3SSMA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
390
structure length
387
Chain Sequence
b'EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
total genus 126
structure length 387
sequence length 390
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssmA02
3LDUA 5DM1A 2A14A 3BGDA 2P8JA 4PYLA 1DL5A 1RI3A 4PONA 5CCXA 2YTZA 3T7RA 3BZBA 4PCAA 1P1CA 3P9IA 1RJDA 3P9KA 4RSRA 1NBHA 3I9FA 5HIJA 1R6AA 3FUWA 3LKDA 5DM4A 4E32A 3CJRA 3M33A 2ZTHA 2PSSA 5FHRA 3EVFA 1IM8A 4KIFA 4PYIA 2PJDA 3PT9A 7MHTA 3M6WA 3GWZA 1L1EA 3FZGA 3FPEA 3LDGA 3NVKI 3DH0A 1ZGAA 3K6RA 1WXWA 4MQ4A 2YUIA 4P7KA 3VC2A 3HA3A 4DCMA 1I4WA 5GM1A 5D1HA 2YQZA 5EZSA 2PX8A 3TKYA 2G8NA 4L7VA 1WY7A 1BC5A 1XDZA 3A27A 3HVHA 3LPMA 3DMHA 3ELWA 3G5TA 3UJAA 3E23A 3MERA 2NYUA 4CWAA 1XXLA 3BKXA 3D2LA 4ZTBA 1SUIA 4NECA 2OB1A 3FUVA 3P2KA 4QDKA 5K0LA 5LQJA 3MHTA 2IGTA 3A4TA 4YV2A 5E1DA 2YVLA 2ZIEA 2GPYA 4E30A 5K0GA 4RTOA 2ZBQA 3EVGA 1B42A 1NW8A 1KR5A 2PX4A 3ME5A 2YXEA 3PB3A 4MHTA 1X1CA 2GS9A 3NWBA 3SR4A 2AN3A 4F84A 5K8VA 3GRVA 4KVZA 1BHJA 1NW5A 3ORHA 3FPFA 3CGGA 2OXTA 3BWMA 2WA1A 2OYRA 1O54A 5HIIA 5LQNA 2C7OA 4LECA 5E8RA 3KPJA 4QVGA 1D2CA 1QYRA 2BM9A 2H11A 2G1PA 2ZZMA 4GUAA 1QANA 4AUKA 5EEGA 2BR5A 3ER9A 5FCDA 3O31A 4IV0A 3HVKA 1JG3A 4PYMA 4PYKA 2PT6A 3CJQA 3UJBA 1DCTA 5CVVA 3LCUA 2FHPA 3U81A 4RTRA 1Z3CA 3CVOA 4AZSA 2P35A 4F85A 5GIOE 2UYCA 2PX2A 1M6EX 1N7IA 4PYQA 3TRKA 3KR0A 2V74B 2I62A 5K0BA 4GEKA 3V8VA 3KHKA 3KR1A 4C07A 3ER8A 3MCTA 4HH4A 5F2NA 1AQJA 2H00A 3M6VA 3OZSA 1INLA 3LHDA 1M6YA 3B3JA 5E8JA 4C06A 1VIDA 1RI2A 2O57A 4POOA 5KQRA 4DKJA 4R05A 2ZVJA 3JWGA 2F8LA 5LQUA 4KRGA 3PFHA 5JR3A 4BLWA 3OCJA 1V39A 5E1BA 3O7WA 5FUBA 3G2MA 3P8ZA 2YX1A 4M36A 1N7JA 3THRA 2ZBRA 3GRZA 1P1BA 1EQAA 3KQTA 2AOUB 4ER5A 5EQJB 2IIPA 4PINA 4CKEA 3CKKA 3G8BA 1YUBA 1QAQA 3KQVA 4FSXA 5P8WA 2BZGA 1ZHFA 9MHTA 1Q0SA 2P7IA 4CXMA 3EVCA 4C05A 3PX2A 1UWVA 3Q7EA 3DR5A 4QQNA 2DPMA 1FP1D 2HMYB 3EVAA 4M37A 2NXJA 1SQFA 3AXTA 4H0NA 4K6MA 3FRIA 5HIMA 4ATNA 3I53A 2PXAA 3CCFA 2AOUA 3IEIA 4RWZA 4A6EA 1KYZA 3HP7A 3LCVB 3ANXA 2I7CA 1VPTA 3JWHA 2QY6A 1XTPA 2YR0A 4RTQA 4OQEA 4E70A 2P40A 4PIPA 4OA8A 1PJZA 5ICGA 2HWKA 5EOVA 1MHTA 1VP9A 2ONZA 4C4AA 1R8YA 2NNWB 4QTTB 4BLUA 4PYJA 5KYGA 4RV9A 4Y2HA 3MTIA 1WZNA 2C7QA 1VE3A 2Y1WA 3FPGA 2GA9A 3G88A 1F3LA 2QM3A 3T0IA 2O0LA 2P41A 5CVEA 1OR8A 5FA8A 1O9HA 1P91A 2H1RA 3V97A 4X61A 4DA4A 4OBXA 4LWPA 2QE6A 5FQNA 3NWEA 3FYCA 3SM3A 5JUWA 3HCFA 4FR0A 3DULA 2VS1A 4ER6A 3AWIA 3A7EA 3RW9A 3R9XB 5FA5A 4HC4A 2IP2A 2IH4A 5DRYA 3HEMA 4KIGA 4CKCA 4OA5A 4KDRA 1ORIA 2OO3A 3FPHA 2Z6AA 1BKYA 5BW5A 3KQQA 4YUYA 3SSOA 4KW7A 3A25A 2JG3A 3KPYA 1ZQ9A 4CTKA 2CL5A 1NV9A 2ERCA 2ZW9A 2ZZNA 1XDSA 3HCDA 4AX8A 5HOQA 1SUSA 3E7PA 3NTVA 3HTXA 3G2PA 4P7FA 4LG1A 3HNRA 1T43A 3E8SA 3EMBA 4RVFA 5HFJA 3VYWA 4KDCA 3DXZA 4QQKA 1FBNA 3CBGA 4DMGA 3T7TA 5E9JA 4U7TB 3BGVA 3EPPA 2AOVA 2GB4A 2EJTA 5KQSA 3A7DA 4GBED 1KPIA 5GWXA 3UJ9A 3WSTA 2C7PA 1ZG3A 3UWPA 3LBFA 1QAMA 2JHPA 4DCGA 2ZLBA 2IBTA 1NT2A 4O29A 5EIFA 2P1DA 4XUDA 4AZVA 3DXXA 1M0EA 3BGIA 1NV8A 2O06A 3GCZA 3F4KA 4QVKA 2OZVA 1RJFA 3GRRA 5LQCA 3PVCA 4GC5A 5K0NA 4E2YA 1WG8A 1I9GA 5KVAA 3KKZA 4ER3A 4E31A 2AS0A 2Z6QA 3EEYA 3UA4A 2IPXA 3HVJA 4HRAA 5ERGB 4LWOA 3G2OA 1XJ5A 2NXCA 3DLCA 3NDJA 2OB2A 3GXOA 3CC8A 3IV6A 4G56A 3M6XA 5DSTA 3ID6C 1RJEA 2IDKA 5E9WA 4RTPA 3G89A 5ICEA 2PVCA 3FPJA 3FYDA 4GC9A 2QRVB 3HA5A 4QTUB 5HZMA 3LECA 2JH8A 2Q41A 5EHIA 3B7PA 4OBWA 3TMAA 4PGGA 2PLWA 2PBFA 3NVMB 1AV6A 5DTMA 1DUSA 1WXXA 3UJ7A 4MTLA 3SXJA 3TM5A 3EMDA 3IYLW 1O9GA 3C0KA 5FADA 2VP3A 5EMKA 2AOTB 2QRVA 4PWYA 4E33A 4GOLD 5DX0A 3PFGA 3HCBA 4ER7A 4PYOA 4IV8A 3TPZA 2K4MA 3GU3A 2NXEA 2VDWA 2ZWAA 3RIEA 3DMGA 3KQYA 2IDJA 2G72A 2CWWA 4U7PB 4Y30A 5T64A 3AY0A 3EVDA 4PGHA 3B89A 2EX4A 4FS8A 4GOMD 2FK8A 5EZQA 1JG4A 3EGEA 3DOUA 1U2ZA 3TKAA 2AOTA 3DTNA 3MAGA 2AZTA 2DULA 1YFLA 1HMYA 2VDVE 3ELDA 1R74A 2O05A 3C6KA 5BW4A 5EPEA 4P7GA 2ORED 2JJQA 1G38A 3DLIA 3SSNA 1JSZA 3G7UA 4WVLA 1BOOA 3FRHA 2ADMA 5H02A 8MHTA 2GAFA 3GNLA 2O07A 4MWZA 5MHTA 3K0BA 3L8DA 2P7HA 4YUXA 2B25A 3MB5A 3LGAA 4YUZA 1IY9A 3JWJA 2ZIFA 2CMGA 2ZZKA 3B3FA 1MJFA 2PWYA 5M5BA 1FP2A 5DXJA 1KIAA 2IBSA 4V0RA 3TLJA 3PS9A 2BR3A 1L9KA 3KQMA 4RTNA 5DM0A 2C7RA 4V0QA 4M7RA 5T67A 4F86A 3DMFA 5BP7A 1PRYA 3MGGA 2EFJA 3LX6A 2JHAA 1EJ6A 5G02A 1HNNA 1QAOA 2VDUE 3X0DA 3HVIA 5HEKA 3UJ8A 2UZ4A 5DSXA 1VP3A 3UA3A 2P3QA 3KPVA 2Z6UA 4P58A 3KPUA 4R6WA 3QV2A 3FTEA 4PNEA 2XYRA 1UFKA 1AF7A 3TFWA 4RTLA 5GIPE 3SSMA 4E2WA 2WA2A 1VBFA 3A26A 3FUTA 4QPPA 3SMQA 5HIKA 5CCBA 3OFJA 3O4FA 5DLYA 3ELYA 4R8RA 1SQGA 3GGDA 3SX0A 4DM3A 2B2CA 2ESRA 4RVDA 5EEHA 3G8AA 3EEOA 2PT9A 5CM2Z 2XYQA 1JQDA 4WXHA 2ZFUA 4FZVA 1RI1A 4IKPA 4X63A 5C1IA 5K03A 5EMJA 5E1MA 2HR1A 3M4XA 3S68A 4E2XA 5DM2A 2AVNA 4P7JA 2ZWVA 4XCXA 3NW9A 5EMMA 1G8SA 3HCEA 4C04A 4GOND 1N2XA 3TM4A 3P9CA 4C08A 1XVAA 3MCZA 3G2QA 2PGXA 3VSEA 1TW3A 3KPWA 4RTKA 3M70A 5CUQA 4AZTA 4RX1A 5IH3A 3TR6A 3LL7A 2V7EA 1EAMA 2BR4A 2JHCA 3I5UA 5EC8A 3NJRA 3EGIA 3BWBA 3R6TA 1G6Q1 2XVAA 4RYLA 1SKMA 1JG2A 2LD4A 3OU7A 4GOOD 5CVJA 3FTFA 1JTEA 1YZHA 4EKIA 1VQ1A 5DT2A 3UFBA 3TQSA 5CVDA 5EHGA 5C0OE 1UIRA 5GM2A 3KR9A 4X41A 3P97A 5U4XA 2NP7A 4YMGA 1NW3A 2WK1A 2AOXA 1X1DA 4R6XA 3UJDA 3PTAA 1KPHA 3OU2A 3P2IA 1EJ0A 1F38A 2FRXA 5GINE 1H1DA 5LR6A 2UYHA 2OKCA 1X1AA 1X19A 1AQIA 2FK7A 3LKZA 5DX8A 5B1SA 2KW5A 4UOEA 2EJUA 5FTWA 2PKWA 5E1OA 4R8SA 3DP7A 5D1NA 3AXSA 2OBFA 2QYOA 3Q87B 1RI5A 5E2BA 2GH1A 2OY0A 3LBYA 5C9ZA 5KS2A 5E9QA 5LQRA 5CD1A 3I58A 3UBTA 3ERCA 3KR2A 4CKBA 4C03A 2AVDA 4HTFB 5ICCA 1ORHA 1VLMA 3UZUA 2I6GA 1EG2A 3I64A 4HGZA 4GQBA 2XBMA 1IXKA 1X1BA 5FQOA 3BT7A 5GOZA 1NW7A 4AZWA 2UYOA 3HA7A 3B3GA 3OFKA 3ELUA 5DTRA 1QZZA 4EKGA 3C3PA 4YUWA 3KQOA 3M6UA 3GO4A 1XCJA 2G70A 3R3HA 5DWQA 3TOSA 4KWCA 4MIKA 3B5IA 3EVZA 2GLUA 1JQEA 3BWYA 3KQPA 4HTFA 4BLVA 2BM8A 2JH9A 3GDHA 4BP1A 2YXLA 5BXYA 3OZRA 3GJYA 2IH5A 3CJTA 3NMUF 1NKVA 2FYTA 3EVBA 5FULA 1RI4A 4ER0A 3SGLA 2EG5A 3GRUA 4PYNA 3IHTA 4PIMA 2AOWA 3MTEA 1I1NA 2NP6A 4EQZA 1ZGJA 3P9NA 1YZ3A 2PXCA 1R00A 4OX9Y 3P2EA 4HGYA 5K0CA 3UJ6A 2B78A 1SVUA 4RVHA 3RODA 2ZSUA 2CKDA 2UYQA 1NE2A 3UJCA 3BUSA 2N47A 3GIWA 1EIZA 1YB2A 3BXOA 3OPNA 3SVZA 5DPMA 2IH2A 5F2OA 1JQ3A 5EGSA 4YV1A 2R3SA 1NW6A 4FT2A 1FJXA 2I9KA 5CIYA 3C6MA 4CTJA 4A6DA 1SG9A 1XDUA 1Y8CA 2P3OA 3GRYA 3FUUA 3MQ2A 4PCLA 4XUEA 5ICFA 3THSA 4HSGA 1KP9A 3QOWA 3G5LA 4QDJA 1L3CA 1JR4A 1G60A 4Z2YA 5IKMA 1YF3A 5DXAA 5EG5A 1R18A 1ZKDA 2Y1XA 1YFJA 2BH2A 3H2BA 1VL5A 4FGZA 3BWCA 3JWIA 5FHQA 4YUVA 4B17A 2PY6A 3E05A 2XYVA 1KXZA 3DXYA 2AR0A 5FWDA 5DX1A 2ONYA 2B9EA 3R24A 4RTMA 5CVUA 2HTEA 3QOXA 1TPYA 3R0QA 2B3TA 3KU1A 4EMSA 5K0EA 1KPGA 1TW2A 3FUXA 3OE5A 1FPQA 2PX5A 4QPNA 4YV0A 3EVEA 1D2GA 1L3IA 3HCAA 5GP1A 2G71A 3DUWA 5F2KA 1G55A 2ZBPA 5K0JA 1D2HA 2VZ9A 4RTSA 2IFTA 5E2AA 4ISCA 2FPOA 1JSXA 2P3LA 3EGVA 3VC1A 2FCAA 2AN5A 4GF5A 3P71T 2E5WA 4EVIA 4E2ZA 5K05A 4DF3A 1L3BA 5EKUA 5T6BA 1KHHA 3BKWA 4FSDA 2OPBA 1JTFA 3OU6A 2ZCJA 4BP3A 3FTCA 1RJGA 2YXDA 5DTQA 2AN4A 3T7SA 1XCLA 1Q0TA 4RTJA 3HM2A 5HILA 5EVJA 3OZTA 3C3YA 3REOA 4X1OA 4DZRA 1KYWA 2PV0A 3PX3A 2PXXA 4FT4A 2XVMA 1WS6A 1P39A 10MHA 3LCCA 4EK9A 1NBIA 1R8XA 4RVGA 3KQSA 4M38A 3LDFA 3PLAE 3HCCA 4IWNA 5LQAA 4OQDA 1JG1A 3NDIA 5FWAA 3OE4A 5EMLA 3AJDA 5EKXA 2PWPA 5LQKA 5K01A 4BY9E 4JXJA 5DRTA 3FTDA 4XUCA 4FP9A 4DQ0A 4YMHA 2HNKA 5K0FA 5LSAA 2ZULA 5EIWA 2ZIGA 5K09A 1G8AA 3LSTA 4HG2A 4X60A 2R6ZA 2CMHA 3KQWA 2NXNA 2HV9A
chains in the Genus database with same CATH superfamily
4HNRA 3TIVA 5CCXA 2BZ1A 5E38A 1VIYA 3RTDA 4RCVA 5AW2A 2OZPA 1Z12A 2ZRMA 1P1CA 2Z8YM 3FPSA 3N0TA 5CYOA 2YCLA 1A7AA 3P9IA 1E5LA 1TM2A 3MMNA 3ZXIA 3FUWA 1DIBA 1U1GA 2PPLA 2IYZA 3K8QA 2I7XA 2VRNA 3V8EA 3MTBA 3ELBA 3H9CA 1DIOB 5HTOA 1V47A 1XAGA 5M34A 1C4WA 3KHUA 4NMMA 3LDHA 4I9HA 1M73E 4JA0A 3WSWA 3WK8A 5I9IA 2IX3A 2X58A 2IYVA 3BWEA 4MQ4A 3VC2A 4CLHA 3JVEA 4D5GA 2BHTA 4TQUS 1IBSA 2JVJA 2JLWA 3C6QA 2A30A 3CRZA 4BBJA 8ABPA 1IK4A 5I47A 1G3IA 3I76A 3OQIA 2CCKA 1QZUA 3ETNA 3GJ7A 3PUXA 3W3AD 1QP0A 3TNJA 1FDVA 1H3FA 5C7OO 2SKCA 4PM4A 3ZCRA 3AHIA 4A92A 4DQXA 1HEIA 1PW5A 1YIAA 1QQAA 3W4JA 5HKLA 2ONCA 3OF3A 4KGZA 4E7OA 1SBQA 2VSOA 3WGOA 3S29A 3CX8A 3QVMA 4M1KA 3NC4A 2YZMA 4LBZA 4JP3A 1JFFA 1VXOA 4UEKA 3K94A 4YXWA 2EZ8A 1E92A 3AI2A 1GQYA 3FWZA 3STYA 821PA 2W8BA 4PLVA 4Q9AA 1Q0ZA 2ZBQA 5FF9A 3IO5A 3RV3A 3UWSA 4DJJA 2JAXA 2VBFA 4BLSA 5IF9A 5LUBA 3MUFA 2QIPA 3PC2A 3SR4A 2AN3A 4PVCA 1O0BA 1V7ZA 3FHCB 4I46A 4DHWA 5KNDH 2QTLA 5SZJA 4M9SA 2BGNA 3S0JA 3X2FA 2LCIA 3CH4B 3DZCA 4IOMA 3W1VA 1UXGA 1RWNA 3ZE8A 3DVAA 1WD5A 2JEYA 3B51X 1FQWA 1W6UA 3ANSA 5HYVA 2CHEA 1NI4B 1OLUB 2X19A 2HCJB 4HAOA 5KJEA 2QRZA 2VYCA 4HBZA 5J5VA 5EHZA 3A11A 3RUFA 2G9RA 3DM5A 4ZY7A 1SCKA 1JXOA 3ETGA 4MW9A 3GD7A 4ALKA 2P35A 5KTYA 2UYCA 2B99A 3GVHA 3D6AA 1WMAA 1U8FO 1XIVA 4PYQA 1UDBA 5EE0A 3A9SA 4Q3OA 5FUMA 4REMA 4AVYA 5K0BA 2BLLA 3OURA 1R0RE 3LVFO 4Y1RA 3IGFA 4BCBA 4UFPA 4TSFA 1P81A 1XLUA 2QVXX 2VP0A 3ZZNA 4C06A 3CLSD 3O74A 1NU6A 1OFGA 3A4YA 3BK2A 4NV0A 2QY9A 4RZHA 3AEUA 4OH1A 1L5GB 3WB2A 4DC0A 1WZEA 2XWBF 3OCJA 4HLQB 5JRJA 3KSZO 4AZ0A 3G2MA 4G1CA 1PYDA 3X1XA 3KAQA 4FWIB 2RHJA 1Y42X 1K08A 2G4CA 1OTYA 2I65A 3FETA 2I71A 2I3GA 3KQTA 3VUEA 3ZKAA 4DARA 2QAIA 3B8EA 4ER5A 1Y82A 1UINA 1AZWA 5JAIA 3ZDBA 1OWOA 1AM4D 2GHQA 4HTAA 1YUMA 1YWGO 2IL1A 2PGJA 3CKKA 4IUYA 4KXFB 3TVDA 4J1TC 1LLUA 1ZHFA 3VR6A 2VIIA 1E1CA 4D97A 1QCZA 1E8NA 1HH4A 3QFCA 4RVNA 4JI5B 2IZ0A 1JFLA 1HGXA 1C9MA 1KZ4A 1M2VA 5EPOA 5TVGA 4M37A 1GY8A 1P3Y1 1A4RA 2QXYA 4TXHA 3GNSA 1CUDA 4A8TA 1KO4A 3BA1A 1W47A 4QU8A 4A6EA 2JJ2D 2Q8PA 1WHTB 5HDQA 3ZE1B 1ZESA 3PBKA 5J4HA 3NHZA 1VPTA 2GAOA 2IITA 3O2NA 1UPBA 1MNQA 1Z4OA 3SYRA 4MP8A 5D3KA 2DPYA 1PHPA 2CYBA 4LI3X 4NWIA 4OMDA 3RC1A 2O8DA 4PIPA 1ZRSA 5A5FA 1L4BA 1UKYA 2WJHA 3WGYA 5ILOA 2LGJA 3ZNPA 1HYQA 4Y0VA 5GONB 1KDPA 2ZRQA 3IVMA 2WKSA 1CC1S 1CETA 1NONA 1KZ1A 2VPQA 4GECA 4KN6A 4MKFA 1MFZA 4MPPA 3LLUA 3T0IA 3TI9A 4A8JB 1IHXA 2N1MA 4PWZA 4RZ2A 1WWKA 2H1RA 3MT7A 4V1CA 4EHDA 1ZITA 1ZNZA 4C2BA 4F4JA 2V7PA 2AMJA 3NWEA 1Y6RA 1V3UA 4MQUA 1I6KA 3SHFA 2TMDA 3PUIA 4AF8A 1T6ZA 2OQ2A 3FE2A 3MS7A 3OWXA 3HUDA 2HBYA 3Q6MA 4NOJA 3REQB 3E6AA 1S0UA 2YMQA 4BO7A 1TZCA 4EKDA 5B4TA 1MB4A 1RW4A 2VDKB 4TWZA 5G0UA 3DLHA 2OO3A 4Z7JA 3VKWA 3LP6A 4CMBA 1J7JA 5FTJA 3SSOA 1Z73A 2XCRB 3TFQA 3KPYA 1CZNA 1YIDA 1KS2A 3UKOA 2FW7A 2PKEA 1SCNE 3HKCA 4KO1S 3N2YA 1B1CA 1LZKA 1NVEA 2WHPA 3RREA 3NIWA 4NZOA 4NEQA 1JYFA 2ZIVB 4C21A 2CLLB 2KWIA 4QSHA 1N2OA 4AJ1A 1LI7A 3RASA 2OV3A 3RANA 3W9BA 1EFAA 3M3DA 1NPDA 1NP3A 4J0KA 3IVXA 3FI9A 4LF4B 4FW9A 4WXRA 5C80A 4F92B 2P30A 1YR7A 1MX1A 4UTOA 5KQSA 3F73A 3GR6A 2NZXA 2W2LD 5ALDA 5EUMA 4EF6A 3TQHA 4AKSA 5L6MB 4RADA 2R7NA 1Z8HA 4KITB 1KBOA 2ZJ8A 4KLAA 4MAAA 3B1VA 1J33A 1FYEA 1UJNA 1US8A 1JFVA 1U0TA 3GOHA 4M8IA 2QRPA 5B3JA 5DJ5A 3SQNA 3AL2A 3PFWO 3WWPA 3KRTA 5KTSA 1EJ2A 5T4EA 4OSPA 5LQCA 1H1TA 4RIHA 2W6NA 2X7XA 1OVMA 2L82A 2X6QA 4KE9A 2BT4A 4RPKA 5FYDA 4FKBA 1CF9A 4EYQA 2RHOA 3GT0A 4YBRA 5KVAA 3L7BA 1XZQA 1H5QA 3CUWA 4LWOA 4BGEA 4P3NA 4NH4A 3CZ9A 3T5GA 1Z5WA 2ZS7A 3IBYA 3IV6A 4UE6A 2IX9A 4LRYA 4XM2A 2C03A 4D9KA 4LDNA 1T9DA 4G9BA 4TM7A 3FYDA 3R0XA 2Z9DA 1SVSA 1XD8A 4KCGA 1TJNA 2DEUA 4V2UA 4YQEA 3FOEC 4QTUB 1JMVA 1I3KA 4JLJA 3SDBA 1K89A 3ZY5A 2JH8A 4Q4HB 1YJ5A 1K5HA 2EARA 1K68A 2PGAA 3BIOA 4I5GA 4R8LA 4DILA 1UBLS 3T1QA 1FP7A 2CXHA 3QKSB 2WD7B 4CQLB 1S8NA 2BBTA 2ON6A 4IQFA 1HG1A 2V96A 2YQ4A 3GLKA 3KQHA 4QPDA 3RHTA 1GQQA 3C0KA 3EXIA 4LNUB 1DTSA 4RJJA 1NFFA 4CMEC 1ZVVA 1LX7A 1N6RA 3QWIA 4K28A 2GN2A 4YC7A 1U7TA 1YOVB 5EP3A 3ETJA 1Q2XA 1XVIA 3ZIAD 2X5OA 2VJLA 1AIPA 1YE8A 4CF4A 2IYLD 3HJTA 5C32A 4ZAZA 1U5BA 2NADA 3A6KA 3E9NA 3FGNA 3SMVA 1YCGA 3HXMA 1DAOA 3BK7A 3HU5A 3C3XA 5F98A 1NLUA 3FBGA 1SZPA 2BEJA 1W85A 4JBHA 2VDVE 5HQJA 1JG6A 421PA 4BGUA 4DG5A 4JLVA 1FQKA 1U0SY 4BO6A 1QG4A 3D3JA 1R4MB 3G85A 2XQFA 3BXZA 3G7UA 1RPAA 2RHHA 1Y48E 3WO1A 5FOQA 8MHTA 5CBKA 4DLTA 1KVTA 2V7UA 3FOCA 4LXGA 4OHXA 1CEEA 2P7HA 4YUXA 2WKPA 2M2IA 3U4GA 3KOMA 3AINA 5H3LA 3TNDA 1OAAA 5A9SB 2J33A 2PX3A 3IVGA 2QRUA 2YWHA 3HDVA 3E70C 4YEDA 2DHQA 2XUFA 3BCHA 2OAP1 2Z09A 5BSUA 2AK3A 1YK1A 3UMJA 4IX1A 3U56A 1NVAA 4QLBA 1NHWA 2J6BA 2KE5A 1AS3A 3AH8A 2HDWA 3Q0EA 3JASA 5KQLA 5HKAA 2X0DA 4QGBA 4RHEA 3TLZA 1K8ZB 3WHPA 2P8SA 1VRWA 4YMUA 1ZGHA 4LV6A 4F3NA 2IYQA 3DHEA 2D62A 3EGCA 4P58A 4MA0A 1RHUA 1W5SA 1XA3A 1YDFA 2XSZD 3ZDDA 3FTEA 3O8QB 4XUGB 3Q2KA 1DXHA 3O3MB 3K0AA 2NPIA 3EARA 4F2PA 4GMKA 4WK0B 1W1UA 4PLWA 4ALLA 4CEJA 3BN8A 1XXHE 1IATA 2AMLA 3G8AA 4MYTA 3U3OA 1SIUA 5CA1F 3TW0A 1VDZA 2ZI9A 5J2TB 1KI6A 1JXAA 4PSUA 4U2FA 2P5YA 3CUVA 2GKOA 1XWIA 3GPCA 4P35A 1U8TA 3IJRA 4P92A 4IIJA 4I50B 4NC9A 4QDTA 4EJSB 5JY1A 1FMFA 2H51A 2OAQ1 1V8ZA 2QG4A 2G06A 2BMJA 3THOA 3WGLA 3KQLA 3L0CA 1Y7PA 3OZXA 4MWGA 1JALA 4FCTA 4EFDA 1TKBA 1SD5A 3G2QA 3KPWA 3O3OB 1Z3IX 3QXJA 1Q19A 4S1OA 1X7ZA 3FHOA 4YP5A 4MV9A 5DHTA 4JI2B 1N2CE 4KXLA 5KUTA 1HTTA 1M7BA 3BWBA 1G6Q1 1TADA 3OOHA 2LD4A 3ZDCA 3VTAA 1VPWA 1D03A 3LLSA 4HAWA 1QVWA 1XKLA 2MYNA 3NNDA 4RQAA 1C5KA 1NR7A 3TRJA 4AUEA 1ND5A 2FPUA 2YXBA 4P80A 1NBAA 4WACA 3DFIA 3KO8A 4Z6KA 2GNPA 1KPHA 3AK4A 1HFEL 2A67A 1XU4A 1AHNA 2ZYSA 1ML3A 2FEOA 4E3WA 1IN6A 1J97A 4UU7A 5B7GA 3N53A 5JJLA 2X3YA 2EJUA 1MVNA 3ZWPA 1IBCA 5C4GB 1A8QA 3DT6A 3OTGA 2NW6A 2A5FA 4OMCA 1TO1E 4FONA 4MGKR 1A5AB 3V8QA 4N76A 5E9QA 4YRLA 3BMNB 3VU3A 4LYFA 2NVUA 5AVXA 3LT5A 1KQGA 5LL6P 1JXQA 4FWBA 1PEYA 4N01A 3BE6A 4MVJA 2F55A 3NT2A 1YAJA 2IK8A 5CIQA 4PCUA 2O5EA 4HGZA 5JSFA 3L4JA 3Q1KA 3TPFA 3TQIA 4LF6B 1FJGB 2HRQA 1EZ4A 1PWXA 1HDYA 2JBWA 3QENA 4BJ1A 5HQTA 4L1KA 2Y92A 1XTBA 4ZN6A 2CVQA 3MJ4A 2QRGA 2W22A 1NKTA 2YNMA 4O3FA 1T9GS 3R20A 3WA7A 1RYEA 3HP1A 4W7SA 4WJLA 1O0CA 5DWQA 1D5WA 5BQ3A 1AE1A 1RCUA 2QAGB 5BSEA 3L0IB 4BUCA 3E3OA 2OO5C 4LI0A 3OZRA 4IKEA 1RQNA 1JPVA 3AFHA 4D25A 3CU5A 3EVBA 3MNFA 3ZLBA 5LYJF 1O6FA 1U0LA 4ROSA 4HZUB 1DLJA 4OG2A 5KNLA 4G37A 5KWIA 3NHMA 1P6UA 2I29A 3KU4A 1TK3A 1GQ2A 2GYWA 3MJVA 2GFQA 4Q16A 4C14A 4CV3A 4F9GA 2W98A 2OMEA 1TXGA 3W3AA 5HZHA 4G5RA 1V3VA 1BO6A 5KX5B 1DWUA 1L7QA 1M9NA 1CDOA 1E4OA 5KYWA 3R4CA 4IR7A 3KYIB 1EIWA 3BXOA 2OP0A 2WU4A 2WYOA 1K5GA 2JVIA 4NBSA 3GLTA 1WX1A 3V1LA 4YV1A 4UTZA 4QUAA 3LXMA 5BN5B 3H7AA 3SHOA 1CDEA 5I3ZA 3GUYA 4MRVA 4CTJA 1LPPA 3IOCA 3S8MA 4A6DA 1XDUA 3VNAA 2Z4RA 1PWHA 1SXHA 2CLFB 4IUCS 4IMPA 3WIDA 4HDRB 2OXFA 1K3UB 2Q9UA 1MAHA 4MI9A 5EJFA 4HLDA 1ZH8A 3TZLA 1L5HB 5GY7A 3ZV5A 1C3XA 2BEUB 3KVYA 4WOBA 5CURA 2FDCA 3PKIA 3UAWA 1YDEA 1WDWB 2EW1A 4LXQA 4MINA 5DDIP 2XUGA 4ZU6X 1C9NA 1JNXX 2O6LA 2Q1SA 3TDKA 1I8TA 2ZGVA 2VT7A 5FWDA 1P0QA 2VCHA 3VNRA 2FHSA 4CU2A 1USWA 4UCQA 1A50B 1O4WA 2GTHA 4YS6A 3ZJ4A 5B1DA 1BOFA 3R0QA 4EMSA 5HZKA 3DL7A 5K0EA 2CXQA 4DAEA 4JOCA 1GDDA 4A16A 5SY6A 2I2AA 3AZQA 5DHQA 1A88A 5BNFA 4Q1BA 4DSTA 1ZCJA 2G71A 1UMCB 4PAMA 5E4FA 1S3SA 5HFNA 4YYZA 4XSHA 4YRBA 3UFXA 4E6PA 3QE0A 5JADA 1QSGA 1T10A 1HO3A 1V5IA 1QQ6A 3ZU2A 4M49A 3WSVA 1TKRA 1SXGA 1ENYA 4WN3A 3UGQA 3AX6A 1ZR2A 4E2ZA 2ZE6A 3EXEA 5LVAA 5JVDA 1C7RA 4GZMA 4TWJA 1YOBA 1Q3KA 2WBLC 2PD6A 1HYEA 2RGUA 2ZBUA 4LV8B 5CRIA 2OOSA 5EJIA 2IS6A 2I54A 1BU5A 4II3A 3ROGA 3NRCA 3PWZA 4Z4CA 2XODA 3ZWNA 2VK1A 3DE6X 2BJVA 1W1IA 2ZJBA 3KALA 1MGOA 4R2KA 3ZIUA 3KAJA 4MGZR 3C3YA 2Y2VA 3E5HA 2IKSA 5KC9A 6REQA 3TEFA 1N2CB 2PEYA 3DEJA 1YS6A 4HQLA 5CP8A 2PMEA 4JNCA 1EUZA 3C5HA 3UXEA 4BJHB 3ISTA 4AG3A 4G23A 4JUFA 3KQKA 4O5AA 3BIFA 1WO8A 4L22A 5BOSA 1N57A 1I4EB 1SHKA 2GAIA 1JG1A 1DKOA 4HQ0A 1UM8A 4L73A 3IHKA 4IGIA 2E4YA 4PHHA 5CH8A 5CT5A 5DU2A 5HF6A 5JMOA 2VTEA 1Q7RA 2O2DA 2AEFA 1G8JA 1QIMA 2GUGA 4UDXX 2QU7A 3GP5A 2CE7A 5ECWA 3WHLA 4O59O 4BLQA 1YA6A 2D2XA 3CTMA 1E3WA 3R7NA 4J0CA 4OMUA 5KI6A 4IWXA 4Y2YA 2YTZA 3QU2A 3VSAA 5F2EA 1GYPA 2DG2A 1AQUA 2EBHX 3D6UA 4RSRA 4NATA 1EP3B 4GPZA 4WNAB 3W6OA 3PQEA 5HHTA 3MW8A 1EK5A 4N8EA 2GO1A 1B8VA 4W8HA 2YV1A 3CR7A 1JLHA 4PVDA 1JA9A 1APBA 3Q7IA 2FPIB 4OREX 1D07A 2OZEA 1L4GA 2MSEB 1RLUA 1WPGA 1P1JA 2JGAA 1M10A 1VFNA 4AX4A 3UB3A 3K6RA 1HG0A 2P2GA 3B1ZA 9ATCA 2XXBA 1N5LA 1NW4A 2GR9A 2GEBA 3DV2A 3TW8B 3K7EA 1I4WA 5LXTA 3UANA 2G9NA 3ORSA 2MJLA 3WGJA 2JJYA 3TWOA 3D4LA 4FEYA 4B17A 3STUA 1U1IA 5GONF 3TLAA 2G8NA 2VUTA 2XVZA 4NZNA 2PX0A 3LPMA 4RUKA 3M5PA 2WICA 1W9HA 5DE3A 4ZC8A 4Y2RA 4MQBA 3RHSA 1ZM4A 4CV2A 4L8FA 1IXSB 1T2DA 2NACA 4IG9A 1TJ3A 1T2FA 2GJSA 2XTAA 3PU6A 2VHXA 3ZDQA 5C46F 5CDFE 5K0GA 4E30A 3DZIA 1PDOA 1TVKB 2V98A 1K75A 3CSDA 3JZDA 2ANBA 1HETA 2FP4A 3BMCA 1DAIA 3H5LA 5LD2B 1TYEB 4MQEA 3GRVA 5EJ2A 2ECPA 4ZCTA 3OOWA 2DGDA 4EQ6B 1MAWA 3FPFA 3CGGA 5HTKA 3BWMA 1I10A 2XKKA 1MB9A 5JBIA 4WXYB 3EC1A 3NHSA 3O21A 3ZGYA 4CFZA 1AZLA 3H75A 3QJYA 4EKYA 2Y05A 1FX0A 2ATEA 3O8NA 2O8NA 3DE5X 4EB0A 4KLRA 3BREA 1IY0A 3JZIA 4UTPA 1JNYA 4WGGA 4A9AA 2MTBA 3DGEC 3M9WA 3V4LA 3VZPA 2HSGA 1HDEA 4MPDA 5TS3A 2CUTA 2VSQA 4AP5A 1MV5A 1GN9A 4NG4A 1ZR4A 4HEHA 5TQ0A 3HU2A 1J0BA 1HT2E 3IMGA 4V2IA 2O7VA 1KIMA 3KEOA 3SZGA 4F4HA 5JO0A 1AGRA 3KZOA 3LX5A 4FBGA 1QFXA 1G21B 2HPAA 1WABA 3GA5A 4HH4A 3HZHA 4G8JA 5CXUA 3QI7A 5C18A 1FFWA 2JANA 2ENUA 4CKWB 3HSKA 1T2NA 3ETHA 5AJUA 4PPYA 4R05A 4YCDA 4U1RA 1KKLA 3CCBA 3RUPA 2P9TA 5EUBA 1L5VA 1WB6A 3NHBA 4UBIA 3RTAA 3PI6A 4QOFA 4ZKEA 4BLWA 2IYEA 5K8LA 1HL3A 2BF7A 1KOGA 1EAYA 4K6FA 3OIGA 2XF2A 4UHFA 3PQCA 1U7PA 4H6PA 5CLGA 1NMSA 5AKXA 1HR0B 4EY3A 4TV9B 3HKDB 3LWBA 1P2UA 4QXPA 1SWVA 3RC7A 1CP2A 2PMBA 1XELA 2P7IA 1ZM9A 4YDHB 4X3CA 1KAGA 3EVCA 4H7PA 2NUBA 1AGPA 4CRWB 1T5HX 3GJQA 4Z0PA 3OJXA 3RTBA 4C3OB 2NXJA 4H0NA 4COKA 3DE2X 1Y98A 1S2DA 1XE3A 2J32A 1SOVA 2AOUA 5AKLA 4P4NA 2UYYA 4PTLA 4IMRA 1UKZA 3L1VA 4L6IA 3L40A 3RSFA 1E6WA 3PHGA 4C30A 4MVYA 3RQIA 1LPNA 3DKVA 3HA2A 2HK6A 3EJ6A 4IV5A 4CR7A 1T35A 2X86A 1LBHA 1S89A 3VZQA 4Y2HA 1J2RA 2C29D 2VBCA 2W0MA 1TU4A 2RH4A 3I9JA 4FMPA 2GA9A 1PKXA 1U2TA 4KYUA 4R7GA 2XXAB 5BN3B 3FYSA 3NIDB 3COPA 2J87A 1EGQA 2CFUA 2XMGA 1Y8RB 5J5CA 2X5XA 3VR4D 3JWPA 3H1AA 2I4MA 3GPLA 4AMBA 4U0JA 3SYTA 4CQMA 4HC4A 4L0MA 3FVWA 1GNLA 4P2GA 2V6FA 1DIHA 2G17A 5EWJB 3A04A 3BX1A 4PO9A 3VSBA 1K6XA 3MCUA 4KRFA 4H3VA 3IESA 3I83A 2W42A 2F1JA 1H94A 5EXSA 5FBKA 4OJYA 4CKYA 5FWXA 1CERA 1YRYE 4OXIA 5A4AA 2V0NA 5HOQA 4MK4A 3EY4A 3MPOA 3SCZA 1BVHA 2GPNA 4J2HA 3TG8A 4MWDA 4ARSA 4I2VA 5ALVA 1NF9A 1KBQA 2ODQA 3F6PA 3DDOA 4N0PA 3IE1A 4OFXA 4ZVKA 1ZIDA 4FFWA 1QZXA 5MGNA 2QJOA 3QE9Y 1CLUA 4HXYA 3RS0A 3BERA 2XMBA 1C2TA 1CY1A 4U7HA 2L18A 5DW0A 5E6RB 1NT2A 2E82A 3QFSA 4GBJA 2QM0A 2QTNA 2XQKA 4FE7A 4NEHB 4DR5B 1F5NA 4JT8A 2CXPA 3AERB 1P75A 5LKAA 1ZWKA 3Q3JB 4G0PA 4TTQA 5LBTA 3F4KA 4LYJA 4BKMA 1RXCA 1IXZA 3H6KA 3QBJA 1MT3A 4LHXA 4GLJA 4UHHA 4Z4EA 5AHKA 2WWRA 5C1BA 3RAPR 4G24A 2GPBA 2DOKA 3PXAA 4OB6A 3WK9A 4BLPA 5CJJA 5K2OA 2ET6A 4YPVA 1WPXA 2VP5A 1AF4A 4MPRA 1B73A 5J2TF 4DDKA 4XWWA 3EK2A 3OOEA 2FPLA 3I6ZA 2AV6A 1ST3A 2AFIB 2OB2A 2HLHA 4QQFA 1NZDA 2ZR7A 3CLSC 4TT3D 2B34A 3ZTYA 3GN1A 1KFJB 4EGCB 5ALXA 4RTPA 2H2AA 3HYSA 3CLHA 4LHSA 1N34B 3HHEA 3EZGA 3PL5A 4D79A 2QRVB 1VM6A 5EKDA 5EJ7A 1GA6A 4DQKA 2X8JB 5GJWC 1EBFA 3QJGA 3GLIE 2IZOA 3LVQE 1NN5A 4C0WA 4ISBA 3BJMA 4LHWA 1NXVA 2W71A 4PGGA 2VDWB 4ZT6A 3ROXA 1KZ7B 1MH1A 1IZ0A 3T3OA 5ESWA 1MRSA 3L4KA 2Q5EA 2AW5A 4CCSA 2C83A 3CWZA 2YZ7A 4GQIA 2OCYC 4EENA 4G2TA 4P9NA 4MA4A 4OKNA 1ECJA 3OM1A 4OHBA 1FS6A 3ZU3A 1G98A 1H2BA 2J41A 4UAJA 4ZK6A 4KQHA 4HXEB 2L19A 5T41A 3WK6A 2JIRA 3C1TA 1M0EA 2OHFA 2CXUA 1KNXA 1R6TA 1S01A 2NXEA 2YBDA 2H7XA 2UZ1A 3TJRA 4DC9A 3IX7A 4N6OA 3KQYA 3NHLA 2CWWA 2JFHA 3OTOB 1QYVA 2GKSA 4BMDA 1RAIA 3AY0A 5DN6D 1SCUA 4JVSB 2HNBA 2ZPTX 1ZCBA 2Q4EA 3AHHA 3VR6H 5B57C 3TKAA 4E2FA 4NKRA 2HA6A 4HJRA 1ONPA 4N47A 3DWFA 4V0ME 3L7DA 1H0HA 1SG6A 3R6GA 1PD1A 3FNGA 3DLIA 3MJEA 4P7GA 4AFNA 5E7JA 5I4KA 2HB6A 1U02A 4P4UA 2CLHB 3VR5D 4N0QA 4QUGA 4ZEVA 2H1HA 1AA6A 3TMKA 2Q0QA 1VL0A 4A2CA 4BMYA 1Q22A 2F62A 3VR1A 1OT5A 4BP9A 3OKFA 1IY9A 1ACJA 2DWUA 2DJIA 2AGVA 1J7KA 1TU3A 2ZVQX 3HRKA 3NB0A 4WRRA 1KI8A 2DR0A 1BVYF 1IOVA 1KIAA 4GI3A 4MS1B 5CTAA 1ZQ1A 4BQNA 1QOPB 2Z2XA 3IJPA 3PS9A 3Q72A 1W1WA 4MKHA 1G2QA 2XLCA 1BHQ1 4GH5A 2ZS8A 4P3PA 5DLQC 1DV2A 3KKQA 2F4VB 2LUOA 3JAWA 4A0HA 2WJGA 1E1QA 3DMFA 4JSRA 1NQOA 4UBOA 3RBXA 3ENWA 4GLOA 5T8KA 1RR6A 3LX6A 3MJSA 4Q0MA 4QFDA 1HNNA 4CPDA 5HEKA 5ALNA 1S1CA 3F5SA 3KPVA 1K1EA 3ICPA 1KH2A 1ZOIA 3D0QA 1PR0A 3GCDA 4YJGA 2FSPA 3VOAA 1P8AA 1D6JA 3FPBA 4LJ4A 5FBQB 4LOKA 4I4IA 4IUBS 1ZHOA 1BW9A 4UW9A 6LDHA 3N59A 3EOZA 5KX5F 2XUAA 2FPMA 2Y6VA 4PGFA 2HWXA 3ZE0B 2JLSA 2D7CA 4M1SA 4CF3A 3AHCA 5GZ1A 3KSBC 3CO0S 5JH7F 4IKPA 2HREA 5K03A 4IQ0A 3GEBA 4QICA 1QK4A 4CIBA 1B8NA 1KIFA 5I7SA 5TS2A 2ERXA 1HDIA 3QVSA 1GGMA 3GEGA 4QWMA 2GF0A 2EQ5A 4KH0A 5CW2A 5EMMA 5CCEA 3D6FA 5KU7A 1Y3HA 1QGAA 2NU6A 5HRCA 1WVGA 2DKFA 1ULBA 1A5ZA 4N7RA 3BIXA 4V3CA 4BNFA 1TW3A 2ATXA 5AJZA 1G9SA 3M70A 5C3MA 2C96A 2HRBA 2Q4DA 4RX1A 3BGOS 3OZBA 5IH3A 2Y68A 4R1TA 1TMYA 2WKRA 3UK6A 3IPRA 5KZMB 5JDIA 1ICEA 2B9VA 2ECOA 2PN1A 3A70A 5DI3B 1QF6A 4TVOA 1KZGB 1NUAA 4OIFA 5JD3A 3AU8A 5EXEA 7REQA 4GOOD 1CX9B 1R9JA 5LB2A 1YZHA 1JH9A 5G1NA 1SVWA 3R76A 4Y67A 5C0OE 3UFBA 1N78A 1X7XB 2GI4A 1ORDA 4B6SA 1U5AA 4HEQA 4TKLA 4EA9A 2AJTA 1H2HA 1TQ2A 1TTTA 3B6ZA 3I12A 1UFOA 4R2HA 1OXTA 5LJIA 2H52A 2R96A 1E9VA 3HE3A 3TFOA 1CQWA 1TIBA 3ND5A 1DJLA 4UU0A 1JSLA 2XUIA 4HB2A 2IRWA 5IC6A 2BRUC 4U9HS 3P9SA 1L5LA 3BEOA 1G63A 3W5AA 2NZJA 4OTZA 3Q5EA 4QBTA 1KYQA 3HCOA 1E79D 4DSZA 4ZVUA 5LZ5A 3LCMA 4I7EA 3NBYC 1JA1A 1GV1A 2LR0A 4I3HA 1S9HA 1QIDA 2JK1A 1BGWA 4EA7A 1SQ0A 4KWIA 4N6GA 4ZCQA 4YXFA 4PYRA 3JYNA 2HN9A 4Q3NA 5DTRA 4QO8A 5JLAA 2AX4A 2VYNA 4DS3A 4JJ6A 1GPYA 5CEJA 5CFQA 2JI9A 1CPYA 2Q3LA 5K6TA 3G0HA 1L4UA 4ZHQA 1DARA 3RS4A 3MQ4A 5FTMA 4FN4A 5KQMA 3AM1A 4F3KA 2IJGX 1PL7A 1JEYB 1TMKA 1L4MA 5L6LB 1GNRA 1NQVA 5TQ2B 2JH9A 3GDHA 4R1LA 1L7EA 3NHAA 1Q2UA 3SX2A 1W93A 2ADFA 2VG8A 2QX8A 5AJWA 2O8DB 1VKOA 1BQ4A 3ANTA 4C7JA 2Y67A 1ZD1A 4TLMB 2R60A 4KO2S 5HR5A 3PHCA 5ELXA 5AESA 3GJRA 2O8CA 1T3SA 1H9CA 4MQMA 2VJNA 1AKWA 4GKJB 4NQRA 4B6OA 4CL8A 1EK6A 1ZINA 1QG6A 4L9RA 3V8PA 1T1IA 1FW8A 1VG0B 4OIMA 4S0ZA 3QELA 5K4GA 1OIWA 1CZHA 2A9PA 4KPGA 4RQBA 3SVZA 1RM4A 4JCOA 3NKFA 5NLLA 5A03A 3BAZA 5EGSA 2WIBA 4I9GA 1DC6A 1D6SA 2VRCA 3BJIC 1WKCA 2IHUA 4KNVA 4CM5A 1K0UA 5IVHA 4PNHA 3Q3HA 1F1BA 1KEEA 1HSZA 2DT5A 3BFJA 2OC9A 1JHZA 3F8SA 3N6RA 5B1EA 3SLGA 5DXAA 4DR1B 1R18A 3LFUA 2QEQA 5AK3A 3HGTA 1NXWA 5JJ5A 3RU9A 4Z0TA 2QQFA 2YOHA 1DUVG 8LDHA 1FUIA 4QDXA 1OLSA 2A5LA 3OO1A 4XD7A 2XYVA 4D0NA 1ULHA 2GBIA 2FPGB 1IG3A 1HF3A 1UP6A 3QKIA 4KACA 4KUGA 4OOEA 1ESCA 2HSZA 4JC8A 4O4JA 4ZAYA 3V48A 3GLUA 1GSAA 1ZW1A 4XB6B 3IPCA 3WBKA 3GJ6A 3PHHA 4ZYVA 3T9AA 3D2BA 1FPQA 1IVSA 1JS1X 1NRWA 5FWYA 5ALFA 1M6NA 1YR1A 2CHUA 4L2IB 4OU4A 2ZQYA 4B4DA 1WY5A 1EX9A 1JQAA 1ZMXA 1Z5OA 2PSHA 3R23A 4MULA 2QOEA 4PBSA 4M1YA 2Y6UA 4UM7A 5FL7A 4KNYA 1KDZA 3BGWA 3PUVA 2QTVA 1H5NA 1JR3A 1GG2A 3IODA 1S7GA 2XMSA 4LSGA 4IO1A 5DHAA 1JT9A 2IU6A 2IXTA 4OXYA 4R54A 4KR7A 1NVKA 1QFZA 4ZTUB 3H4VA 1JTFA 4ZEMA 2WHQA 1PF7E 5HOEA 4QOEA 3WA6A 1EDDA 3M1LA 1MR3F 1SVKA 2QL6A 4RF3A 3RVDA 1GOTA 1V2HE 2W2KB 3IR6A 3OPYB 2J3MA 1Q0RA 2GEKA 1J0XO 3I2FA 3C15C 3PQ3A 5KBYA 4QHYA 3RYOA 3ITKA 1MENA 4J91A 4B6FA 1T8RA 2GTIA 1WW2A 4Q4DA 1TF5A 4O33A 4U3JA 4OB8A 4MUEA 1R8QA 1WF6A 4XLLA 3INRA 2ZE8A 4LPSA 2WTXA 2XHEA 2YC4C 2R8BA 1RRMA 2IIBA 4JUIA 4B48A 2YY7A 1EGMB 4PRYA 3ZWKA 4RPIA 3ROTA 2X2OA 2UU9B 3ZK8A 3NUGA 5B1SA 3RSOA 1JVNA 2BUBA 3FNHA 3LSTA 4MPTA 2PVSA 5EN4A 2XDYA 1PFUA 3TXXA 4M46A 1M2JA 5ITSA 3KQWA 2ZYAA 2NXNA 2BBSA 2ZSJA 3FMGA 3BGDA 4G97A 4WLEA 1A1SA 4BJ6A 4KKXB 3BZBA 4JSYA 4TV9F 1JJBA 5JZSA 5HA5A 5AUPB 3LC1O 5BSFA 3FDXA 2CNOA 4MVJH 2XQGA 3EJWA 4NCHA 3S1AB 3K0CA 4G0UA 1ZVJA 1BCSA 3EG9A 3WJAA 1SKYE 1TPZA 2VQSA 3ASYA 3OZIA 4FFRA 4G09A 3VO1A 4BX2A 2WZCA 4KI7A 3U9TA 1SBNE 4RH1A 2C1EA 2CV2A 1XEXB 2K2QB 3PDCA 2Q6VA 3JRNA 1PJ4A 1AKEA 2WFZA 4CUKA 4PQGA 5JZMA 4Y98A 1RRVA 4YO8A 5SICE 2NUAB 5JDIC 1VRVA 2GBFA 1BEEA 2FX2A 1PFYA 1E99A 5EC8A 3SDSA 3ZIDA 4R1SA 2QL7A 2WTNA 1M33A 3PGMA 4XWAA 5D1HA 5BQPA 1ZW6A 3PFFA 4WFKA 5BSKA 4QOIA 2XUHA 3U7HB 1CUSA 1I5OA 3A2LA 4IIEA 5T8KC 3N1UA 4UXIA 4ZGWA 4DV2B 3UTDA 3HYLA 3WS7A 1DS6A 3OX1A 4QRIA 2EF0A 5EIHA 1P9LA 1KMCA 1ZK0A 5JHHB 1NPYA 1SHJA 3OO0A 1PN3A 4QTZA 1G4AE 1T91A 2YXPX 4R31A 4MVXA 5CM8B 4NULA 1Q50A 3W3AH 2YVLA 3PHJA 4EZEA 1V6AA 5DK4A 1TT5A 1NI5A 3PDIB 1NW8A 2GPSA 1RU3A 2P4QA 2CCGA 1ZD8A 2VEOA 1SWWA 2FH5B 2IXGA 1T4CB 2VZLA 2ZPAA 3DE0X 5EI5A 4EUSA 2Y1GA 5C2JB 5JAPA 3WFIA 2HIGA 1Q6ZA 2J07A 4GP6A 1D2EA 3P94A 1GZVA 2B4YA 2JFVA 2PL9A 2XA9A 3KSUA 4HP8A 4M9XA 1YU6A 5HIIA 5I7VA 2VP6A 3ZD6A 1QIJA 3Q1LA 2JD1A 2YVQA 8AT1A 4GVPA 5ALJA 3TZHA 5E9AA 4AUKA 2QS9A 3N8NA 4LVUA 2F1KA 1ZGBA 3T38A 2O19A 3UJBA 4OLJA 3G8DA 5EIEA 4RDIA 1QFSA 1XTSA 2HFKA 2VSYA 3R3SA 3YASA 4CMJA 5GIOE 4P93A 2A9VA 4LCBA 3JTEA 1WSDA 4XX0B 5LPNA 2UUCB 4HH0A 3BKSA 1XU9A 2C9CA 3QLJA 1HC7A 2WYWA 4GEKA 1ENPA 5LN1A 4FOLA 4C07A 3UO8B 4MVJP 2NU7A 1N6PA 2H6EA 3RROA 2H5JA 4TPKA 1ZICA 4WCVA 1XYGA 5EWLB 1AURA 3Q3VA 2E18A 3DV0A 4WY8A 5CCDA 4S0XA 5C7LO 1TGVA 4PLFA 4DKJA 2JLVA 4EI7A 1VB5A 4BDTA 1XQYA 1NYLA 4DRXA 2GD0A 4YLYA 1DEAA 3TRFA 3HDTA 1E6UA 2YN0A 3VBCA 4C7KA 3ZOKA 2Q7DA 4WZAA 4GI2A 3T5BA 1KP3A 5I7OA 1C29B 4TL8A 1TQ4A 1B6GA 3T9EA 1WUKS 2I78A 2LDXA 2OWDA 4FCVA 1H2RS 3E18A 1X0VA 2J46A 1L7PA 2ZR8A 3GBVA 1V5GA 3JRXA 4PAGA 4UU8A 4KBFA 4WX2B 4DIBA 5L3VA 3OHMA 4I4CA 3OCUA 4Q9KA 1VYVA 3HEAA 4FYMA 2KM1A 4PFQA 3MUEA 1P72A 1W5BA 1GEGA 3IEVA 1IWPB 4TOIA 5DNAA 1Y80A 2QY6A 4L50A 1QJCA 4F6LA 2Y27A 1HM5A 3U16A 2F43B 5JZ9A 5KNBD 4JI7B 2HMVA 1F0PA 3B6JA 4P0TA 5ELLA 1NAHA 2EKBA 3OM0A 5CNKA 5MFPA 2Z95A 5JAMA 4NU8X 3M0EA 5JS7A 1FVFA 4C0KA 1QIKA 2XMDA 1G66A 2Y1WA 1Q1GA 1PD0A 1UL1X 4OM8A 4EGSA 2P41A 4WGFA 4YH1A 2ETVA 4JKOA 2CE2X 1K7SN 4FCCA 1QGZA 4W8OA 1IZZA 3RBZA 3V1UA 3V97A 1P80A 1GEEA 3SVTA 1LQUA 2V55B 4ZZ1A 3GG9A 2IKQA 3A7EA 3RW9A 1SKYB 3H2SA 3AR7A 4LZAA 3INNA 4UUMA 3PZRA 2YVKA 3HEMA 5KWSA 1TU0A 2M6LA 1QE3A 1GUYA 2B0JA 2P11A 4ZYWA 1TTQB 2OK7A 3NXKA 1VLQA 5I7EA 2G82A 1T8YA 2JRCA 4NVRA 5HBRA 1NV9A 4CTKA 5EJ4A 2BGMA 5SY4A 4UVHA 3LAWA 4F8YA 1F8UA 1PTJA 3NTVA 5EJEA 1BFUA 2GN1A 5K8UA 1HY3A 1JJFA 3R9XA 2IPAB 2BOVA 4ZRDA 1TCCA 3LKBA 3L79A 3CY6A 5EESA 2VZ0A 1IM5A 2V9ZA 3DXZA 2QBYA 2E55A 3GH3A 5SYMA 1NF2A 4BQIA 1QZTA 3CBGA 4M86A 1R1DA 4BNDA 1BX1A 3T7TA 3EPPA 3W6NA 5B2ZA 1ZGZA 4I4TA 1E1RD 1PFWA 2OAGA 1CCWA 4XVCA 1L7RA 1K98A 4KMRA 4ARCA 1XCOA 2JFUA 4GSKA 4O29A 1KZYC 1R0WA 1RDFA 2D5IA 4YDSA 1HE5A 2WIAA 4KXMA 4Q9DA 1OGIA 3IDSA 5IAKA 3HJCA 4ZOAA 1XZ8A 4J49A 4OBBA 5HBGA 1VHJA 4NENB 3SZMA 4XTRA 2ZUFA 2P9FA 3Q7RA 1KMHA 4RKQA 4U7WA 4UM5A 2WI8A 4JI0B 1TM3E 2ETXA 1VPEA 2C77A 4HO1X 2NSGA 2I9PA 1YQWA 5K45A 4RO0A 3K9HA 5H4HA 4XIFA 2F1HA 2JFQA 4PQYA 1T2EA 4P22A 2X0RA 1G16A 1ACLA 4YCSA 1VSUA 4Z4FA 3IQDB 5LA6B 2WWVD 3BH7A 2WJWA 4N18A 5AH0A 2NTEA 3DTVD 3UNXA 3ZGXA 4R81A 4YX9A 2EKDA 1JB1A 2CFCA 3AEKA 1N2BA 2RK4A 4FK8A 2DYKA 1G8PA 3L0ZA 3SJAA 3BEDA 1CW2B 2FA9A 3EWNA 3X2EA 1GRQA 2DUJA 4K2AA 4BB9A 2XZOA 1J20A 4DR6B 1FU8A 1U28A 3JZAA 1Z2NX 3RIMA 3G0IA 3OJCA 1KRHA 3MIZA 2O8FB 4RIFA 4DUPA 4DSUA 1T1EA 4QLAA 4NBWA 5CNIA 4MLZA 1U9JA 5AP9A 3TOXA 4ND1A 4B3JA 3T7DA 1N33B 4BX0A 1P60A 2RGWA 4O02B 5H70A 3TPZA 2HADA 4AIRA 2QTFA 2EG9A 1TRHA 3VGPA 5TMBA 3LYAA 4HDKA 1GO2A 2PUWA 4KR6A 4J0QA 2R48A 1VE9A 1TD1A 4HI0E 3N76A 1U6KA 2B7CA 3EVDA 5J2UB 2EX4A 3ENZA 4M6WB 4QEKA 4ND8A 1Q7EA 3ZE9A 1X1EA 1X3LA 1G7TA 3EFOA 1KOLA 1TEVA 4IHAA 1A2OA 1EDBA 1WA5A 2GF2A 5F1PA 3E7XA 1HMYA 1NX9A 2INGX 3RRNA 1R74A 3UWKA 3ZDFA 1ODCA 2DC1A 2F67A 1G9XA 3FRJA 4CTOA 1MUUA 1ZRHA 4CNQA 2R4QA 3TLKA 2ODEA 2ADMA 4RV4A 2MU1A 3EX7C 1HK7A 5CLJA 4A10A 1S2IA 5EMHA 3ROEA 2JFBA 3FSRA 4K9NA 2PBLA 5TR9A 4GPTA 3BQ9A 2C2MA 4R2LA 4ZQEA 4WKBA 3MT8A 4MMXB 3CSSA 4PHCA 1DFIA 3ROFA 4R83A 3L01A 4TL7A 4YWJA 3ZWXA 5IVKA 1JX6A 3F1KA 1FYVA 2OHJA 3G2JA 4ZVPA 2BGGA 1PRYA 1UEJA 3TQQA 3E2PA 3IXQA 2R8YA 4B74A 5BMVA 2ZT5A 3UA3A 2P3QA 1R0CA 3KTAA 3MT9A 1R50A 4KWHA 1X7GA 3NBAA 1AK2A 1JDJA 2J3LA 3DOJA 3HRIA 1GUFA 3JR3A 1QO7A 1RE1A 2C5BA 5HIKA 2BF4A 4DV0B 2PWAA 3SX0A 4GG1A 1WXHA 5EIXA 3HU1A 2G04A 3JQGB 4L85A 2JI7A 2PZMA 2D1SA 4Q7MB 3UJ6A 5KWVA 2AQIA 4JT2A 4PDXA 4FZVA 3NAGA 2YC2C 3E3LA 4M2LA 3L8FA 5BR7A 5EMJA 2IDMA 2FWRA 1SXJB 2B7BA 3M4XA 4MWEA 3VKFA 1NSTA 2BFDB 4MUHA 3KSRA 4NAVA 2OK8A 5TMDA 2WAYA 1XZBA 2OZGA 3A9UA 5K4HA 5AYVA 4LDAA 3WLRA 2EEPA 4ZV4A 3IQEA 3FCXA 2ZTLA 4Q1CA 4C08A 1X1RA 1Y0BA 3RTGA 3EFBA 3HBFA 1QIEA 4XPIB 4Q7LA 4DA8A 4HQ6A 4QYTA 5AVRA 2W83A 4F71A 3W2EA 3PG5A 4TLEA 5KTKA 4KLCA 2WIJA 3JYOA 3DKIA 4G6ZA 2NBMA 1LBTA 1LNZA 2P6MA 3TLCA 2F3SA 3QEAZ 1WBDA 3WQSB 2Q6OA 1CIJA 1UBOS 2SICE 3AFOA 3HV0A 1D5CA 4O4LA 4ZYXA 3PC8A 4I4LA 1F48A 3AHEA 4ZARA 2FLVA 1VQ1A 2FQXA 5EHGA 2IF2A 5GM2A 1Z17A 2SHKA 3P97A 5U4XA 3B1WA 1NW3A 1BXGA 1Z68A 1MJNA 4EF4A 4QFCA 1WU7A 1PUJA 4DZZA 2ID7A 2LVBA 2ZBGA 1OXKB 2PUCA 1OJ7A 3W34A 2JDID 1GGHA 2H18A 5FTWA 5J40A 4F12A 3OTHA 1UBSB 2G7MC 2VQDA 4ZALA 2CBZA 5IFLA 1L5FA 4QFMA 1JDNA 3B9PA 4DG8A 2VTBA 1CVRA 3ZDYB 3F98A 2I2WA 1J8FA 4C0SA 3UHAA 2PIAA 3U62A 5D3MB 1CUBA 2GVZC 2B1IA 1GPUA 4I36A 1TEXA 2QYHA 1IUPA 4KDFA 3V2UA 4S05A 2NO9A 3ADDA 3KYCA 4AZWA 2EDAA 3GLIA 3SKVA 2Y1LA 4LYHA 4H35A 1QIIA 1O94D 3A1DA 3CNNA 3KQOA 1QDLB 3LQ1A 2C1XA 3AGQA 3LW7A 4MQ5A 4NPCA 3OT4A 3U4IA 4JYCA 1T1GA 1XCJA 3WLHA 1KI1A 3E48A 3V1YA 5F3WB 2PCJA 1A4UA 1NUSA 3Q11A 3BWYA 1DI0A 2Z1MA 5A1TA 1E4YA 5CNMA 5IULC 4I3GA 5JHGB 4QOGA 2IH5A 3QVGB 2B2NA 4JFAA 4CEHA 2VSNA 4LA4A 4LMAA 1DXYA 3NIFB 5FR2A 2O0KA 5TT1A 3UT6A 1I7DA 4KK3A 3DDUA 5FAKA 4FM9A 4MX8A 1YL5A 3V6LA 2YOFA 3E03A 5BUSA 2FWNA 2GFIA 3D6HA 3IB6A 4DCPA 4HGYA 2OSBA 1DC5A 1AB6A 3K0FA 1W2GA 2G88A 2OBMA 3JD3A 2QGZA 1ECGA 3B38A 4GZ5A 4X7RA 5AUQA 1NE2A 3EZFA 4MQ6A 3LPLA 4IHKA 4M22A 4Q02A 1PT9A 4MV3A 3OPNA 3FSJX 1KS9A 2E4AA 4IIFA 4OHKA 1LLDA 1M1UA 2ICAA 3FR8A 3EQ2A 1K4MA 4KQ6A 1FW6A 3ZZMA 4DLLA 1PTJC 4FQ5A 4DBLC 2JCVA 5TDHA 1GPLA 2VJYA 2ODWA 4HDCA 4MA5A 2ZXFA 4ERNA 1KP9A 2J6HA 4NFLA 3MWKA 2B4TO 3M2TA 3CVVA 2JFYA 1TUGA 4PPNA 1ZAKA 3JD1A 4JH0A 1PG5A 5DMXA 3TF5A 4X62B 3PC6A 3RJMA 1GITA 3ZHOA 1IOWA 1Z5UA 4ENTA 3IKVA 4MWOA 1CUCA 3EW9A 5HFAA 5DWDA 1M54A 3E05A 4EAAA 4KFCA 2XB6A 4GXNA 4Y0NA 4JI8B 3OQ6A 4PR3A 2VJKA 3JSAA 3O2SB 4M4SA 4DEVA 4DQDA 5J4VA 5D51S 3W6ZA 2JD0A 2Q2VA 4QFBA 3L7OA 1FA9A 4L57A 1YASA 2BY4A 3O4JA 4WV3A 1WRBA 1YZQA 2AE2A 3C3AA 4ID9A 3N2LA 4KUEA 4P83A 2R5WA 1BEZA 1U5CA 3K0EA 1M6HA 3QY9A 3BA6A 3P2JA 4UU1A 4BWFB 1Z33A 3DE3X 2FF7A 2VC2B 3MBOA 4CL0A 5G40A 1UF9A 4ISCA 4JXKA 1NBME 3TL2A 1NN0A 1P2DA 3GAFA 1FFBA 3MBKA 4FU0A 1ZI6A 4F45A 3U9LA 3D5EA 1WFRA 3NAMA 2V1UA 2QD4A 4C4TA 3ZHVA 5ECDA 1NXOA 3ED5A 1R5JA 1HNWB 3FTCA 1RJGA 1W2HA 2QVGA 3EHEA 3NQ41 3S55A 1C1XA 4U2KA 1PEDA 2FMUA 3ABSB 3E4DA 4W4TA 3KUXA 2IUTA 2P2NA 3AVQA 4DZRA 1A69A 1NT4A 2I2XB 2PV0A 3DFUA 3H8SA 3UT5B 1O87A 3WRYC 3ULKA 1OYVA 1ZX1A 3F47A 1F1JA 1JYEA 4XWGA 3KD2A 1E7MA 1HT3A 1R8XA 1ZRMA 2RMKA 4TMYA 3K1JA 1UPXA 3VH2A 3GMDA 4GX1A 4PIVA 5IKPA 2OG1A 4GM4A 1PO7A 2PYDA 4BY9E 1V8OA 2BKXA 4FP9A 4RESA 5ARDA 5IMBA 3MYYA 4EL0A 5FPKA 1JR2A 2ZIGA 2CK3D 4HG2A 2YS6A 3AUSA 1QO0D 1XL1A 3ZWBA 3FUVA 2K7FA 4OHOA 4EY7A 3GLFB 3E2IA 1RI3A 3QKUA 4DSNA 4F2HA 5CVTA 1JZTA 4L6CA 4W1RA 3SHQA 4JR2A 4BNNA 1QHHB 3NJ4A 2ZWIA 2I4TA 3KAKA 3PDUA 1PZ4A 3ZHUA 1EM8B 4K81B 3DUFA 3ZD7A 1QNDA 1YI0A 1ORTA 3TBKA 1JU3A 2IEIA 2ZU6A 3T99A 1M0TA 4D5EA 1L4FA 5A4KA 4X1IB 3W04A 3ZJYA 4TV8A 2BSQA 1RHQA 2XWQA 4AJLA 1FXWF 1U80A 4IYRA 3ZHZA 3K9BA 1QLHA 2R7AA 1IZYA 2DTXA 3DCJA 5EWMB 4WZ6A 2APJA 1IPHA 2FPSA 4JCCA 3WV5A 1UPTA 2J9XB 2PX8A 1ODKA 4GGMX 4L7VA 1WY7A 1BC5A 1BFDA 3MD9A 3Q12A 1YZUA 1Q0UA 3DMHA 2FRVA 1FFXA 3PHIA 1QHYA 1KJ9A 3D2LA 1TC1A 1VJ5A 3OPXA 4QDKA 2OB1A 3P2KA 4UZEA 3AIMA 4Y2UA 4KYIB 3O0TA 2DH6A 2IBMA 2DUMA 2WT4A 3GAAA 3PR3A 3A4TA 4TS1A 5ER9A 4RTOA 1SBYA 1PAUA 3G2NA 2QA5A 4TUYA 3CX4A 3LQRA 2AFHE 1O77A 2OFOA 2PX4A 2RK3A 5C52B 1H23A 2VJQA 3K1YA 4D4IA 1QE0A 1IQUA 4J6FA 3LYLA 1RXSA 1I7QB 4N9QA 1BHJA 4YJHB 3ZW7A 3RGGA 1PEKE 2BGIA 4D3XA 2XUKA 1KHTA 4EIWA 3NFYA 4ZDIA 4PQRA 3EVNA 4TRMA 4B3RB 3RRXA 2BM9A 3W2TA 1ANKA 4H7HA 5A7HA 3VAYA 4ASUD 1HE4A 1UOQA 2CEAA 3GF4A 4LW8A 4MJ7A 3UV6A 4KNWA 2GAJA 4UXJA 4ZZ2A 3CJQA 2QE7D 1G8GA 2FJPA 3SHTA 4RHYA 4KQGA 4QM6A 3ANNA 3QA9A 3RAFC 1T8PA 3NDPA 4R1NA 5EQTA 4AN1A 4XRRA 5FOXA 5KDLA 3FF1A 2OXIA 3I62A 3EZLA 1MRNA 2LP4Y 4D9EA 4YAIA 2X5KO 3VHRA 1HL7A 4AG6A 4QG7A 3R7AA 4JZYA 3COYA 5LQMA 1TOAA 3DEKA 1JIJA 1N9KA 3ESQA 3KHKA 5K3AA 3ER8A 3MTQA 4W8GA 3MFYA 2BKVA 3PC8C 4N3NA 1BGVA 2MSDB 1XOIA 3ZWOA 5JYCA 5CG2A 2FR8A 5KC8A 3JQPA 4D4HA 4MZDA 4WBNB 2FFAA 5DNEA 2YH2A 1J4AA 3P52A 5BOVA 1QU3A 4RZIA 2B1RA 1LSSA 5ALYA 2IE0A 2EJVA 2XE8A 4Z0HO 2CDAA 1ZJYA 4EVRA 2Q4OA 1P7WA 5E0KB 1BA3A 3ET4A 3GFSA 1KJZA 3DHVA 3IPXA 3MA0A 2HPHA 3MCWA 4GYYA 4M7OA 5FP0A 2GZAA 3TR0A 2CMKA 3PGJA 1JN0A 3LPDA 4YI5A 2O3SA 5LA6F 3RVSA 1IXRC 2II6A 4GDMA 1IN7A 2IP4A 3T9FA 5JTTA 1S02A 3LZCA 3H1GA 3R5JA 5LFAA 1EVIA 4ZVVA 2CJWB 4LQCA 1K5DA 3EXHC 2PXAA 2G1KA 4D8XA 3DZGA 1FFDA 3HP7A 3KT3A 2I7CA 3ESRA 1ZN2A 3VU9B 2CBXA 2KLBA 4FEEA 1FUEA 1U3FA 2FU5C 2YR0A 3KFLA 4K9OA 4DMRA 2HU5A 1XMSA 4MUBA 1RPTA 1II8A 2HWKA 5K3BA 4DR7B 1MG0A 1VP9A 3WG9A 2BMFA 1XYYA 2FP3A 4JLDA 1DGQA 4H7KA 3FPGA 1YVDA 3I2IA 3FM9A 1I30A 2JJ1A 3Q3EA 1PWYE 1OR8A 2IHJA 3F90A 1CJUC 4ZA2A 5AT1A 1CBUA 4CGYA 4X91A 4ZZIA 2IHKA 3RYFA 3KZVA 3H4TA 3K9NA 4GE3A 2FNAA 3G5UA 4DA4A 5EZ6B 2PGDA 3RNOA 2YZKA 4UNSA 5J2UF 4MKRA 3GN2A 3IURA 4DANA 4D4JA 1JF8A 2VS1A 4XIJA 5IK2A 1CUFA 1VIAA 2AYZA 3PUWA 5CLIA 5C5CA 5LLSA 2BI8A 3EZ2A 3BXXA 4RH3A 2ATCA 5ILGA 2VPXA 2DBRA 2AJBA 1CQIA 3U7IA 3ZXUB 2XD4A 3L07A 4QATA 3N7AA 1R4AA 1UZNA 3L6OO 5HMLA 2A2ZA 5JS2A 3VR4H 3O8CA 3C6XA 3TS1A 3S5JA 1K8XB 1ZVKA 2XKJE 3U3XA 3L4EA 2Q9BA 1MHPA 2PRJA 2AXNA 2ZI3A 3WZLA 4EBBA 2HQBA 3CGWA 3CNQS 3IIMA 2Z83A 4URYR 2DBZA 5FBZA 1QTNA 1IN5A 1DFGA 4P32A 1MX3A 2H2WA 2XVXA 1HBJA 1SMKA 3LT2A 4EHFA 2CL6X 4FVTA 1JHVA 2Y4OA 5EE5B 3MINA 4MJ3A 3TTVA 5KWEA 4HHEA 1M2EA 4QHTA 1A8PA 3K1AA 3MTJA 1ZOSA 3KTDA 3P32A 1X1QA 4K9QA 3QFHA 5ALOA 2VRWA 2D1YA 3Q9LA 3R7LA 1UM9A 2AI3A 3BFKA 2VQFB 4YR7A 1ZP6A 2AFHB 4W1PA 4AZVA 1I32A 3ZNOA 2WYIA 4C4ZA 4GPBA 1J00A 3DZHA 2GT1A 3LIPA 5KCZA 3PNKA 1MIOA 1WMBA 3GUZA 3H86A 4G0MA 1T5SA 4NE7A 1USIA 1Z47A 1ZH2A 3CUSA 1MQ8B 2A0UA 4DG9A 3KKZA 2W2QA 1ZU5A 3W90A 4GKKB 1OIVA 3ENQA 1LK0A 3PVSA 2XCQA 3O38A 5CT6A 1PDVA 5KTTA 2HM7A 5F52A 3ZHYA 5F9MA 1LPBB 1Z8FA 3AESB 5E2IA 4MUXA 1XZMA 4OXRA 1ABBA 1W0KA 2K7ZA 4FDTA 3P2MA 3RH0A 1F0YA 2PR7A 4FFDA 1E3LA 2J3DA 1H4SA 4O4IB 4IXMA 1Q57A 1EWYA 2W6CX 1KE1A 2YMMA 1OWLA 2ZIWB 4EA8A 3THXB 1HNXB 2VAVA 3OIWA 1V1MB 4HNAB 1UKAA 1TM5E 3CLVA 2MHCA 4UE3S 2CFTA 3QNMA 4XYBA 1AKMA 3HUFA 2NIPA 4UCFA 3H97A 5CMLA 4ETMA 1R0SA 3T7KA 3TIGA 2WY2D 4EUEA 3BMQB 1B8PA 1S8AA 4YRJA 4EHHA 4BZZA 4DDTA 1PK9A 1RWMA 1Z4IA 4Q9IA 1LVHA 1XF1A 2AC4A 3H0CA 2YDXA 5I7AA 4YRDA 2H59A 2HMAA 1QGED 1ZOPA 2BAGA 2SKEA 5CLQA 3RT9A 4PW0A 4PGHA 2OMKA 2I99A 3AF2A 3C3MA 1KXJA 1UDWA 4GVLA 3IP1A 5HDBB 3KLOA 1C8LA 1DIRA 1Z2CA 2DULA 4QGGA 1QRTA 2P9JA 5BW4A 4AO8A 3RIYA 3T3HA 2C3OA 4FYYA 1JSZA 3UENA 2J5XA 3X43A 2I55A 1RZRD 2ZJFA 2QLJA 4K88A 1YI8A 1DAPA 4HGNA 4CLRB 5MHTA 1M8JA 2XD9A 1AC5A 1ONSA 2TS1A 4X1YB 1OCEA 1GAQA 1ZMRA 1X0XA 4IINA 4DJ5X 4J0GA 3L6DA 4HWRA 2D2FA 1UUFA 4WWHA 5DXJA 1SB9A 4MQLA 3ROQA 1GPWB 1PG2A 3I01A 4MRNA 4NZPA 3ORRA 3GFOA 2NAPA 4BYMA 1WXGA 3ESCA 5AVTA 3VR5H 3LUKA 3VPBA 1JAHA 3PIIA 2HCBA 5IV0A 1MRZA 4B4KA 3WY9A 1FLNA 2G8LA 1C4KA 5GMOA 5AI8A 1QR2A 4B4OA 5DULA 2NU9B 3HQ4O 5BQOA 2NO0A 5KKAA 5JC8A 1M6WA 1X7YA 4IMIB 3BPSA 4M8LA 1XLWA 4Y2GA 5IAAA 4Q7EA 3I61A 1CVLA 1RAAA 1AMUA 3KUDA 3QBTA 3O75A 1G20A 3G0DA 2JIZD 4PNEA 1VE1A 1KKUA 2FOLA 2WA2A 3MUNA 1RKXA 3HUTA 4G5FA 1SY7A 5DLYA 1PBTA 1WZCA 5CB4B 5K2MA 3L7JA 1L8QA 4ZAWA 2D7DA 3GGJA 1QV6A 4O4HB 3OOSA 1RXVA 5C1PA 3N86A 4WD3A 2P9YA 3FMIA 4G9GA 1RI1A 3L7MA 3WOHA 1ZEMA 5EE1A 1W59A 4JQOA 1R12A 4AQ7A 3QVWA 4FYWA 1E9EA 1ZONA 3C16C 3ZWMA 5H9WA 1YR8A 1IN8A 4C01A 4JASB 2FZCA 1EUDB 2VOJA 3GGPA 1V41E 1UMDA 1CB7A 4NU5A 2GSWA 1P9RA 4G4SP 5CUQA 4XLZA 4AZTA 1PL8A 2VNIA 4QJ5A 3AW9A 2AR9A 1C80A 4DM7A 3B20A 3SIWA 3R6TA 4PHGA 1Y89A 3DMPA 3IOEA 4QDZA 1X1SA 3E5NA 5EZYB 3CW9A 1FTYA 2FPKA 1WCYA 3C3JA 3N2KB 1C8BA 1T36A 3R3YA 4L8VA 5JNSA 5AMXA 3ND7A 2C97A 4K87A 4V0KA 5C37A 3U3RA 2XE6A 3EULA 3K2BA 2GNAA 4QX6A 4EHAA 4DV1B 4KR2A 3OT5A 1FLDA 1X1DA 3EZXA 5EUCA 2JL1A 3WQRA 4B46A 6GPBA 1F38A 2XA1A 4W9MC 3HY3A 1LJUA 1X1AA 2OKCA 2Q4BA 1LV8A 2CMFA 4TMXA 4CL2A 4UHCA 3VPDA 2D6FA 1DT3A 1PVVA 3KDAA 2DQKA 4JU9A 2QYOA 1GVNB 3D8TA 3PGVA 2YJ4A 5CD1A 3VVBA 3CURA 1C9EA 3I58A 2QM8A 4LY6A 1QE5A 2QSYA 4MUGA 4RS3A 3PWSA 3CWQA 4CKBA 4I5EA 1UBNA 4G0QA 1Z4QA 3LQ2A 4FHDA 3B7WA 1GPMA 4MUFA 3T5PA 3K71B 3VJRA 4BNUA 1PUXA 2A9RA 2FPPB 2XAAA 2W7TA 1OC2A 5SY9A 1OI7A 3K53A 3KZNA 4J8PA 2FF5A 3QMVA 1S2NA 2N1BA 1QHXA 3N5KA 4CMHA 1HUQA 1SPXA 1IN1A 2HIAA 2WFLA 5F33A 5EINA 2O8BB 1YJXA 4TXJA 2X0FA 4EVQA 1OHHD 3FDZB 1UPCA 3O92A 4FQ7A 1LCIA 5EUQB 2WSBA 3VXKA 2R6AA 4GIBA 3SBOA 4QTYA 2ZP1A 1JLSA 2AQKA 4ZO9A 2XOKA 2QMUA 1YR3A 1DKMA 1KEUA 4FGJA 4JROA 5CBPA 2HLNA 4HKTA 3UK0A 3SY8A 3L0DA 2Q62A 2VH2A 3SXUA 1L1FA 3TOCA 4HWOA 4WN9B 4NS4A 1SKQA 1JU9A 3NVDA 2NP6A 2H63A 1LK5A 3AF4A 1XP8A 3EQ9A 3GA7A 1IN4A 1DBRA 3DR3A 3I9KA 3L82B 1CY7A 4MKZA 1QQ7A 4RD1A 4Z54A 4H6VA 2JGFA 3ZQ4A 5G1OA 3C97A 2QL9A 2N47A 3N8GA 3H2ZA 4Z2AA 1O1YA 3H6HA 3V55A 4Z7NB 3H2IA 4PSDA 2IH2A 3LMKA 1DBIA 5KYKA 3D6VA 3GJXC 2C5AA 2OE2A 3ZCPA 4F72A 1C9JA 1J8VA 1HLGA 4G4JA 4WCDA 4YLEA 4A91A 1J5EB 1YTUA 1SUDA 2WFMA 2I3BA 3FUUA 2CLDX 3U40A 2R1VB 4RF5A 5T6MA 1MVLA 2XWJI 3UICA 2YASA 3LUPA 2J85A 1X6VA 1NBMD 4IHJB 4R1UA 4BVGA 2CDCA 5CA1A 4HD8A 2CZCA 4Z9YA 2WMDA 3KD3A 3UJ3X 1H3EA 2OC4A 1KXZA 2F8MA 1LPSA 3EA0A 3DBHB 1LFDB 4P98A 4TLCA 3VMMA 3GZNA 1FIUA 1H2FA 1NNI1 1XALA 2IQ5A 2ONYA 4OGFA 3VTFA 4ASUA 2HHCA 4HLUC 3QPAA 1USVA 3PFKA 4J90A 3IULA 3IB3A 1TFUA 2VQEB 1TD9A 2JI8A 2FUEA 3AI3A 2XTJA 5AIJA 4N7MA 2CY0A 3HCAA 1U8UA 2GCOA 4B4WA 1NQWA 4H7DA 3TG2A 1IEXA 1HFWA 1WCIB 5K0JA 2VZ9A 3WLNA 1P4HA 2Z5LA 4G84A 3O8OB 3A1CA 4X20A 4XQ9A 5E2AA 4BN5A 1U7HA 5JJCA 4X5OA 4G63A 1B6RA 2Q5IA 4NP6A 4P84A 4BO8A 1J56A 3FR7A 4H6XA 1LWOA 2RGEA 4DIEA 5IM4A 3ZDRA 1YVUA 2OPBA 1EWRA 3EFHA 3GUUA 2I4IA 2J0UA 8ATCA 3GLGB 1CUJA 3D5TA 5AI5A 1RFGE 3THWB 2AN4A 4M76B 1SG0A 1ZI9A 2FKAA 5GGYA 3RUAA 3AF1A 1VLJA 2ES4A 2CJPA 1KSGA 3RFTA 2YRWA 3UB4A 4JDPA 1WS6A 1YQEA 2Z5VA 3OPYI 2JFWA 1CF2O 2FTKE 2ZAYA 4P8RA 4TKUB 3TLEA 1MT0A 5E7QA 4HFNA 1K6IA 1OX5A 3KQSA 3NWPA 5HRUA 4R1PA 2ZSAA 3UATA 4DGSA 3K31A 3KLMX 3HYRA 3NDIA 1Q1AA 2R1TB 3TLGA 4RK4A 4J3JA 4YRZA 4YRCA 1YBFA 2Q3DA 4CG3A 4WBNF 1BDHA 3AVVA 1JDUA 2QMHA 2HNKA 1T5IA 4WZBE 1E5QA 2Z2YA 2XMPA 3OLYA 1LW6E 2AF3C 4NK5A 1XBTA 4FXOA 5BVGB 1O94C 1ZGCA 1DOHA 2R7LA 1T0UA 3I1JA 4L4RA 3OQPA 2ZUUA 3ZWYA 4PCAA 5BSHA 2B4AA 1Y4AE 3LCJA 3H1EA 4AQDA 2H7CA 5BY2A 4YDQA 1ZXBA 1S8OA 3CYFA 3F6SA 1EFLA 5AHOA 2GA8A 3UQYS 4CDNA 1CR1A 3CRRA 3DLPX 3ESDA 3H2YA 2YWDA 4JEHA 4NARA 2PTHA 5U9CA 5GZ6A 5GJBA 1QC5A 5LYJA 9ABPA 3WFJA 4MY0A 4KQEA 1JIXA 1A9XB 1XEFA 2ZRJA 4B3XA 3GEIA 2YFYA 2Q3MA 5DEIA 1JQLB 3P26A 2Q6IA 4JBGA 5D5HA 3H4MA 4DJEC 4B8WA 2HBZA 4IIGA 4LC1A 3PQ2A 1WDLA 4M21A 2C98A 2D06A 1I51A 4KAXA 3WRXA 2NZWA 3H1BA 3GL9A 4JVNA 1UR5A 4JI3B 3VRHA 1P7ZA 2D1FA 2PKQP 1WW8A 4YJFB 4G8DA 4PPFA 4R2XA 1EFKA 1JSCA 3K16A 5DGHA 3WXMA 4FHZA 2IW1A 3A27A 5D87A 5FOWA 4B76A 4TN1A 5F9FA 1BVRA 4X85A 2ISSD 2H3HA 3NTUA 3H0EA 1X7WB 2PH1A 2NYUA 4K9LA 1RKBA 4ZTBA 4HUQB 3F1LA 4U00A 1C1HA 1N32B 2ZJ6A 3H16A 3IE0A 3I05A 1AUOA 4Y3UA 4HAUA 1X38A 4N7JA 2JAWA 2OOKA 2OHVA 3O91A 4XGRA 1E3TA 4UXHA 2YXEA 1UC4B 2IXFA 1TO6A 4KQ1A 4NFYA 1P4JA 2JPDA 5AOVA 4K9KA 1Z07A 3CTPA 4LWQA 1V71A 1EZZA 1O54A 3FKQA 1DC7A 2WZDA 4KVGA 4LVCA 4Q5IA 4KJXA 4EG1A 4EL5A 2O8EA 4S1NA 1ESMA 4R4JA 2X40A 3QA3E 2BR5A 4CETA 3ER9A 3U7GA 6PFKA 2W6QA 5ALEA 2P90A 2H5IA 4DLVA 3PRJA 1KDYA 2PT6A 5MDHA 4LY9A 2EWMA 3NUZA 3KYDB 4PZCA 4AZSA 3U60B 2IPLA 3VDNB 4PFJA 4ETWA 1N4AA 5BSGA 4MW5A 4HDOB 4R0VA 5JDCC 4RJTA 3OIFA 4NV3A 1I0LA 1FDRA 4P34A 1A9TA 2RK6A 2XNCA 1CDDA 4BAUA 4C4PA 1ZK2A 1OIXA 2C92A 3AFMA 3RYCB 1B4DA 1PGNA 1NI4A 1OLUA 3N6VA 4KFSA 1Y3FE 3HJNA 3LDAA 5EL0A 1INLA 2DWQA 2BFNA 1R64A 3QE2A 1TJYA 1UXOA 2X9QA 2C2XA 4POOA 2D5LA 3K4PA 1Y5RA 4DSOA 1EP2B 2ZSEA 3DZDA 4EW3A 4D82A 2YVUA 3C98A 4KYVA 1ZY2A 3ZE7A 1GL3A 1OW3B 1EFUA 1FP4A 4M1OA 3FF4A 4N5IX 3N7ZA 1ZD9A 2C2GA 4WOPA 2PUDA 1DT5A 1N7JA 3A05A 3AR6A 3KZ1E 5GTDA 4BEBA 3TDNA 4TLBA 5EP4A 2FEAA 1BQ3A 3W5HA 4ENWA 3WI7A 4Y6QA 1L4HA 5THKA 2PUAA 2XCUA 1AQNA 2BZGA 4D0LB 1VJTA 2E37A 3ND6A 3H42B 5GAJA 4C05A 3JQAD 1YBHA 4BNLA 1FPMA 3SC4A 3WWCA 4AJ2A 1RRCA 4NICA 3SZOA 3OMWA 4WECA 3SLRA 3TGWA 5AIBA 3ANXA 4AF7A 2OD9A 3HKEB 4JSTA 1YCHA 4OQMA 5EJGA 3ZDXB 4RTQA 3B3QA 2FMKA 5ALRA 3JQBC