The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
126
|
sequence length |
390
|
structure length |
387
|
Chain Sequence |
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Micromonospora griseorubida
|
molecule keywords |
Methyltransferase
|
total genus |
126
|
structure length |
387
|
sequence length |
390
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
2.1.1.238: Mycinamicin VI 2''-O-methyltransferase. |
pdb deposition date | 2011-07-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF17843 | MycE_N | MycE methyltransferase N-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Nonspecific Lipid-transfer Protein; Chain A | Nonspecific Lipid-transfer Protein; Chain A | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |