0SA 4JEMA 1FDOA 4K8RB 5IBCA 5IKMA 3OIDA 3C6XA 3F8SA 5E6SA 3ZV6A 1GZSA 2F3QA 3ABQB 4ALMA 5ALSA 2UXDB 3LYLA 3V4FA 4LA4A 1LSUA 1V1RB 2G9UA 2LVBA 3DJYA 1Z56C 3BBLA 1IU9A 3LBHA 4LV6A 1Q91A 2AKAB 4NYIQ 8AT1A 2BMJA 1ZRSA 3DCIA 5KJFA 1C4XA 3D4IA 4G85A 1MORA 2BF4A 4O5AA 1J1ZA 1FQJA 4NL4H 3G1WA 4WKGA 3SVZA 4F91B 3I23A 4M8SA 1RWXA 1BA3A 3C7DB 2GA9A 4BQNA 5EFOA 1IMJA 4D0RA 4GLLA 1Z7WA 4U7FA 2YZ2A 4YP5A 1KFJB 3A1EA 2B6NA 2O3SA 4DMFA 1QDEA 5JHHB 1G59A 2G3YA 2DLCX 4QG7A 1OYWA 3D2LA 2DQZA 2W7TA 4ZOCA 1O1YA 3DO6A 5DMHA 3FMPB 4ZI7B 2AD1A 4M8KA 3PWTA 3CX4A 3CUTA 4KCGA 3CVYA 2QGFA 1ZIXA 1TGVA 2JRCA 2KYRA 2ZANA 4IQ8A 2JLAA 3TIIA 7REQA 5IM4F 1S1CA 1CP3A 3JQGA 3ROZA 4OGLA 3AM4A 3DO5A 4C0SA 1KZ6A 2EWWA 4HAWA 4LECA 3P2EA 3M6LA 4MZXA 1CUYA 3PL5A 4LGCA 1ADYA 3AWIA 2A0UA 3QG5A 1YHNA 4MQEB 5AXDA 1Q14A 3SYTA 1I32A 1XKQA 5AI9A 5GVRA 1H2YA 1ZUNA 4M6WA 4E7OA 3R0JA 4M1OA 3BL6A 2R66A 1QGED 5JD6A 3SZUA 4KPUA 3UTCA 3SHTA 1JA0A 1NSTA 3R2JA 4QEKA 3WKBA 1E3JA 4BGUA 2B30A 5BMVF 1SD1A 4MS4B 2QBYB 1UODA 1W2WB 1N0IA 3E9EA 5BR4A 1OFUA 2PH5A 1N5OX 3ISJA 5FADA 1KP9A 3CMCO 4K2AA 3PJDA 3BMOB 5CFZA 2JG3A 3ZWCA 4L1KA 2O7VA 1CERA 4IHKA 2RHMA 3VNAA 3LWDA 4MA5A 1IHYA 1L5YA 4YFVA 4FFMA 1VE9A 4WFIA 2FW0A 1VHTA 1OWLA 3DVAB 2Q6KA 4N7JA 1A2KC 1PN3A 1QTRA 1WQ3A 1FP4B 1OY1A 2AJDA 1L5LA 3M2TA 3R5XA 4QX6A 1H2WA 4ZC1A 4W5JA 3MJDA 5IKPA 1XU9A 5DPMA 4JC8A 3ROPA 1ZNZA 1K06A 3Q3GE 3DAYA 2FNAA 3F8TA 1EDBA 4DCTA 4O4LA 4YPOA 4OLHA 5FEUA 4OHCA 5TPZD 1GGJA 1UK7A 1M8GA 1XCPA 2QAJA 3Q3IA 2E2WA 2PEYA 3VAYA 4ACAA 3IMGA 3AVUA 3LUGA 4ZVNA 2R1VB 4IH1A 4JMLA 4KDCA 2ZT8A 5JJLA 2ZRLA 5FQOA 3VR5D 1OI3A 4TTPA 4UBOA 5A5DA 2UXBB 1EFPB 2QLTA 3LK7A 5JRDS 1QAQA 2V7BA 1YS6A 2P4HX 3CT6A 2WU3A 1WE2A 3DDNA 3GC6A 1AQLA 2IFTA 4KQXA 2E55A 1MX5A 1ZGGA 2A6PA 2WF7A 5AM3A 4AX4A 3MHTA 2E0IA 4YJ3A 3U48A 1N32B 2GK4A 3DBRA 2AYYA 4LW8A 3E53A 2P1RA 4PWZA 4CMBA 2UZ3A 5T57A 2IYLD 2I00A 1HF3A 5FWNA 3WYDA 3GPDG 4NVRA 1R27A 4IW3B 5H81A 4YQEA 1IVSA 2FMFA 1LCIA 2IX9A 3PWSA 4B7XA 5I7VA 2G9ZA 2QMEA 2RHCA 4YMLA 4RMIA 4RULA 1KDOA 2P4EA 1ZH6A 3NAZA 4IIJB 1ZLYA 2H9IA 5BQOA 2R8OA 1E2DA 4F12A 2DBQA 1ZLXA 5KYYB 1KNXA 2CY0A 4GBMA 3UB2A 1KRWA 1GWNA 4MB6A 5ALDA 2C83A 3NYIA 5CH5A 2FR1A 3NOQA 4JFAA 1W88A 5DBHX 4MGKR 2Y71A 3N07A 2AHRA 3JR7A 2JFWA 3PQ6A 3BGVA 4GC5A 4XYGA 1TT5B 4L15A 4KI7A 3UMFA 5G0WA 1PDWA 6ADHA 1NM5A 1WZ2A 4LWPA 1RZRA 1W9MA 4RD4A 2YC4C 4JVNA 4REQA 1ZXBA 1LDYA 1RWBA 2R25B 3UJ8A 3EUEA 3O0TA 1A98A 1FPQA 5GV8A 3UPUA 1F2UA 2OD9A 2QSJA 1YRAA 1D1TA 1OTYA 3G68A 2CDRA 5JNRA 3DLHA 3NHWA 4TTQA 3PQDA 4PYLA 4RZSA 3U19A 3N53A 2OC9A 4G25A 5B4VA 2ODNA 3LDUA 3ZX4A 2HWUA 3DXYA 2DMRA 3GEEA 4BUJA 1X1CA 2XCQA 3V4VB 3KSMA 1RYNA 3IJEB 1YC2A 3D7LA 2X2OA 3EGVA 3Q2OA 5FWYA 4CDGA 4A2WA 3DOEA 1GUYA 1SIWA 2O3QA 3WXBA 2HA2A 2NYUA 5JROA 2ZE7A 3GG2A 4Z5XA 4JGXA 3D6VA 1WIWA 2J31A 3FPKA 4RZXA 3M1AA 2DHRA 1SCNE 4DR3B 4JQYA 5TMEA 4DCOA 1D4OA 2VP5A 1G1AA 3KTOA 3W5JA 4DCUA 2FEKA 3LPLA 4P98A 5GV7A 4BNDB 2A9FA 3D54D 2PWAA 2P3OA 3TINA 1C8BA 1L4UA 1T9CA 3M4NA 3UMBA 4NYMR 3V55A 1TRKA 5EUCA 1FX1A 4LY0A 1K75A 3B9QA 1B8UA 2CEKA 2QZJA 4Q9KA 4P3NA 1VLQA 4RMHA 4WUVA 2HLDD 2Y0EA 4R1TA 3L43A 3K32A 1IDOA 2P41A 4N40A 3F3KA 3OKFA 1VA5A 4LXHA 5KNDH 1NYQA 2NZ8A 1PYGA 4KO2S 3NWJA 4M36A 5K4HA 2OZKA 4GWGA 1XE3A 1ACMA 1XTZA 3AB3A 4UM5A 5DXJA 3NQ41 4B71A 3WJAA 5M2QA 2VBFA 4J49A 3R6WA 3R3HA 2HBZA 3VC3A 4IAOA 3I0ZA 1RBQA 4C03A 2ZIZA 1I10A 4IRXA 1E59A 1R8JA 2DFNA 2XVAA 4HDNB 3QXJA 4MV6A 4AG6A 4C0JA 1N3YA 1RM0A 4WN9A 4KH1A 3BT7A 1KAHA 1PJTA 4G1BA 4EO4A 3Q10A 1T10A 1UJMA 3R3VA 3O3CA 5ECDA 4Z7QB 1B15A 2QSZA 3JX9A 2PUTA 3OQHA 2FZWA 5T64A 3I30X 3AX6A 4EUFA 1ISPA 4FVTA 3F6YA 3OC0A 4D3DA 1Z39A 3W8DA 4ZJZA 5FAXA 1EEXB 2FDXA 4M38A 1U8EA 3F6SA 1U8UA 2IW3A 4GLJA 4DLSA 1BYIA 1XLTA 3EULA 4GP7A 4D3ZA 3LHSA 3R74A 2X2PA 5JBIA 1EP1B 4OMCA 4AV7A 1L5VA 1HM5A 4IBOA 4MUYA 5CRIA 5BPFA 5AQEA 3QW4B 4UUNA 2BTEA 5CA0A 4FQ8A 3GOHA 2ECKA 4ND3A 1T9DA 1O0CA 5DT2A 4P38A 1TECE 1E6MA 3RVLA 1FTSA 3LYUA 3BWXA 3Q8LA 4AC9A 2FMTA 4HGQA 2A9PA 3EZ6A 5DCLA 3VSEA 2MR6A 3BL5A 2ZU6A 4YJGA 1J8QA 1FNBA 3TOXA 3ZDDA 1N6HA 2FSSA 3JQBA 3LAWA 4IF6A 4BPBA 3A9RA 1Z68A 1RPNA 1NF2A 4MO2A 2ZI9A 4JC0A 1JQDA 1POWA 3HDVA 1LEHA 3GLUA 1ZN8A 3TIXB 1UMCA 1QFMA 1Y8QB 1DWOA 5D1HA 4ZV7A 1QTQA 1NW3A 2EV9A 2XMZA 5CA1A 5JAZA 5LZ9A 4IWXA 2TMDA 8ATCA 4NULA 3KR2A 2VPZA 4G0XA 2G9RA 3GXOA 1D09A 2AG1A 1BC5A 2FUG1 4YP9A 3A1UA 6ABPA 1U3GA 4DLXA 2CL0X 2Q49A 1C3LA 2VCEA 4PGAA 3HO1A 1GZ7A 2J46A 1I14A 1T25A 4FONA 1KEZA 3I61A 3VNUA 3LBYA 2JJMA 4NRDA 2IYZA 2JVKA 4ZDJA 4BVHA 1NI3A 4EARA 4WXRA 1S7GA 1FPMA 2TECE 1VP9A 2I1VB 3BM5A 3KKMA 4H7JA 4B3HA 1HORA 5IVIA 2BMFA 1JG6A 4H16A 2N75A 1ZITA 2D2VA 1GRQA 3VR6H 4UW9A 5ILGA 5C1IA 3CG0A 3VGJA 1LC3A 4BNJA 2C2XA 5IDXA 2R4QA 1BKSB 1T1SA 3EVCA 2NYVA 4QO7A 2OGUA 3IILA 3PFHA 1U9IA 3N86A 1ORRA 3F47A 1NNUA 2OLEA 5M3BA 1RWPA 1YZ3A 4L2IA 1LU9A 1N5KA 1VCIA 5K4GA 4TWIA 1XZKA 5CBPB 4R8RA 3WBJA 1KE1A 3PCXA 1ZVKA 3ER9A 2JLYA 4EB0A 2YV3A 5KNLA 4MUIA 2ZUFA 5CFQA 4HWOA 1IHPA 1KDPA 3IAFA 3DHWC 2A4KA 1RP1A 3E27A 4LI0A 4LSZA 4RSRA 4ZOAA 5T4BA 1E98A 5HX7A 1RJDA 4DMCA 3B3GA 4TV9B 1TZCA 3WQSB 1DU4A 4GKAA 4JYPA 3ZN2A 2B5WA 4IO1A 2FDCA 2CHGA 4GR9A 3BORA 4DV4B 5BRJA 4YJ2B 3GUVA 4Q16A 2P9JA 4ZICA 3LV8A 3I76A 5A3QA 1Q1GA 4KZPA 3H17A 2RONA 5EUBA 3RANA 4C5BA 1N5JA 4G0WA 1GUFA 5BUZA 1G7RA 2PH3A 2XOKA 2HHJA 2F43A 3CKKA 3DYBA 3PT9A 4XYBA 5ETJA 4H1WA 1UFKA 4JGIA 4JS0A 4W5WA 3H04A 2BMAA 1HYGA 1YIDA 1FQOA 2EZ8A 4GLBA 3WDLA 4HXGA 7AT1A 4D57A 2C3MA 3FWNA 2CFRA 4PX9A 4QGFA 3JQCA 4YK7A 2XLBA 2C92A 1GY8A 4MQMA 1E89A 1IH8A 2ES4A 3L1IA 1ODCA 2MINB 2RMKA 2YW2A 4RLQA 3J7AC 3DFMA 5F33A 3VOSA 3CWCA 1SVIA 3ZWVA 3L3BA 4L9AA 3VTZA 2B4KA 4PSDA 2FWJA 3WIBA 2A86A 1SUAA 4TLDA 1S5PA 4YASA 4OU5A 3GCZA 3MJRA 3OCWA 1Y82A 3C3AA 2Q62A 2Z09A 3QSGA 4P93A 2O3UA 2AOXA 3LY7A 2WIKA 2XMBA 3DXZA 1EUDB 2Q21A 4AF7A 2C77A 1I1NA 3H3FA 3FF1A 3R5FA 3O6VA 4QGSA 2VF8A 1ZK1A 2PZMA 4UBNA 1ZD2P 1CR0A 1CRQA 3MBKA 2QP9X 4Q21A 3K9QO 4LZWA 2EJVA 3GP5A 1IVNA 1T2EA 2W70A 1DQPA 1H6CA 3WL5A 4LF6B 1NRIA 4U3JB 5EP1A 3LDFA 1EHIA 2FPGA 3ABSB 3I8XA 3DHNA 4FYPA 2R8PA 3OA0A 2EZTA 2QTBA 1QCDA 3JRXA 1TFRA 1NI4B 3AR8A 2VSYA 4H7KA 3QPUA 3FIUA 5AOBA 2GDZA 1HA3A 4RSGA 1Z6TA 5TQ2A 3WDKA 1TYEB 2GXSA 2X4DA 2XQGA 5FNVB 2G4LA 1XO1A 3NIFB 2JVIA 4OQYA 5F23A 3ZEAA 1HNXB 1LVUA 1HX7A 4OJNA 1OYOA 4XYMA 3V80A 4BFSA 2XMQA 1UBRS 2GCOB 1PKXA 2VH2A 4BFZA 4O59O 3WK8A 1TGYA 3OCZA 4YMHA 1RQLA 4O4HB 1AF4A 3ILSA 5KDDA 2BZGA 2VDNB 5I47A 3DOOA 3NBMA 5I9IA 1KJYA 4NBUA 5JNVA 4EBBA 1I01A 4Q9DA 1YUMA 3GJ6A 2IHTA 1T5SA 2YHEA 4RXTA 2Y1EA 3GJYA 4OAOA 1YKGA 2BFDB 3ZDXB 4BMVA 5T4HA 2BISA 1T1JA 3OIVA 2AXPA 4D8XA 1GV1A 3TW8A 1VIYA 1U1FA 5KVCA 4HI0E 2CXTA 1KOJA 1IBKB 2XYHA 4XW2A 4LPKA 2VDVE 1KO1A 1BJRE 1BVRA 1RXUA 2WHEA 4B87A 4BO1A 2PZGA 3CONA 5THQA 2XF2A 2WUGA 2YRFA 3O91A 1VLJA 5EMMA 2G88A 4LQLA 5FOWA 1GILA 1LK5A 1IHOA 3I72A 2IYNA 2KLBA 3HCWA 3UG7A 4P82A 2X86A 4EY5A 1SUSA 1SZPA 1F8XA 1U1CA 5CLJA 2VCYA 3RUDA 2CV2A 1PEKE 2D13A 2TS1A 2PD4A 1XN4A 1EK5A 4G07A 3KPVA 3FMFA 3H9QA 4KN8A 4WINA 1VGQA 4IJKA 4QTXA 5B1SA 2AKYA 3EB9A 4DLAA 1JILA 3SN6A 2IXAA 4Q47A 5K51A 4MRRA 4EJ6A 2ESRA 5AVWA 3BQNB 1H2AS 2Y9MB 2MR5A 4LZZA 2DBZA 1V5EA 2JCBA 1IY8A 2PKQO 3A8TA 3JVDA 3LECA 2FSFA 4O4IF 1ADCA 2YZNA 2B2CA 3AF6A 5A5GA 2XVXA 2G40A 3EWIA 2J6BA 1IUKA 4XX0A 1OX4B 2Q4OA 1LJUA 3FKSD 2QG4A 1D0IA 4MW2A 4DCMA 2UYQA 3C8UA 2FX2A 1LX6A 4HEA6 3S70A 4A1FA 4BEJA 1UPXA 2OT3B 3DHYA 5BSHA 1QTIA 5JARA 3CZ4A 5K8LA 3PKIA 4XKJA 5MDHA 4JI6B 3U31A 4M49A 3TAUA 3TSWA 2VR1A 3OJLA 3NCTA 2HHHB 1EX7A 1P61B 3GGPA 1UJNA 4E5VA 5F4BA 3CB2A 1PTKA 4X91A 5GJBA 3JU3A 1MOZA 3TX2A 1J0AA 3DXFA 5AVKA 2FX3A 1JDZA 1FFXA 2R6AA 3WJ2A 1D6NA 4M1MA 4QOGA 2JJ8A 3WBBA 1M0EA 4L57A 4ND2A 1B0AA 4DA7A 1ORWA 3TZKA 1H23A 3PTAA 5ALIA 3EEFA 2GJ9A 2BVNA 3A06A 2ZQYA 3EXHA 3HR4A 1NFFA 4JJ6A 4L9SA 1OE0A 4NARA 3AEKB 2CYBA 2ISCA 5E3JA 3U6KA 2H2IA 3PE4A 4IJMA 4X20A 5FTLA 5BW8A 1JIQA 1WF6A 5IM5A 4UAVA 4KAXA 1DKMA 2V8OA 4J0GA 3T7CA 5JRJA 2W2MA 4S24A 2I67A 4WVLA 4BO4A 1CF9A 3LOPA 3AHDA 3A32A 1REQA 1FS4A 3JPYA 4DR2B 3EGCA 3U80A 2V96A 4DTIA 3V7UA 1VPDA 1Q12A 3G0OA 3WLLA 5JWOA 3E3NA 3TJZA 4EG4A 4M0MA 1KSGA 2NUTA 5A1TA 5L6MB 3SM9A 2Y4OA 1I5EA 2A9RA 3QV1A 1A95A 3KYBA 2UYOA 2XA9A 1WM1A 2VF7A 5K3DA 3IE0A 1JYFA 1XTBA 2H65A 4HVAA 5A0TA 5G3YA 2EERA 2FSHA 1QHFA 1SZDA 2JDIA 4Y1RB 1OH7A 5C5DA 2N0SA 3I2JA 1O94D 2GBCA 2H3EA 1YJQA 2A0XA 1P6XA 2H4HA 2JEOA 2W6PA 2W71A 3ICWA 2OO5A 1P8AA 5JCZA 5CYGA 3ADBA 1U5BB 1I1QB 1Y9AA 2FY8A 2WSMA 3A2MA 4ZXFA 3FLMA 4LV5B 4F9GA 1V5GA 3HY6A 3O8BA 1K9SA 4MPJA 5AR1A 2ZREA 1I2DA 1ISGA 3M8KA 5JD4A 1USGA 3CBQA 4MINA 5EWMA 2D1TA 3ANMA 1J90A 4MV9A 5CCDA 3V8MA 3V8EA 3WQQA 4PS0A 4EA7A 3N0XA 5LL6P 3OEYA 5IMSA 5HRUA 2AB0A 1Z4LA 1T0HB 3ZD7A 3C3YA 4AKHA 1VHJA 3WKCA 721PA 1JB1A 3PB3A 4L16A 2EF1A 4DNFA 2I55A 1KL7A 1QGUB 3NIWA 1EWQA 2LD4A 3OLZA 2QT1A 3FSRA 3ZWMA 2R8BA 4GMHA 3CM0A 2C82A 4AN1A 2IY7A 1Q44A 2O8EB 1C3XA 3QTLA 3SMVA 5B7PA 1DHRA 2AN4A 1MN6A 1OPRA 2A59A 5COAA 3KLMX 1QE3A 4F1KA 5JEEA 4QLOA 1KMIY 1IPHA 1KFEB 2WF5A 3UJ6A 5I7SA 3FOFC 3PDHA 3CT4A 3GLSA 5LYJA 5A3JA 1F0KA 4YVFA 3VR2D 3R8FA 3IKLA 4LJ8A 3RYHB 1T36A 4KO4S 3Q0IA 1K3TA 2B1QA 4LWQA 3OF3A 4JX8A 3QGMA 1D2EA 4G37A 3AF0A 3NW9A 2QG6A 4V2UA 4BMXA 4DDTA 3UQZA 3MILA 2WU8A 4C08A 3EFHA 3B12A 2G8LA 5CM9C 4Z3OA 4H1TA 4X60A 5IT4A 4F72A 4MK4A 1HURA 3ND8A 2NBNA 4F2HA 5D51S 5FDFA 1I36A 2GM5A 1QHSA 2QTZA 2WWIA 1M1YB 2HHAA 2OHGA 2J85A 2PZEA 3AIIA 1PQWA 2ZJFA 4J2HA 1U28A 2I8LA 4NS4A 2C2YA 5CNIA 5I8WA 4J6FA 3A6EA 5B2FA 2Q9AA 3M6IA 4GUAA 3E2IA 3Q8KA 2RGBA 1EXNA 4LRYA 4CXMA 1J09A 3K0SA 2JA1A 1XJ5A 2Q29A 2YWRA 2NT3A 1O3YA 3ONNA 1YDMA 2ZW9A 3FTCA 4MYHA 1JBKA 5BO5A 4B76A 3ROXA 3KT8A 2JD1A 4NCXA 3DL7A 2Q1XA 4BFUA 3RAFC 1JDJA 4HX9A 3U4HA 1SM4A 2AF3C 5KYNA 5E1BA 4XASA 3GHYA 1PEAA 2NQ8A 5JYCA 3SGLA 5KTSA 1U8CB 5EIBD 4DG9A 1BDBA 3L01A 4IXNA 5EP4A 5J1SB 3LLMA 5EXTA 1W4RA 4I8IA 1IULA 2AF4C 2C5AA 2QK4A 3NCHA 4URZR 5DCUA 2J08A 4L27A 4FGSA 5CJPA 4GZMA 5KSPA 3GJ4A 5KYWB 2I4LA 4B83A 1E2KA 3SX2A 4FFNA 5GMOA 4EHDA 4FN4A 1YQDA 4CNQA 1M8JA 3SVTA 1N9GB 4P36A 1I13A 4D8YA 5KJ6A 3PXBA 1YWGO 1A9OA 2X8LA 4QIHA 1B0PA 1IZ7A 3MB5A 3TXYA 2H29A 1F6DA 1VL0A 2AOUB 2YY5A 1XLUA 4LGMA 1J22A 2OL4A 1QO7A 4JBYA 4OIFA 3ICOA 3JAKB 4EZIA 2HXGA 4ZI7A 4RTLA 5IXYA 2YHIB 3I5UA 3ND9A 4GMKA 4R2JA 4BFXA 4MPDA 2O8FB 1SVNA 3P8ZA 3RT7A 1OTHA 3OJXA 2X5JO 3JD2A 3ANSA 3WK4A 1WXHA 2JGDB 3WMGA 3O4FA 5GGYA 2C4UA 3HDHA 4HQNA 5ENVA 3WLFA 3DSRA 4NAVA 1TFUA 1Y3CE 4MUEA 1XKTA 4P7KA 4CCAA 4DLLA 5CB4F 3SX4A 2NSHA 1AO0A 1O96B 4MQEA 1Y63A 3QVMA 1F8YA 2IF2A 4GM4A 1LDNA 4EA9A 3NWBA 3NNDA 3C1OA 4K9OA 3PHJA 2YJ3A 2ZEJA 1DFGA 3ORYA 4QUEA 2CVPA 2A35A 4V1CI 3HM2A 3KKZA 5DEOA 3WKEA 3K1YA 1PRYA 3RU7A 2JHAA 1DAOA 3IQEA 4LZOA 4MS4A 1O95D 4LHZA 4M9SA 2A9VA 3GFSA 4DM3A 1UOPA 4HYEA 3BMOA 2OXEA 1KFKB 2QRVB 5FR1A 5J40A 1SHZA 2WPNA 2KSQA 3IAXA 1PR4A 2QQ5A 2WBLC 5HF9A 3V1YA 1LBSA 1HQYE 2YMLA 5BWOA 1A9PA 2O6LA 3DVAA 5EHXA 3PC7A 4G5GA 1FP4A 4IDDA 2EFJA 1CY4A 1HH4A 1PW5A 5T4FA 2QJFA 4BNWA 1V3QE 1SUIA 3L40A 4ALJA 3U3KA 4I4TB 1GL9B 4RSMA 4EITA 1F14A 1NW9B 3O4JA 5GM1A 1JFSA 2WF8A 4KR7A 4ILEA 1BE8A 2CNOA 4RTMA 4S1TA 3JD4A 2PRSA 1RXYA 2FQ1A 1MNQA 5AXBA 1SQFA 1YB5A 2GPAA 5HCIA 1IJEA 1H1LA 1RSZA 2GASA 4ZAYA 3UJCA 1D7OA 9LDTA 4ZCQA 3WDSA 3H42B 4WLFA 2CD7A 3KQTA 2UZAA 4G9BA 4G5OA 4HCJA 3N8DA 3GMDA 2WSBA 2XWSA 2JANA 3CX6A 1SVUA 2WUDA 5DTRA 5AO9A 3IALA 2FSUA 3GOQA 1MO4A 1GKLA 1KJZA 1SVWA 1ZN2A 3HJNA 3KZVA 4H6XA 3TNJA 3F4KA 4DY4A 4ZT7A 3T7JA 2CBGA 1H0SA 5J1TB 1NYTA 3EIHA 2OHIA 3ZOZA 3MQ4A 3GUZA 2IXFA 1Z0AA 3SQLA 2AW3A 2Q7XA 3OQOA 3D4OA 4JOSA 3AJ9A 3MWYW 4G63A 4J94A 1P1BA 2DOKA 4D9JA 2YC2C 1ZUHA 5HOEA 1LS6A 1SVOA 2WIFA 2ZSJA 4FDVA 4IIJA 4MYCA 3NAMA 4AWAA 3FDJA 3EIXA 1G8HA 1XPRA 3FOBA 1FZTA 1TK3A 1WXEA 1XL0A 4ABYA 3NM5A 5KYYA 3KSZO 3ZNQA 2D54A 4RM2A 2C07A 2ZYSA 4EPVA 4UM9D 1MO2A 1WCXA 2C61A 2E4XA 2ET6A 3PUZA 2UUCB 2H2FA 3VOBA 2G76A 5IT5A 4YCAA 4ETIA 1G8KA 3ODGA 1LI4A 1SCAA 4P4NA 4AX8A 4DJJA 1QF9A 5FPTA 4JLSA 4R4JA 4CQMA 4BECA 4NENB 3GLFB 4WT7A 1MFPA 2D1SA 5CT4A 1WV1A 2Q7DA 3ZGLA 1OXVA 4ZANA 1H6DA 3OFSA 3ACBA 3RFCA 4D4GA 2V3CC 521PA 1L3BA 2ZIXB 1C5KA 1PJ8A 1YAHA 2GI4A 3EXEB 3M6XA 4G5QA 16PKA 5DULA 4KNVA 3SJUA 3FNRA 5B3KA 2JAQA 5JSKA 1B7GO 1DUVG 4MKHA 2P35A 2FFQA 2J5XA 3O9VA 3T3HA 3TEJA 6Q21A 1QPGA 5EBVA 2D4HA 2C5LA 2Y8EA 2WC1A 3NATA 3QFTA 5KPDA 4JYZA 2WHPB 1H5NA 3OWHA 3TTWA 1XMQB 3KJEA 4HFNA 1Y7PA 2ZG6A 5I48A 1NDQA 2WVJA 4D4JA 3TD2A 2OQIA 1HDEA 3AUYA 4M9QA 1T3ZA 2IYXA 4LZLA 4F86A 4BNDA 5LIRA 4E70A 5A9RA 3A4IA 2BFCB 3OM9A 1L8AA 5ELMA 2RCYA 1UJ4A 1HQKA 2V9CA 1XTVA 4WBNF 2D5BA 3LO5A 3LIIA 4BNXA 1OAKA 2J9YB 4S0ZA 1XDBA 3IUYA 4Q1CA 1BVHA 4PR3A 5AJUA 3T5AA 3HS3A 4MZDA 1Y0BA 2IZZA 2HMSA 1RLTA 4CTMA 4XWOA 3EZ9A 2GWHA 4NMLA 2ZUTA 2J3IA 4S2EA 1NNSA 4KBGA 1XTPA 2QPOA 4RXUA 1CUWA 2PXAA 1PK7A 4KGDA 4MMYB 3ZHXA 1CWUA 5D1NA 5CMLA 3WTBA 3O4GA 4RK5A 2HQ1A 4U4AA 5EWJA 5EIWA 3UWOA 5IBRA 4BO6A 4HDNA 1E1CB 1YZNA 1YR9A 2WKSA 1WQ4A 4IS3A 3T5DA 1CETA 3ZGVA 4LJRA 3BA6A 3PC2A 4PZZA 1SXQA 2CE7A 4MWSA 3L93A 3PRHA 1O9BA 2CK3A 3AHCA 3MWKA 3W6UA 5M34A 2UZ4A 1H4QA 1KHTA 4IKEA 3Q0TA 4R8VA 9ABPA 5KNCD 3PICA 5E4FA 3TW4A 3IPLA 1GA6A 4KH0A 1ENPA 1AN9A 5EJFA 1EBBA 5AVQA 3OD1A 2P2CA 3EHDA 2WFZA 3PG5A 1D6SA 3CU5A 4ZOEA 3SJBA 3U4QB 4UE6A 3I5MA 4TRRA 2OPBA 3DVQX 5E38A 4I1OA 1W8DA 5HZKA 4GF5A 3FHLA 3DOJA 3ST7A 5FI5A 3O92A 5ALUA 3GLGB 4CT4B 4FR5A 2YXLA 4HJXA 3U37A 4TL7A 3HUEA 2NPOA 2VJMA 2Q2QA 1CUAA 1D8TA 3BTVA 4J0JA 3DE0X 3II6X 1L5GB 2ZSHA 3EPJA 3HXMA 2XECA 2H17A 2CXXA 3QNWA 4ND6A 4V38A 5JR3A 4AK9A 2P6RA 3P0JA 3HFJA 7MHTA 5FL7D 1UDWA 1QB7A 1Y8QA 1ZK0A 3M0EA 4K6GA 4RC9A 4XVQA 4A03A 3U5ZB 1RIFA 1L0BA 3P9XA 1Z7YA 3E2MA 1TD1A 1KQFA 3ENKA 4FUQA 5EWLB 3D8UA 2XEDA 1AVTA 2Z2KA 4GPZA 5JSHA 4Y0NA 4E3WA 2G0TA 2QZPA 3ZV3A 1GZUA 3M34A 3OEED 1TZKA 1AU9A 3G8AA 4HLDA 4QDTA 5L3SB 2H92A 3F97A 5LZ7A 4LYGA 4Q1DA 2V4ZA 2OXTA 5TV2A 1RQRA 2FMUA 1PG0A 3PEVA 1HWYA 1JI0A 1NW6A 3RUAA 4Z49A 1UPCA 4ZVQA 4BLPA 1X6VA 1QG4A 4W5HA 4F6LA 1MF7A 2FZCA 1EA7A 2MYPA 3DH0A 4L4RA 3HL0A 3OOJA 4H1UA 1DWPA 1BN6A 2GDJA 2B82A 2GKSA 1CR4A 1R9NA 3TQTA 3LHKA 2AI2A 3ZGOA 2A0KA 3TG2A 3UKJA 2DR2A 3L8CA 3ELBA 1I4OA 4H15A 4Y8VA 3UXHA 3CYFA 4TSRA 2R7NA 3FLEA 3M6FA 3EISA 1DQSA 1G66A 1GAJA 2IOFA 3ILVA 3KL4A 4HGRA 1VMKA 4ES6A 4XVCA 1LFDB 3OAAA 4NMMA 1KZ4A 3COSA 1KH1A 1G291 4QVGA 1V6CA 3I8OA 1CR2A 4J0IA 1Z4PX 1NJ1A 1XZPA 3QJYA 2W22A 2VBCA 4P4GA 1G5HA 4OOEA 5FP0A 5HFNA 1XMXA 3ZU5A 4EPTA 1T91A 4ID9A 3SZRA 4C4OA 4I1PA 3ZDBA 2IYFA 3HGMA 4FM9A 2W6ZA 3F4LA 5IKEA 4J91A 3B3AA 1A9YA 1U9ZA 1YOVB 2WJAA 4TV9A 1MH1A 1JJ7A 2XUZA 4JN6B 1P19A 2MU1A 4G0YA 4F71A 1L2TA 4KQ6A 2Z58A 4Q4CA 4W9MC 2OCXA 4OKSA 5DNYB 4I2NA 1FTQA 4BUZA 3B8EA 4YT4A 4YJ2A 3U3RA 3B1KA 2WVHA 3ECAA 3EIOA 1HDIA 1KORA 1ORDA 1ZIYA 3VMFA 4LUCA 3HYTA 1NBIA 1Y7TA 4Y1GA 5PGMA 4KO8A 1JG3A 2NMVA 2VWHA 3RUFA 4ZK6A 2YYZA 3R3UA 3N74A 4PZYA 2BDTA 1O58A 2NZVG 5C1OA 4P4TA 3DCJA 5F5LA 3OPQA 2HCTA 1ISMA 4AJ1A 4JROA 4P83A 2XCUA 5C5IA 3MGAA 3D6JA 2YY7A 1Y1LA 4PYJA 1Q77A 3ZWXA 1NP3A 2HMTA 3DMGA 2PIAA 4HQLA 4KVGA 4O1HA 1OKKD 1G63A 1VYVA 4L74A 4U6SA 2ZJ0A 4YAEA 4ONEA 1HLPA 2AR9A 1JALA 2BR3A 2Z56A 3OY7A 5AM2A 2ZIFA 3SDZA 3LCMA 2XR1A 4H7EA 1HE1C 1MC4A 2KQUA 3CGWA 3VNQA 3SFZA 1SPXA 3GFQA 4UEJA 2I2WA 4I66A 4CMAA 2IZ6A 3HY3A 5IULC 3QYJA 4KR2A 1EUDA 1W1IA 1DAKA 1LLQA 1UEJA 3BGDA 2Z8XA 3PQ2A 1ZHOA 4NZMA 2YDXA 4FFLA 4P2GA 2EKDA 3N6VA 2ZJAA 1UOOA 4UTRA 4RD2A 1RXVA 2NSJA 2J3HA 3NTLA 3THOA 4MJXA 4D96A 3O4HA 3QHPA 3COVA 4U3JA 4QUJA 2IVFA 1GNVA 1PGJA 4MJ3A 5AI6A 2Q99A 2CLKB 3E9DA 2B8TA 4DUYB 1BH6A 1VYTA 4CIDA 4GQIA 4DHWA 1HFJA 3TFQA 3EBLA 1BKDR 2PT7A 3KSUA 4JI5B 3D7NA 4OBEA 4KWIA 4DQKA 3CHYA 4KWEA 1YRQA 4NY1A 5FNVA 2ZWAA 4X5OA 3GWGA 3HB0A 5IK2D 2PGOA 4KX5A 1R37A 3DONA 4OI2A 3VJRA 3HA5A 1DTWB 3ENZA 4MCAA 4NZYA 1R6XA 1TO6A 2B3TA 5H8WA 1RHMA 2GCOA 4IH9A 1D2GA 2W4MA 4ETMA 1ODJA 1C9MA 2ZLBA 1UXJA 2PMFA 4O4HA 4RHFA 5LXTB 3BXPA 1UKCA 5DGIA 3L9XA 3UO8B 5IVKA 3V9AA 621PA 1SB9A 4G01B 4MUNA 3VHLB 3KHKA 4XGNA 4TYQA 5AT1A 4XEHA 2OAGA 5TXGA 3LA6A 3FUTA 3OPVA 4FCWA 5HQTA 3UK6A 1QRSA 2BKVA 1JR3A 1OWPA 2A84A 3OUZA 4D9BA 1PQPA 1QUFA 4G89A 4LSMA 3SIWA 4BVGA 5B12A 1L1RA 1RWVA 4M9ZA 3ABIA 3Q8WA 3UUFA 1EZ1A 3OZDA 1N2EA 1N0VC 2IEYA 1Z8FA 2EC5A 3GV0A 1M5RA 1Y8RB 3SNKA 1VLZA 7GPBA 4I1VA 5FTWA 2PNJA 5AVOA 4XVHA 5ICMA 3TRDA 3ITKA 1JYEA 1YCDA 1N2XA 4NH4A 3D6NB 3GGJA 1AKVA 3UCFA 1IUNA 1YU6A 2CMDA 2VS1A 4BLQA 1ZGCA 4DL9A 1MW8X 1DUIA 3DV9A 4MRPA 1YZLA 1PTJC 3ED5A 2G9NA 1HR0B 4PICA 1MB4A 1A9QA 3TMYA 2H7YA 1UP6A 4FX2A 4JB8A 1MQSA 1U7OA 2PO5A 3G85A 4ERNA 4RTKA 1N8KA 1RC1A 3C6BA 4LDAA 3WK9A 1HDCA 1Y8CA 2X5OA 1XCGB 2H4JA 2HO5A 2RHOA 3HE3A 3ESRA 3MCTA 3L0ZA 4HEA1 1XLWA 2GFHA 3ZVRA 4EW1A 1A1VA 1D8AA 3C5WP 2NTVA 4YRCA 3AY0A 1P77A 4RVOA 1Z4NA 4UFOA 3EGIA 1X7GA 2YXEA 1SUBA 4FFWA 2HJRA 1TVCA 1H05A 1U3FA 2HU5A 4UNNA 3RIEA 2HSEA 1OX4A 2OORC 3WG9A 1EHYA 2EW8A 1VIMA 3WGMA 2MMGA 3T7AA 1L4GA 2WZDA 4X3PA 4G5XA 5EJMA 1M67A 3KCQA 4H3KB 4HH4A 5CHYA 3LC2O 3T1HB 5T67A 5LPNA 4J4BA 2R00A 1POXA 3AEUB 3C5HA 3S2IA 4EEZA 1HTTA 5HK9A 1E9SA 1OXSC 2D2FA 1GPH1 3QXCA 4YAWA 4J7UA 4P31A 3NGXA 2Y93A 2OFXA 2PS3A 2OENG 4E30A 1N1DA 1SHJA 3KXLA 2WJIA 2LKCA 4RW0A 2XXJA 1D3AA 1RC8A 1QRAA 5A9SB 4IDEA 4B43A 5C52B 4IKPA 4ARIA 2VTVA 2DPLA 1U7DA 2ZWPA 1FTYA 3EVFA 1PEDA 3SAJA 1CQIB 3VV2A 1QRRA 2ACWA 1VYHA 3INNA 4ENWA 3OI7A 5CFMA 1Z2NX 3AEKA 3A3YA 5TJ9A 4OMUA 3UFBA 1IXRC 1X7WB 3GNQA 5FJIA 3IELA 1S8AA 3MFQA 4O2BF 1H3FA 5TMBA 1DEHA 1XNRB 1I7PA 2Q6VA 4UHKA 4DC0A 1RXEA 3AUTA 1M6HA 3TSOA 3LX8A 1U7WA 4L28A 2M32A 2V7QA 1DBQA 4MWEA 4ZOLB 3F78A 4JHLA 5F2OA 5C8XA 3NDRA 3U7EB 4C3ZA 5GIOE 1WAMA 4DIKA 2BFEB 4OQLA 4YJ3F 2ZT6A 4QPNA 3MAGA 4B85A 1DTEA 5B7GA 1YTUA 1PFGA 1SVMA 1M9NA 3B6EA 2XQJA 2C5GA 4HFMA 4NPAA 1H2FA 3H2HA 4Q3AA 4X6LA 3NYQA 1Z5GA 3SS8A 1KY3A 3V8QA 1NVKA 4UJ5A 1QQ6A 5FV4A 4BOYA 2X15A 4YWJA 1RT9A 1CZLA 3GDGA 4Y1RA 1DKOA 3O3MB 1D4AA 4AXXA 1AK1A 2HADA 5LFAA 3AKZA 2YIDA 3QKIA 4LHWA 2XNJA 1I9CA 4ZCMA 2DC1A 3KUUA 4BEVA 5BXQC 5JZVA 1JAIA 4CDNA 3QWBA 2ZTVA 3RODA 4PSUA 2Y1DA 3BJMA 4F4IA 1U5BA 3RYTC 1Z75A 4ENSA 4PPQA 3QEOA 2QM7A 3GG9A 1CUZA 3D1VA 5DM60 1UANA 2CV1A 3MJTA 1SWWA 1QVWA 4QUAA 3K6RA 2IHBA 5F52A 2V7GA 1UOQA 3OECA 4UEOA 1BOOA 3K0AB 3VVMA 4NJEB 1NVDA 3OMXA 1A4RA 1XTQA 2HK8A 3CVJA 3B9BA 4ZU6X 3KNZA 1ENZA 3BE5A 2ZXFA 3MWDB 3NIBA 5HOQA 1QGUA 2DJIA 2HU7A 1XZLA 1MB9A 1H22A 1NOIA 3HXLA 2EATA 5JDCA 3BICA 3OA2A 4DEXA 5K8TA 2HF9A 5EKSA 2M98A 4U7JA 1DQNA 4P34A 1PAUA 3S2YA 1YXMA 1NX6A 3GFGA 3SK0A 5TNXA 4HDSB 5CYFA 3AIKA 1AA9A 2P5UA 1AV6A 5KWSA 3L79A 4X71A 4LMBA 1HFWA 3SEQA 2IEDA 1E6KA 4RF5A 1RLOA 1PV1A 2IXEA 2JZNA 3A3PA 4R41A 3RYHA 3TOSA 5H1YA 4AJKA 4OI1A 1RTTA 4XDYA 3O9MA 5DM2A 3KL2A 3OE7D 1TIPA 4FNMA 1QHIA 1VB5A 2TMYA 1BFUA 1EMDA 4FYJA 4IDNA 2KPOA 4M98A 3WKAA 4J90A 2IKSA 5KWJA 5I7UA 2XMGA 2XWPA 4YBRA 4ZQEA 4QQNA 1UKYA 1BH2A 3UXEA 3VDQA 3ZWKA 2CJFA 2RHRA 5BURA 1IYZA 2V0GA 4PHHA 3LUHA 1BSVA 1GYRA 2YRWA 4ZVKA 1M1YA 4UTPA 4YHHB 3T52A 2P68A 2NUBA 4JJGA 1J6UA 4RL6A 4E0BA 4R2XA 5EC8A 1E0JA 3A3KA 4V1CB 2VYFA 4AKTA 2DFVA 1K6MA 3CX3A 2IH5A 3DF7A 2BDEA 3JQFC 2DQYA 2FLWA 3R8XA 1LVGA 3KVRA 3ETEA 3RVNA 2J3QA 3GCDA 4YCSA 2HV2A 1RWWA 2ZZNA 4G41A 1EWTA 1Q7TA 2VJYA 2VPWA 3L8ZA 3RC3A 3WGYA 2SKEA 3WAGA 3AW9A 3PYXA 4ZQGA 4QOSA 2Q2OA 4RH1A 3RVJA 1Z17A 2NV6A 1RXSA 5EHIA 2CXPA 2IITA 1YO6A 1IJBA 3GT3A 3OE1A 1HDZA 1Q0HA 1DMSA 4D3SA 1VJCA 1JVBA 4UC0A 3N05A 5D3MB 2BBOA 3BB4A 5NULA 3DE7X 1ZFNA 2J33A 3CUWA 5EUMA 4DADA 2JAHA 4Z51A 3MN1A 2NVWA 5KYWA 2JA2A 3AW8A 1WRBA 1ZCBA 3CV3A 3IURA 4B6JA 2A58A 5REQB 4YT2A 6NULA 1JLMA 1F38A 1QKKA 3FCEA 4P3KA 5KAMA 4RSHA 5JNTA 1S4MA 1N9GA 4IINA 2ODPA 2VP0A 5CLIA 4JITA 3U3ZA 1PJ2A 2YV1A 3P94A 3QITA 4CKBA 4U5QA 2A0FA 1B3RA 5EEGA 3NHAA 4RF2A 3ZHUA 3B2NA 3ND6A 1JIVA 3MBOA 2V7EA 2AOUA 2J30A 3W1WA 3JAKA 5K0LA 2NZUG 5FBKA 4IGIA 3C3MA 2HREA 2O8FA 3KBBA 2W4QA 1SH7A 4KOAA 3ECSA 1CW2B 2JGDA 2V54A 4LX8A 1G8SA 3CNNA 1J8FA 3WWEA 1TQ6A 1T3HA 3KKOA 5E9QA 1YJBA 2GOYA 2OWEA 1AQJA 2B0CA 2PZKA 5IC4