3SSMA

Myce methyltransferase from the mycinamycin biosynthetic pathway in complex with mg and sah, crystal form 1
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
390
structure length
387
Chain Sequence
EFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVLVELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGVRGTKLFPYLTDAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLHWFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSHVDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLYVIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGLHVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
pubmed doi rcsb
source organism Micromonospora griseorubida
molecule tags Transferase
molecule keywords Methyltransferase
total genus 126
structure length 387
sequence length 390
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.238: Mycinamicin VI 2''-O-methyltransferase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17843 MycE_N MycE methyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.30 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A Nonspecific Lipid-transfer Protein; Chain A 3ssmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ssmA02
4OBWA 4P7KA 1L1EA 2IIPA 5EIFA 4CTKA 5GINE 1JQDA 3LSTA 4U7TB 2LD4A 1INLA 5HIIA 2BR5A 4GOOD 2ZTHA 3BWMA 3WSTA 2JH9A 3BGDA 4PYKA 5FWDA 2EX4A 3M6UA 3EMDA 5LQKA 3M4XA 2IBSA 1AV6A 1KYZA 3FUTA 4FS8A 4HH4A 4R8RA 3FRIA 3G88A 2N47A 5EHGA 4FSXA 4JXJA 4YUVA 5GIOE 2JJQA 3MAGA 3FUWA 5LQJA 2F8LA 4YMHA 3GGDA 3A25A 2UYOA 3X0DA 2PKWA 4PGHA 3LDFA 1R00A 3G89A 4GOLD 1KIAA 4X61A 5EIWA 2AOTB 2ZLBA 2ZSUA 4R6XA 5HILA 3CKKA 3DP7A 5EG5A 1BKYA 2ZULA 1EG2A 3OU7A 4V0RA 5FHRA 1KYWA 5GWXA 5H02A 1DL5A 5F2NA 5K0LA 1D2CA 2VZ9A 5E1BA 3HVKA 3KQWA 1KPIA 2O57A 2JHPA 5E2AA 2GAFA 1SG9A 5MHTA 2PX8A 4CWAA 3AY0A 2HTEA 2WA1A 2UYQA 5T67A 2QM3A 5T6BA 1R8XA 10MHA 2DPMA 4P58A 1MHTA 2PBFA 1NBHA 1D2GA 4PYOA 5G02A 2B78A 4C03A 3THRA 1KXZA 2ONZA 5EVJA 1BOOA 3GRZA 4M7RA 5CM2Z 3SR4A 1ZGJA 2V7EA 4BLWA 2ZZMA 1JR4A 1P1CA 1BC5A 3FPEA 2ZIGA 3HM2A 4YV2A 2P1DA 2GB4A 1KHHA 2XVAA 3BWYA 3FZGA 3P9KA 5JUWA 5ICCA 2G72A 2YXLA 1Q0TA 4M38A 2FRXA 2P41A 5EPEA 3NW9A 4PGGA 3PX2A 3IYLW 4RX1A 5EOVA 3G5LA 3HVIA 3LDUA 3U81A 4RSRA 3HA7A 4GF5A 4BLVA 1VIDA 4V0QA 2G8NA 3CJTA 1KP9A 2PY6A 5IKMA 1XDUA 3OZSA 2PLWA 3E7PA 1Z3CA 3TKYA 4ER7A 2ZBRA 2HR1A 3IHTA 4LWPA 5KVAA 2KW5A 3KU1A 5DX1A 2ZWVA 3G2MA 4MIKA 5E1MA 3PFHA 3RODA 4HC4A 4M36A 4IKPA 4XUEA 4E2WA 5K0EA 2QRVA 4DQ0A 3OE4A 3I58A 2B9EA 5DRTA 1JG1A 2JHCA 2P3QA 3BUSA 2QE6A 3DMHA 2NXCA 2IBTA 4PNEA 5ERGB 2ADMA 3KQTA 1SKMA 3O4FA 1UIRA 1SVUA 3G7UA 4QQKA 4EVIA 3R6TA 4R05A 3Q87B 4PYNA 4E32A 1IM8A 2GS9A 1O9GA 3LCVB 3KPWA 1JG2A 7MHTA 2HV9A 3DXYA 2PJDA 2IPXA 3I53A 2AOXA 1U2ZA 4QPPA 1YF3A 3R3HA 5ICFA 2EJUA 1RI2A 3DMGA 3PT9A 2ZZNA 3TMAA 3HP7A 2C7OA 1YFJA 4C08A 4A6EA 3TFWA 5HFJA 4ER0A 2BR4A 2P3LA 3FTDA 4FT2A 3TPZA 4QDJA 3SSOA 2GA9A 2PGXA 2YR0A 1B42A 3DMFA 4RTMA 3CBGA 2ZBQA 3DTNA 3E23A 3EVCA 3PS9A 4FR0A 2ONYA 4GOMD 3PLAE 2I7CA 3KPYA 1NE2A 4RYLA 4EQZA 1NW7A 4FGZA 2V74B 4AZSA 4BP1A 1TW2A 2G71A 3AXSA 5GM2A 3M33A 5LSAA 2OB2A 4HTFA 3D2LA 3HCCA 1RJGA 3QOWA 1FP2A 1RI3A 3M6WA 3OU6A 3DLIA 5KQRA 3LHDA 5EHIA 3I5UA 4YV1A 3B5IA 1D2HA 5CVEA 1NW6A 5K09A 3GO4A 5CVDA 4ER5A 3KQVA 2XVMA 5E1DA 3GRYA 4YV0A 1KPGA 3KR2A 4KWCA 5EZQA 2B25A 4ER3A 1ZKDA 2R6ZA 3G2PA 3OU2A 2A14A 3TR6A 2PSSA 4BP3A 2YUIA 2FK8A 2C7RA 4RTOA 1L9KA 3Q7EA 3NMUF 2PT9A 3B3JA 4DA4A 5DX0A 4C06A 1XVAA 3TLJA 5DTRA 2DULA 1M6EX 1P1BA 1L3CA 2JHAA 3BWCA 3LX6A 3FPGA 4AZWA 4X1OA 2BZGA 3NDIA 4POOA 5FTWA 2O05A 1QANA 2CWWA 3TM5A 2AOTA 2NXEA 2PXAA 3C6KA 3UA3A 3LKZA 4K6MA 3FPFA 5EKUA 5F2KA 3KQQA 4GUAA 4IV8A 3KQYA 4HRAA 2YX1A 3UJDA 2H1RA 3KR1A 4RTSA 5LQUA 4O29A 3H2BA 4HGYA 3FTEA 2AR0A 5DSTA 4EMSA 1WXXA 1Q0SA 4Y2HA 3QV2A 2G1PA 1N7JA 3AWIA 2PXXA 1QYRA 1ORIA 4AX8A 3V8VA 3MGGA 4QVGA 5K0BA 2P8JA 4KVZA 2P7HA 1G8SA 1F38A 5P8WA 4PONA 3GWZA 3LCUA 2NP6A 1WXWA 3ELUA 3UJ8A 5EEHA 1QAQA 2C7PA 3LECA 3MB5A 4QQNA 5BP7A 2AN4A 2UZ4A 1IXKA 2AOUB 3MTEA 2HMYB 4F85A 1YB2A 1FBNA 2O0LA 4PCLA 3MCZA 1ZQ9A 1HMYA 4YMGA 2K4MA 3V97A 1QAMA 2ZZKA 3BGIA 3P71T 3P9NA 1RJEA 3LPMA 5D1NA 1R18A 5EMMA 3C3YA 3UJAA 1AQJA 3THSA 1FPQA 1ORHA 5BW4A 4Y30A 1RJFA 4P7JA 3NWBA 1I1NA 5K05A 2C7QA 3SX0A 4WXHA 2EG5A 3A7DA 3CCFA 3FPHA 5GP1A 5LQNA 3BWBA 4H0NA 3NJRA 2WK1A 2PXCA 5DXJA 4FZVA 4YUYA 1YUBA 3A27A 3KHKA 3OPNA 3M70A 1X1CA 5EMKA 2VS1A 4KDRA 1XJ5A 2CKDA 3EPPA 3SVZA 1VQ1A 2HWKA 3MTIA 3T0IA 3UJCA 4HGZA 4YUXA 3KQOA 1BHJA 1XDZA 1H1DA 3FRHA 1NW3A 4FT4A 2BM8A 3P97A 3EVEA 5HEKA 2OBFA 1X19A 3CJRA 1G8AA 2HNKA 1VLMA 2VDWA 3CGGA 2G70A 3VC2A 3HVJA 3OFJA 5FCDA 3CJQA 3P8ZA 1G60A 2OZVA 2YXEA 3JWIA 2AOWA 4IWNA 3FPJA 4RTKA 4OQDA 4PYLA 3LCCA 4OX9Y 1PRYA 4MQ4A 3A26A 4QPNA 2XYRA 5LQAA 2PT6A 5DSXA 4PINA 1V39A 5EEGA 3JWGA 3ME5A 1OR8A 2E5WA 4OQEA 2ZFUA 4YUWA 1P91A 2I6GA 4PYMA 4FP9A 4DZRA 3KPJA 4RTLA 4BLUA 3NWEA 5DLYA 3ER9A 1EJ6A 2ZIFA 3MERA 3UBTA 3DUWA 1R6AA 2NYUA 4PCAA 2YTZA 3GCZA 4X63A 3ID6C 1IY9A 1SUSA 1ZG3A 2PVCA 3GIWA 1NT2A 3UJ7A 4EKIA 2PWYA 5DX8A 3P2EA 3R9XB 2JH8A 2OY0A 2ZBPA 3JWJA 5CCBA 5D1HA 1JQEA 4WVLA 2P35A 5F2OA 3IV6A 2AZTA 2OB1A 4CKBA 4AZVA 5K03A 5GIPE 5FHQA 1KR5A 3R0QA 3LGAA 3HCBA 2H00A 5E1OA 2NXNA 1ZHFA 3QOXA 1X1DA 3KQMA 1YFLA 4XUCA 2PX2A 2AOUA 4ISCA 2JG3A 3FUVA 3P9CA 5DTQA 3KQPA 3UJBA 3MCTA 4L7VA 4C07A 2QY6A 3GU3A 5EZSA 5KYGA 1F3LA 4PIMA 2P7IA 2Y1XA 1WS6A 2BM9A 2YVLA 3HA3A 4PYQA 3KQSA 3TM4A 1VE3A 3FUXA 3UJ9A 3EGIA 4HTFB 1YZHA 2ZVJA 2AVDA 1N2XA 1NBIA 5LR6A 2P40A 2ERCA 2O07A 5FWAA 5CCXA 1ZGAA 4RTNA 3FTCA 5FQOA 1XCJA 5EKXA 5HOQA 2BH2A 3G2OA 3DXZA 4OA8A 4XCXA 3I9FA 1O54A 3REOA 2AN3A 3T7RA 4LECA 1NW8A 2AN5A 2GPYA 4IV0A 4HSGA 5C9ZA 1SQGA 4GC5A 3CC8A 1AQIA 4E2YA 2WA2A 3ANXA 3FYCA 3NTVA 2ZW9A 3G2QA 3P9IA 3UWPA 3ERCA 3KPUA 2O06A 3EGVA 3HVHA 1RI4A 5FA5A 1FP1D 1XTPA 3GDHA 3A4TA 4FSDA 4RTQA 2NXJA 1X1BA 2CMGA 5DM0A 2FK7A 5EMLA 2H11A 1VBFA 3FYDA 3HEMA 2IP2A 1UWVA 5DT2A 1T43A 5EC8A 5CVUA 3SGLA 1DUSA 1XDSA 4MTLA 3UA4A 3EVAA 1PJZA 2B2CA 2GLUA 2P3OA 3GJYA 4RWZA 2OYRA 5CUQA 1RI5A 1Y8CA 5DM4A 1I4WA 3A7EA 3ORHA 5C0OE 4XUDA 3CVOA 5K8VA 4M37A 2Z6QA 1P39A 3RIEA 5HIJA 3LDGA 3ELDA 4RVHA 2IH2A 1WY7A 1UFKA 3EEOA 4KIGA 1FJXA 4QDKA 3LKDA 2OO3A 3HA5A 2QYOA 3T7TA 1JSXA 1VP9A 2FYTA 2NNWB 4G56A 4AZTA 2IGTA 3JWHA 4X60A 3OZRA 3SSMA 3OZTA 5EGSA 1KPHA 2PX5A 3EVZA 3RW9A 3SMQA 4EK9A 2QRVB 4DCMA 2PV0A 3TQSA 4KIFA 4DMGA 5HZMA 3DH0A 1X1AA 4R8SA 4E2XA 2IDKA 5EQJB 3SM3A 5CVVA 5LQCA 3EVGA 3BZBA 4RTJA 3NVMB 3HCAA 1QAOA 4C04A 2OPBA 3DXXA 5DXAA 3G8BA 3UFBA 5JR3A 2OKCA 2EJTA 5E9QA 3HCFA 3G8AA 4RVDA 3K6RA 2IDJA 5E9JA 3VSEA 4AUKA 4F86A 3FTFA 3UJ6A 1DCTA 4X41A 1NW5A 4E30A 4PIPA 3BT7A 3S68A 5DWQA 4DKJA 3B89A 3C0KA 3DLCA 4MWZA 2VDVE 3EMBA 3AXTA 3LBYA 5E8RA 4E2ZA 4R6WA 3OFKA 2OXTA 4DF3A 5K0NA 3UZUA 3R24A 2XYQA 3T7SA 3SXJA 3NVKI 4P7FA 4GOND 5K0JA 1EJ0A 3EEYA 2ZCJA 1JTFA 3FUUA 1XXLA 5CD1A 1R74A 1O9HA 3NDJA 4E31A 3F4KA 1G38A 2ORED 5GM1A 4CKEA 4HG2A 5FULA 3PFGA 3E8SA 5DM1A 2FPOA 1WZNA 4RVFA 4PYIA 1XCLA 3GRUA 1TW3A 2ESRA 4Z2YA 3TKAA 1NV8A 3GRRA 1EQAA 3HNRA 4DM3A 2BR3A 2YQZA 3B3GA 3L8DA 4KW7A 4LG1A 5FA8A 1QZZA 5GOZA 4ER6A 2IH4A 3BKXA 2PX4A 5BXYA 4F84A 1MJFA 1JQ3A 1N7IA 2AS0A 1RJDA 2FCAA 3PVCA 4P7GA 2AOVA 4ATNA 4OA5A 4UOEA 5KS2A 2YXDA 1VPTA 4YUZA 4RTPA 1G6Q1 3SSNA 2B3TA 2Q41A 1L3BA 4LWOA 3LL7A 5FADA 4E70A 5CVJA 4PYJA 3VYWA 1HNNA 4GQBA 3BXOA 4RTRA 3TOSA 3KR9A 2GH1A 3B3FA 8MHTA 2Z6UA 3DR5A 5DM2A 5DRYA 1SUIA 5HIMA 3GNLA 2ZWAA 1JSZA 5DPMA 5DTMA 3EVFA 4MHTA 3ELYA 1EAMA 3LBFA 1L3IA 3HCEA 5ICEA 5EMJA 3I64A 2I9KA 3C6MA 3C3PA 1VL5A 3G5TA 5FUBA 5FQNA 2UYCA 2XBMA 3M6VA 1AF7A 4U7PB 1VP3A 5E8JA 1JG3A 3EGEA 1JTEA 1JG4A 2ZIEA 2R3SA 1RI1A 3HCDA 4CTJA 5LQRA 5IH3A 1M0EA 3B7PA 3OE5A 3BGVA 3P2IA 4QTTB 5KQSA 3MHTA 2PWPA 1EIZA 3KR0A 4KRGA 2CL5A 4KDCA 3PTAA 4GC9A 5K0GA 5K0CA 1SQFA 3GRVA 4DCGA 5E9WA 4C05A 2Y1WA 5E2BA 5U4XA 3EVDA 4NECA 5CIYA 4BY9E 3HTXA 4QVKA 5B1SA 4C4AA 3BKWA 3OCJA 1M6YA 3M6XA 1R8YA 1NV9A 2I62A 4GEKA 2UYHA 1WG8A 2IFTA 4QTUB 3ELWA 4ZTBA 1I9GA 3P2KA 3TRKA 2CMHA 3EVBA 4A6DA 3AJDA 3PX3A 5BW5A 2AVNA 5C1IA 4RVGA 4B17A 3DULA 5HIKA 3KPVA 9MHTA 1NKVA 2IH5A 4GBED 4E33A 3E05A 3IEIA 4OBXA 2FHPA 4EKGA 2XYVA 2EFJA 3VC1A 4CXMA 3PB3A 1G55A 1TPYA 1YZ3A 5T64A 2NP7A 4PWYA 4RV9A 2Z6AA 3KKZA 3K0BA 5K0FA 3DOUA 3O31A 3ER8A 3GXOA 3O7WA 5M5BA 5K01A 2VDUE 2VP3A 5ICGA 4CKCA 3MQ2A
chains in the Genus database with same CATH superfamily
2WYWA 5GINE 2FLWA 5JAOA 1MVOA 2AG0A 3ETCA 2WUWE 4XGKA 3S55A 1BVUA 4ACAA 2WWXA 1UZAA 3GNTA 3R7SA 3PIRA 4HD8A 3M6UA 4MW6A 4DC9A 2N75A 3ND7A 3DXFA 3MRTA 1KYZA 3OWXA 5DYIA 4NCHA 5K3CA 1S01A 2AMLA 2PZKA 1AMUA 1WLSA 3G88A 3HJGA 4TLDA 3DOIA 1WSDA 3PDIB 1YL6A 2CYBA 1JAYA 2PKQP 1M34E 1GHTA 3FE2A 3HFJA 4MQMA 4HQFA 3GHYA 1DLIA 1X14A 1H8HA 2IWHA 4NBUA 5KVSA 1D0VA 5AFSA 3A25A 2I6UA 3I1YA 4NKRA 1NBAA 2FPPB 4YMSA 3W5IA 2UYOA 1G1AA 1OTYA 4JUAA 2OYCA 4FPXA 4B73A 1Y7LA 1KI4A 1EAYA 2ZRMA 4BV2A 1VCOA 5KYUB 1HURA 4BMOB 2D1YA 2ODBA 1GNTA 4H7HA 4Q7LA 4ETIA 3LQFA 3F8WA 3HYTA 4I9HA 1DL5A 2B3DA 3M4YA 4AKHA 4MRAA 3HCOA 3X1WA 1DJLA 2OUIA 1Z15A 3QKUA 1SJ9A 5DVZA 4TTVA 2EARA 3RM3A 2H1FA 4Z1MA 1NQUA 2JKYA 3KDAA 3MJ4A 3NIBA 3ZGVA 1E1QD 1PR5A 2HIGA 2WA1A 3K5WA 3PEFA 4TLCA 4BNJA 4Y6RA 2V3CC 1OIWA 4PE5B 4WPGA 4DA6A 2B78A 2MU1A 3CINA 3TLYA 1HK7A 2QQ5A 2VPZA 1FFEA 3PEEA 4FHGA 3IELA 1ZL0A 4TTPA 1W5SA 4W5TA 2ZZMA 3DJYA 3OF5A 3PWZA 1NVBA 2WQ7A 3C1UA 3K6SB 3X1DA 5JUWA 4C89A 4PGAA 2WNIA 3A8TA 1Y1TA 1UXIA 2J1LA 5K45A 2ZXEA 4FS3A 3OCYA 3D9QX 3HB4X 2E4YA 2QM7A 5IFLA 3Q8KA 3FG9A 4BQQA 1BE1A 1QGZA 2PT5A 2Y27A 3JARB 4H4CA 3A1WA 4B74A 5EP3A 2Z1DA 4DM7A 5FO1A 5FBRB 4ZA2A 2VJPA 4ER7A 8OHMA 2NZ8A 2WR8A 3L01A 2IRWA 4D9HA 3HDYA 1UK6A 3TLMA 2Q6KA 4IDPA 4AKIA 3TOZA 3IERA 3DFZA 3RODA 1UBGA 3C4QA 3EWNA 3DB1A 1YZQA 2XQVA 3IUYA 3AEYA 1AHHA 1WL8A 3K4PA 3PD7A 4B2LA 1JI0A 1T2DA 5COQA 2HQSA 5BSWA 3QKSB 2H3EA 4TKMA 4IDQA 1USWA 4EMTA 1E7MA 3K32A 2IQ5A 3CRZA 3JQGB 1DO8A 2YHSA 4FGLA 1HE1C 1C9YA 4U7HA 4AC9A 4G81A 4J91A 1WOMA 1JLMA 2R84A 3ABIA 4BNDA 4DZTA 3CLUC 3HU2A 1CB0A 2BP7B 2GA8A 3FMOB 3PL5A 4KUEA 4UULA 5EJ5A 4B4WA 1O9GA 3PQ4A 1TIPA 4QBIA 1W46A 4UD2A 2XA9A 3PGXA 2HCFA 3ZWKA 1KJWA 4DIOA 2AOXA 1HG1A 1YF3A 2A88A 2D59A 2EJUA 1W5AA 3FBWA 1UOPA 4QOJA 2GTPA 4MA5A 2YXBA 1LRLA 1P3DA 1ZA1A 3MRXA 3ZWMA 4K6OA 3W3AA 4RZIA 3V3KA 2GBLC 4ZOLF 3GH1A 2A9VA 1Z8DA 4UDXX 1JNYA 4D92A 3BRSA 3X2FA 5EJMA 3DMFA 4RTMA 2CNWD 1V26A 2BM1A 4ZYLA 1QHXA 2ZVPX 2IV7A 3DTNA 1VMIA 5D2CA 5F3DA 1JDNA 4NENB 1XTKA 5KYKA 3GC6A 4RSHA 2TMKA 3B38A 4W9NC 4EECA 4L16A 3LUJA 4I50F 4NULA 5AKLA 2B2NA 1TW2A 2FZGA 2P9TA 3RIMA 1LX6A 4YO7A 5IP5A 4UHJA 3GT3A 4EQ6A 3OC0A 4DWJA 3VFDA 2E18A 5KQRA 1IH8A 1PZEA 1X7YB 3O5AA 1M2KA 2JGRA 4B79A 4HYQA 4HRYA 3EVNA 2C1ZA 5BR1A 1M7BA 1SHUX 1ESDA 2RGNC 4O2LA 4HGQA 3RT1A 3FGZA 2FJ0A 2TYSB 4INJA 1ZGZA 3GPBA 3H8JA 3QXGA 4KODA 2G17A 3ZQKA 3Q2KA 2EQAA 3DL7A 2VUSA 4PRZA 4X3PA 4YH1A 2FK8A 1NUPA 3H4IA 3MIIA 3TGLA 1PUIA 4PBRA 2CLOB 2VTVA 5ILGA 3VPXA 2NO7A 4PLZA 1WCIB 4WMLA 4G8CA 4BWFB 3PNOA 1GWNA 4FUQA 4TWZA 5TQ2B 4B09A 1A8IA 4B6QA 4DGQA 3AH8A 1G6HA 1Q95A 1TNDA 3QPWA 4GUAA 4MLZA 4QRHA 4GKAA 4ID3A 1B14A 1FA9A 1BH6A 2H1RA 2Y77A 3ZLJA 3VM6A 2FWPA 3L1IA 5CH3A 3ECCA 2OPHA 3QMVA 3EJ6A 1IOWA 4LKOA 1GZ3A 3K6KA 4XKJA 1WULS 4ZO8A 1QYRA 1GGJA 2PL9A 2X4DA 5JMOA 5K0BA 4EFKA 4O2BA 2I7TA 3GWZA 1AK9A 2OXEA 3ELUA 1HKHA 2JI4A 3RS3A 1JSCA 1QAQA 5CHYA 4Z4IA 3PHHA 2X2EA 3L77A 3A1VA 4NV1A 4G3XA 1RYFA 2D2FA 3TSCA 4ZJZA 3JPWA 3JQ6A 3TZEA 3REFA 1FBNA 1UCFA 4B9AA 1Z16A 1MA3A 3GD5A 2K4MA 2KLHA 4JLVA 2JNWA 3V97A 4ALMA 1JBEA 1EFDN 2Z5VA 3UJAA 3C6YA 3T3DA 4OXKA 4WT7A 5G41A 4DLAA 1YR6A 3NWBA 1RQ7A 2C4WA 3G6KA 4ZD6A 4NHOA 1I94B 1YKFA 4FGSA 1P7PA 1FFYA 2XGMA 3IULA 3JD1A 4H17A 2UDPA 2UZ3A 3ANMA 1XVIA 1PJ8A 2P91A 4FXOA 3Q10A 4N0PA 4O0LA 1PL6A 3A27A 1Z4PX 2FWNA 4R9UC 3ROFA 2PGIA 5LCXA 4HZIA 1UMBB 3BCUA 2PWAA 4MUJA 5DHSA 3MGCA 1O6GA 5HF9A 1HSOA 4C21A 2I2AA 3N0WA 5TMEA 3ZI7A 2B94A 5IULC 5MFZA 4J7XA 3H5LA 5CXQA 5AJYA 2BUCA 5IT9A 1E98A 2PBZA 5AIAA 4J1SA 5EIXA 2J9RA 2X9GA 4P34A 2YW2A 3MAAC 1JDBC 3CJQA 1I6WA 3OY7A 2VUUA 3LQQA 1AD2A 4BCBA 5I9TA 1C3OB 3C7AA 2AOWA 3H0EA 4ECEA 3QPDA 3T1HB 1EDEA 2L0XA 3BILA 1TTTA 1MAAA 3A26A 3L6BA 2YY6A 2ZTVA 1H94A 2PS0A 2XCQA 5SYNA 1GPDG 2V65A 1FP7A 2JI6A 5CTJA 1ZO8A 2G6TA 3S2UA 3DLTA 4PINA 3U4GA 4JUDX 2QLTA 2QU8A 3Q5GA 5LWHA 2GYWA 4OIMA 3PNSA 1RYZA 5IBQA 1N1DA 1OYVA 4E5DA 1N8KA 5FR2A 1OFIA 1V3QE 3DT9A 3C45A 1T3TA 3JYQA 3QXJA 4MCJA 1DKUA 1LH0A 1M0TA 4JLSA 4XGNA 3CVJA 3INYA 2BP7A 1PCXA 2X2OA 5IVIA 4FNGA 4ZC8A 5JNUA 3EEQA 4MO2A 3U26A 3PQ3A 3OIFA 3IMFA 3SEZA 1H2RS 3KAQA 2C77A 4AY5A 3WIOA 4JYAB 2KBFA 2DHDA 5EXSA 4KFUA 5EQDA 1TA4A 3HJHA 4CNQA 5HGJA 2B8TA 2O2HA 5AW6A 5IJ0A 1UJBA 4ESOA 4I6JA 1RYHA 1SC9A 3ITKA 1FJGB 2QUZA 4XQGA 4IXNA 2OGWA 3FWYA 4C07A 4B4VA 4QASA 4W6QA 4M1SA 1I7NA 2FP4A 2W4QA 5KYYA 3ANNA 5DBHX 4YJ3F 1XRPA 2XXBA 1ZRMA 3O2JA 2BM9A 1N8TA 2ECKA 4J1QA 1G6OA 1O1YA 4UU7A 2J85A 3TM4A 2PGJA 1E0DA 1PEYA 3B5EA 2CXNA 1PAUA 4TL6A 2CLSA 2ZVJA 2AVDA 1WP4A 1YS6A 1G20E 5H5JA 3STVA 1ZUIA 4RGQA 3GMIA 2YCBA 3EXIA 3H2ZA 2AEEA 1QX4A 5AVQA 5LU9A 4OQXA 3PSHA 3UXYA 4FJ2A 1EZZA 3KSDO 4HEJA 4JBLA 2HK7A 2VHTA 1XZPA 2GPYA 3CG4A 3EAFA 1G2OA 1GZDA 3KG2A 4OQNA 4V0NA 4TQUS 3JY6A 2DCMA 4O59O 2Q9CA 1AB6A 3IIJA 4OQFA 5FWXA 4F5WA 1EVEA 5AK6A 3HRHA 1EGVB 2OHVA 3EY9A 2I54A 2J33A 1FP1D 1R5NA 3NT2A 4XWOA 4O4IA 3K9GA 2JF0A 1ADJA 4FDVA 3V1YA 1EP3B 2WG1A 1DKRA 1PEDA 3KLPX 2NTYC 3HRIA 4UXIA 4Y2YA 3H5RA 1BQ3A 3PI6A 1C7RA 2TS1A 3IOEA 5J59A 1H9CA 3HB7A 4CQMD 2KLBA 3GP8A 5DM4A 2GJ4A 2Z98A 3BMQB 1QCDA 2W8ZA 2Q49A 5I51A 1FYVA 2MDTA 3DHVA 5CLLA 2QRJA 3A6FA 3VR2A 5DK6A 2B20A 1MZVA 2X86A 1MOPA 3SX2A 3ZWAA 5IANA 3BSFA 2HA0A 3T5BA 1PK8A 1XT6A 4XJVA 2ZB3A 4KIGA 3NXKA 4IIHA 3HA5A 3DKRA 1Z0KA 2E6KA 4UEQA 4LF4B 1KJ9A 3W2TA 3WK4A 5LZ2A 3IRUA 3TAUA 1EFVA 3SZRA 3LMKA 2WAAA 4FOSA 3N0RA 5AVSA 4K0KB 2VHXA 5A04A 4R1UA 1UZUA 4P36A 5K6TA 2EZ9A 1KI8A 3JD3A 4YYEA 2QR3A 2XR1A 3PEYA 1F8FA 3R6LA 5LQCA 1HFKA 1Y3CE 2IITA 4GL4A 5TGTA 3A6PC 3L5OA 1GCGA 1S02A 3QUSA 2RGNA 1H2FA 4P33A 1UXHA 1TZMA 3SKYA 3VU0A 4LJLA 3BHIA 2OQIA 4H77A 3R41A 3TK1A 4M1ZA 4ILEA 5JD4A 3MT7A 1ESZA 4CFSA 4AYTA 3IESA 3RHZA 1UPUA 2CLHB 2CL0X 4PAOA 3COZA 3KFVA 5L3SB 1T1GA 3V2HA 1P9RA 1I5OA 3VGJA 3UFXB 3Q8MA 5A3VA 2Z9CA 1TO1E 1E7YA 2FZCA 1P1FA 3D6UA 2J4CA 1H2WA 3DKPA 3PUYA 4CLDA 3O91A 2A86A 2EG9A 3SQWA 5E8RA 3HFGA 5K8TA 1PYGA 1KVTA 3H11B 3H4TA 3G2HA 1WBDA 3UZUA 4XXHA 4YS6A 1NVWQ 1V5GA 3SHWA 1ODCA 1KARA 5AJHA 2CG2A 4NZPA 5JTTA 2ZCJA 3ZHQA 3ML1A 2IU4A 3I6QA 3IMGA 5MN4A 4UHDA 1H2HA 5KUTA 2IYRA 1TRKA 4DQDA 2JFNA 1PDWA 4NONA 4F3RA 2WFAA 4U7DA 1U4OA 2O1WA 5JZ9A 2FN9A 2DJ5A 4DNQA 3IT0A 1RAFA 1VKZA 2CL6X 2BR3A 2HJGA 2AT1A 4UMVA 5IT5A 2PRKA 5EUQB 5BSGA 1TT5A 3H3FA 4F84A 3WK8A 2AZMA 5IYZF 4DMRA 1XTRA 4E0BA 3R9IA 4N6OA 2Z43A 3H6GA 5FADA 3D8TA 4MI9A 1SVKA 4UXHA 1RRVA 4AKEA 2ONKA 3ZDAA 2WW8A 4RENA 2VPYA 3FPCA 3TOSA 1SURA 4ZZ0A 2G09A 4Q4JA 5DYNA 2P27A 5I3ZA 2D00A 2ECPA 2CZQA 5JSUA 1G8KA 4Q5IA 5FNVA 2XH8A 3F5MA 4QSHA 3TAXA 3PUWA 2ZCUA 4YRNA 1O89A 2R8XA 4B85A 1P61B 4IQGA 3I01M 3ACBA 1KO8A 3HKDA 1WHTA 2ZB4A 4RZSA 1VA4A 2W58A 4EEZA 1JHVA 1L7XA 2EEZA 2QZTA 2ZIEA 3HLKA 4G8DA 1K66A 3QJYA 1Q92A 2CNWA 4FI3F 4QJIA 4XJSA 4AT1A 3LUGA 4HBZA 4I9FA 4JOQA 5CM9C 4PG4A 1NVKA 4XEUA 4OP3A 1PNRA 3VUFA 4J1NA 2PWPA 2VTBA 4J1TC 3GRVA 3QE2A 4KQFA 3V80A 1OC4A 1XZ8A 1NAHA 2QN9A 1NUSA 1GT6A 2Q3HA 2YYYA 1QWSA 3DOFA 3R5FA 4O1IA 3WKAA 3DM9B 4TMVA 1X74A 3VPAA 2VWGA 4Y0AA 4D4HA 3SKXA 4EHBA 1KWKA 1BAPA 1QYVA 4JI8B 1WKVA 2BONA 2FPMA 4MI3A 4D9CA 3OJFA 1BEUB 3E1GA 5ALUA 3P2KA 1R4MB 4DJJA 2RHDA 2RDMA 4Y9UA 4A6DA 1DWOA 1I7DA 3AJDA 1KO4A 2OYSA 4F12A 2P9YA 2AZXA 2C97A 2GYVA 5JS7A 1AJEA 1XALA 1DDIA 1XZMA 1RFLA 2B5WA 4MJ3A 5TQ0A 3PB3A 1AKTA 5B4UA 1Z8FA 3OWOA 1U8UA 3JPYA 4F2GA 4DQXA 2I4TA 3ZC3A 3IQDB 4N9QA 1LS1A 5SYAA 4CQLB 4AP5A 4DPMA 2F9LA 3FMIA 2C2BA 1P5FA 1J8DA 3A1FA 3G8CA 2FR8A 1MGOA 1I1OA 3UMRA 5C5CA 2PFSA 4C9BA 5EIFA 1F7VA 1L1EA 1ZINA 1RYBA 1PYDA 2B83A 4OQPA 2VT2A 4DLYA 3VKGA 5CITA 1AK2A 4HJRA 4B84A 2F1HA 2HSDA 2PPLA 1I3LA 1IEQA 2R68A 2NUTB 1W35A 1VJGA 5C5DA 5JPDA 2P90A 3OZCA 4AF8A 3EMDA 1JHAA 3TBFA 1KEZA 1M8PA 2ZWMA 3OQBA 4YTEA 5ALQA 2VC2B 4BZQA 3FLMA 4BAGA 2BFCB 4J0QA 1F6BA 4JXJA 1DBSA 5KHAA 5C1PA 3K9CA 4HWPA 2VHUA 2Z9DA 2I4RA 1WU7A 5HG0A 4D0LB 5BQXA 2IC5A 1MB3A 1PW7A 4PQFA 4J0HA 5LBTA 3X0DA 2Q1YA 3KSUA 4Z51A 1E1QA 2DLCX 1R2QA 2BHSA 3LDFA 1GYQA 3RU3A 5AVZA 1OFUX 5K9ZA 1Y6FA 2OR3A 3QHAA 1E3SA 5BVHB 3A4IA 1E63A 1E7QA 5T41A 1XHEA 1BXKA 3D7SA 1P6UA 3AHEA 3B6EA 2VZ9A 4GH5A 4RDHA 2PMDA 3GGCA 1V37A 3CN9A 3LLVA 4C22A 1CY0A 1HOTA 2QNRA 1K7EB 1MAHA 1Q0QA 3AKCA 3E81A 4MO9A 4TN1A 4IF4A 5FTMA 4EHIA 3FI9A 1ADCA 3QPVA 4MRVA 4FFLA 3SR4A 1KSGA 1RMQA 3M5PA 1WSWA 3I1JA 4FFRA 5IBCA 3WSVA 3EIQA 2W0SA 3K0KA 2ZIGA 2H2GA 4JU9A 2GNPA 1XZQA 5EZYA 2G72A 1HQCA 4Y1EA 1IY8A 1CQJA 4KEAA 1GNVA 1XKTA 5IAEA 1QQAA 3DOHA 3BYZA 3NW9A 3PX2A 1KZHA 5JAZA 3AWDA 2IHZA 4IH4A 2V6FA 5ALHA 1T15A 1YUNA 2HA6A 1E2QA 1KP9A 2WU4A 4LAFA 3USZA 3V1KA 4L3OA 2CNLA 2FDRA 4Y1GA 5FL3A 1WPRA 4XYEA 3RFCA 1Z75A 2W4MA 3DNPA 2Q7OE 2P2NA 3PNVA 2QQ0A 3EPLA 1SA0A 2G77B 1EVLA 4G24A 3ZE2B 3HBLA 1DOHA 4PG5A 1NDQA 3ZE6A 1YACA 3QK7A 3CLUD 2WPNA 1ZI6A 1KP2A 1U31A 3PE4A 4IKPA 4N4AA 4LK3A 2XJ4A 1ECPA 4R68A 2X5JO 3QE4A 4OOEA 4AG6A 4U6QA 3NONA 5LDDC 2OG1A 2XWPA 3HCNA 4IX9A 1R4NB 5DRTA 2BL4A 4EL0A 2ST1A 2FZWA 3TE6A 4H3HB 2A30A 2CCKA 1S1MA 2G3YA 1XL1A 3O4IA 1SKAA 1SG6A 4H1WA 4NE7A 3V7UA 5HBGA 1PWHA 3ADKA 4CI9A 3GRAA 1S2LA 5FUYA 1JG2A 4OM7A 1E5DA 4RKRA 2QTRA 3JQBC 4Q3LA 2R8YA 4QPPA 5JJKA 4K28A 1CDZA 4DB4A 4HRVA 5GOTA 1N2BA 3TRHA 3LRXA 2BR4A 4QFBA 4JWTA 2D1QA 3C98A 5JZBA 2IPMA 3DE7X 1Z9BA 3HI6A 2BCEA 3MJFA 3BK2A 3WQBA 4BO6A 2WU8A 2V7XA 3JYHA 4Q9AA 3WLKX 1B3BA 2X3YA 3O9MA 1PF7E 1C3OA 1Q6ZA 1IEXA 1ZHHA 5KC8A 3OJOA 3KS9A 1VLVA 4U0KA 3H3XA 3L9WA 1I80A 4WZAA 4C3ZA 5IYZB 4Y9RA 1YK1A 2HGZA 4U9UA 3DAGA 3JQ9C 4HXEB 2JLAA 4QUEA 5EZ6B 5GM2A 2AG6A 1S5PA 1W85A 3PV0A 5KINB 2GM3A 4H1HA 5A3SA 2DWUA 4BXOA 1COZA 1XKLA 1EHIA 1E7SA 4LSGA 4HEA6 5K09A 3DE2X 3ADOA 1WCXA 1SWWA 3MSXA 4IEEA 4YECA 1YB1A 2XVMA 3WX0A 3MWLA 1PT9A 3AJAA 4IJ6A 4IXWA 3VNSA 4LKRA 4NBTA 1UPFA 2X41A 4FZRA 3TINA 3G2PA 2CXRA 3FSJX 1ZD9A 2C29D 2IWRA 2FW9A 4JVNA 3F4BA 4KGDA 4R9RA 1ODFA 2G1UA 4HXYA 2HJRA 1NMYA 3C1AA 3JVUA 1AMNA 4AKGA 5BMVF 3UV3A 2JRLA 5KYWB 3ZU5A 1J5PA 1ZBQA 2JHAA 2X8WA 3BWCA 3EWSA 4G4GA 1W44A 2NQ8A 16PKA 3AIMA 3L93A 4I4TB 4Y1RB 4DM4A 4QBFA 1HORA 1QANA 5EQFA 3TM5A 4FYIA 2FFBA 2J0EA 4CCYA 5F7JA 3MUEA 4XFDA 3UHAA 3UAZA 2C4UA 4OO3A 3KQYA 1UODA 2YX1A 1FU8A 1GQYA 2DWCA 4EKDA 1PLKA 4KXFB 3FOFC 1I30A 1Z0DA 3H8SA 1A72A 2I6QA 1VPEA 2NBNA 5A0VA 4HGYA 3CG0A 3R7AA 1EK6A 1PL0A 3DBRA 4LJSA 1P0PA 1YCFA 3SIPA 3TLGB 3MLAA 4D44A 1A76A 3JYPA 2X8JB 3H65A 1RP1A 1NKSA 3IQFA 2GD2A 4O4HB 3UPTA 4MWOA 3CB4A 1Z4JA 4XI9A 1XQ9A 2FLKA 3VR0A 3LH5A 3FD8A 4I9NA 4FK8A 1IXKA 1KQPA 3DOEA 3WKDA 2A57A 1KBZA 3VDMA 1WB6A 2FRVA 3B13B 1YB2A 2HWYA 1MTOA 3OG9A 4YMGA 2HOQA 4JB8A 4OK5A 4DW8A 1S3FA 1WEHA 4IXMA 1NI5A 2NVOA 4XQEA 3RS4A 2AFHA 4LJ5A 4KK3A 1AQJA 2AG5A 1RCFA 2DPHA 1YHYA 4P7JA 2Z83A 1IXRC 1I1NA 3ZXSA 3QKRB 4II2A 3WTCA 3A7DA 4MKRA 3UMJA 3D8UA 3Q41A 4BEWA 1F1JA 2GWRA 3C70A 4JJ7A 1MT0A 4PLFA 3TSOA 1D6MA 4RLSA 4B6PA 1JXMA 1UKCA 4WY8A 4EJ6A 1RRMA 1L7VC 2JBAB 2OQ2A 4UU8A 4YCMA 5IYZA 3U3DA 3VR3D 4O6VA 2O8BA 1KS2A 3AFGA 1H1DA 2YY5A 1X8LA 6GPBA 4NEHB 5T6MA 5CBPA 3JQ7A 1G8AA 2PT7A 3IKLA 1CQWA 4KMSA 3V2GA 5H3LA 2FX5A 3LY9A 3Q2OA 4HGOA 1FQJA 3INTA 5D5PA 4CFYA 4KPUB 2YXEA 2EFGA 2NZUG 1RXVA 4MOWA 2BM0A 3HACA 2EHDA 2QUJA 5A9RA 1T34A 1P5HA 3DZKA 2CK3D 1VSQA 5FLEX 1HFJA 3AU9A 1IY0A 3LCRA 1EUDA 1HDIA 4JQYA 3WFJA 2VNKA 2XYRA 3VZCA 1THZA 2D0OB 1U98A 2CNBA 1EUCB 2E5WA 4G85A 4TUYA 4WCDA 3WGYA 4YUWA 4HB3A 2AYXA 1P3JA 1KZGB 1VIAA 4R0MA 4P7BA 5JAMA 1EUCA 4CCYB 4Q0MA 3B60A 2H57A 2ZJ8A 4L4XA 4LY3A 4JJZA 4Q1EA 2OZKA 3UB4A 4L5CA 1NIPA 4F46A 2QSUA 1ZG3A 1XCMA 2P9HA 1NYRA 3DFKA 3OZIA 4DDWA 3DZCA 3GLVA 4BAUA 4TWAA 2AEMA 4W5JA 2ZBPA 3GA0A 4J0EA 4UUAA 2DBRA 1C3JA 1JHZA 1JQEA 1U7WA 2JANA 2WYUA 4I4NA 5SZHB 3IV6A 4GVPA 2GGSA 2OHXA 5IJZA 3C74A 4CKBA 4ZXPA 1L4YA 1AH2A 4LYJA 3FFWA 5FHQA 1QOZA 3AHHA 3F6BX 5HNKA 5AKZA 4EUHA 4X8HA 2R751 1FFXB 4ZICA 3L0DA 2GAIA 4TM8A 4WCFC 3G1WA 2JJMA 5DKFA 3E2IA 3BPSA 3DGEC 1YFLA 3HDVA 1RBQA 4NNPA 4RY2A 4JOBA 3ANYB 2BMFA 1V47A 2VBIA 1N5KA 3OY2A 2RKOA 3CF4A 3EVTA 1GZ6A 1O87A 3O73A 3HA3A 1UBSB 1E6KA 4WKCA 4XW2A 1WW2A 3ZH9B 1E1YA 1QFZA 3JRNA 4D7AA 3UJ9A 3U4QA 2Q2VA 2A0YA 2IXEA 2O23A 1YZHA 2CUZA 1CUEA 3KE8A 3P96A 4PHFA 1E3JA 4Q3OA 4RHTA 1N4DA 1LPMA 1UK8A 2VBGA 4KQHA 3CUWA 4YROA 5JNVA 1UOOA 3FTCA 5FQOA 1HM5A 1J8QA 3K96A 3LVQE 3MLBA 4LSMA 2I2DA 4XCXA 5FBZA 2ACEA 3C3KA 2C7BA 1OB2A 2V7QA 1SUBA 1NXPA 2BKXA 2EGGA 3WBBA 4E12A 2QW1A 2QTBA 1Y0BA 4LJ8A 4FOOA 5JASA 2FZEA 2O2DA 4O4LB 2WSLA 3G2QA 5MGBA 3KPUA 5CR9A 2Q3FA 4GECA 3SE7A 4X66B 2ID8A 2ZS8A 4Z4CA 2JLBA 4N0DA 1I10A 4C29A 1V2GA 5CAEA 4ENVA 2OCXA 1ZOPA 4CMHA 3S29A 2XCUA 3T4EA 3QRWA 2MSNA 3MWEA 3U5TA 3AB8A 2NVUB 3V4VB 5CVUA 3UA4A 2WVAA 3F8TA 1R0ZA 4DS3A 3GJYA 4NVRA 5CFMA 1WTCA 1PS9A 3A7EA 4OP1A 4R9VA 2WNSA 1P72A 4WK6A 4MW9A 5K8VA 2D7JA 1QO7A 2O1EA 2REQB 3CVUA 1KEPA 2PEZA 1JBKA 3QQPA 2VQEB 1U2SA 3T9EA 3NS7A 3GLGE 3IQXA 1ZGCA 2C98A 2ZJ6A 2PWBA 3EXEA 2XHZA 2ZYGA 4PYRA 5HZHA 4EK9A 1PFUA 2QRVB 1G20B 2G4CA 2OAP1 3F73A 1B93A 1CNEA 3MOGA 4LC9A 3TKLA 1XC7A 2GPSA 2ZBDA 2PL3A 2XKBA 4F3KA 2Y1CA 5CVVA 3PLNA 3QBJA 1LI5A 2CFOA 3PQCA 1CG6A 2FH5B 4KIWA 1DV2A 3MTQA 4KR0A 1W1IA 1O95C 1Y3FE 3PVSA 3DSRA 3H5NA 3SPXA 2FUCA 2FZ5A 2YJNA 3HBJA 4ENSA 5HPYB 3HB9A 4M1OA 1W75A 2PL5A 2BIFA 1WD5A 4G0XA 4NFYA 1M76A 5KJCA 2WWRA 3BDVA 2ZJ2A 1WXQA 1QR2A 2WE7A 3OZUA 1P0QA 1U2DC 4E08A 3UY5A 3AR7A 4JL8A 4S35A 1DCTA 4OHUA 4DRXB 3BT7A 2A33A 4MPPA 4E1BA 4DKJA 4DEVA 3NKFA 1RKQA 4CLOA 3GLQA 3AFMA 5LM3A 4HLNA 3OQ6A 2WY2D 5IRCD 3VJRA 3PENA 1QF7A 5JD3A 3IP8A 2W2VA 1P1KA 2BTQB 2I33A 2O8NA 4PNZA 4EMUA 3QV1A 1DXOA 3CT6A 1QV7A 3CFYA 4QGHA 4YP5A 3U31A 3OQJA 1ONNA 1G0OA 3G5UA 3TAHA 4NLLA 1XEXA 2G9RA 2ORED 5GM1A 4HG2A 1N33B 4EG0A 2NO5A 3UWSA 2AKEA 1PFWA 3B9RA 3C3WA 3CIFA 3V2IA 4XX0A 4TV8B 1PT5A 4O2RA 1U63A 2AQHA 1KP3A 1R3UA 3QWFA 4RAOA 4TUYB 3JATB 4MUIA 5D5HA 5FA8A 1N6LA 4ZKEA 3BS4A 1DJNA 3AHDA 2GEDA 3OSUA 2NYAA 3DP9A 5HF6A 1SH7A 1PFVA 4H1TA 3NNSA 1YRQA 1Z83A 2C5SA 4MV4A 1PT7A 3IIEA 4EJSB 5HK9A 1H4SA 1LPSA 3IDOA 4WKNA 3RYIA 4Q39A 1R64A 1GQQA 1Z5OA 2P4SA 1C3XA 3FGPA 1QCYA 5F9MA 4FI3C 1TX4B 2REXB 1VMDA 3V9PA 1Q21A 4E70A 4PYJA 2DLDA 2D5BA 2GVNA 4OATA 5LQDA 4L78A 1E3MA 1JJAA 1E2KA 3LV8A 3F5SA 3WNVA 1DWQA 2VP9A 4HX9A 3ZLTA 4CF6A 3OD5A 3ZNNA 2YQ5A 5K3FA 1OE0A 1JDBB 1GXSB 1T2EA 1BIFA 4M9RA 4YWJA 4YJ2F 4ZXFA 3HCEA 1JQBA 2V03A 3EZLA 3MSCA 3QW4B 4FHDA 4IWYA 3OWHA 1EUQA 1A9OA 2Z2IA 1FUUA 1XKXA 4FGKA 3AT1A 2SBTA 4HS4A 4PSVA 3RKRA 1VP3A 1BS9A 5DYWA 4QBGB 1GPWB 3WMXA 1O0CA 1ULHA 2M6RA 2VPQA 3BMXA 2HMAA 3HUTA 4UBIA 1Z18A 3GUYA 4DIDA 2PH7A 4FYJA 1VPVA 2JFOA 3ESXA 3HE3A 5AVKA 4BMDA 1QK3A 4MEJA 3L4BC 1V7PC 1YZFA 4DOMA 4ZQCB 1AHIA 1M1XB 5BOSB 3U16A 1JNXX 1JKJA 1HE4A 3NHJA 4OHKA 3ET4A 1N5RA 1ENPA 1DFHA 2O2JA 1D7AA 4WD3A 5F23A 4CUKA 3DVAA 2BFFA 4FWTA 2PPVA 5C34B 3HTXA 3L8EA 3OEEA 1R8YA 1RACA 3PA8A 4GMDA 4LMBA 1MABA 3ELWA 3FFXA 1NN1A 4KQWA 4ZAXA 2YZ7A 2H1VA 2NO6A 4J3NA 3RC7A 4E7PA 4U5QA 3BMOB 2AVNA 4B33A 4B17A 1T29A 4BC1A 5EJ2A 2AFVA 3EE6A 3G79A 2H4XA 1YJAA 2FHPA 3KOWA 3KOYA 2C0QA 3CX7A 1P0IA 3SJ7A 3F90A 4BO9A 1T5IA 2BF4A 1RWPA 1G2PA 4O2AA 4Q3DA 5H1YA 3L7AA 1C44A 2B4AA 3K0BA 4M9UA 4EI9A 3DOUA 3LM8A 3ILXA 4FE3A 4R3UC 5I7FA 1ULUA 2WTXA 3JAWB 4GX1A 1TUGA 3ZTYA 2NOAA 1OWNA 4V39A 4CKCA 1U0HC 4NE2A 1KZ7B 4IOLA 1EVZA 1UF9A 1UR5A 3QEAZ 1HYQA 1S9HA 1KK1A 3JWPA 1IAQA 2IZOA 3CCCA 2IZZA 5FPKA 4XM1A 3I04M 3CUTA 4JKIA 4ZEWA 3WDMA 4ZVMA 3FNBA 2A1IA 4D8YA 5BSTA 1KSJA 4Y2TA 2D13A 4ZO9A 4TKLA 2Q5IA 2XKKA 2B1IA 2C57A 2FPGA 2IYPA 2HGSA 3OLCX 4BX8A 2VIIA 1AK1A 1PVDA 1V6SA 2H4WA 1DT5A 5H4GA 1NMZA 3AR4A 1GUAA 3WGKA 3K70C 1OC2A 3QFRA 3NHKA 2W2NA 1L4HA 2I8LA 3EMVA 4K46A 1E79A 3CF4G 1DBWA 3E22A 3GY0A 4UASA 1V5WA 4KVGA 3TZCA 3MCWA 3AVPA 3VR4H 1OREA 1AN0A 3V8NA 1NUAA 1RBZA 1GA1A 3G89A 4GOLD 2AG8A 1XIVA 1CP3A 1QPZA 2UZAA 1H69A 3P20A 2HU8A 3TXXA 2R8OA 4BRZA 4N5LA 1CY6A 5LZ9A 4FCVA 1RMTA 3MS7A 3FLAA 1TPZA 3VKHA 2FQ1A 2QRNA 3ODGA 5DIFA 4R71A 2V7BA 3AQ4A 4D9BA 1SKUA 3C3DA 3RUCA 2AJCA 1J70A 1C0LA 3HCWA 3PWSA 2H0RA 4HYYA 2F9FA 3L46A 2YXPX 4P58A 3IBTA 4EZIA 4F71A 1NBHA 3NFRA 5AKHA 2ONZA 3GRZA 1K7YA 4J16C 5SYMA 3RG8A 3WGUA 3UG7A 4CU5A 4DQUA 5IF3A 1KFBB 3UGTA 1BA2A 1G9TA 3QLJA 1Y4ZA 4YJGB 4OH1A 1H42A 3B1VA 3O7MA 5K3AA 4PLGA 4J29A 1YI1A 3HCRA 1G3IA 5ALNA 3V6LA 4BFXA 3SD7A 5BYJA 4OFBA 1FLDA 5BRJA 1R4MA 3L0SA 3IYLW 2O7VA 4LOIA 1W8DA 1ZD2P 1QG6A 2CHQA 2DFLA 2XXJA 3BIXA 4GF5A 4BLVA 1VIDA 3MCAA 5KREA 2R1TA 5E7IA 4V0QA 1ZJ4A 2SECE 1OBHA 4OFZA 4Q7EA 4X0EA 2X0FA 1SBYA 1E5TA 3QMWA 2I3GA 4TWBA 2PLWA 4KDEA 1MNAA 1BSVA 4EA7A 4A36A 1CXZA 4AK9A 3V4OA 3P2OA 5T4FA 2B8EA 4G09A 4HUQB 1A97A 1TYDE 2E49A 5HKOA 4FILA 5IDVA 2PAFA 4M36A 2VQSA 4E2WA 5HHTA 4TTRA 2IUSA 3LD9A 5GV8A 2W6JD 1E96A 5AJZA 2C8LA 2PKRA 3MJCA 2QE6A 2WYHA 4TL8A 1E2PA 3K9WA 4TLEA 3L0PA 2I3ZA 1XTZA 1Z5NA 2HA2A 5A9SA 1DT3A 4BMYA 1Z0SA 5K3BA 4YRPA 2JD1A 4PYNA 3C48A 4B6GA 1W4BA 5JS8A 3B12A 4BV3A 4CDNA 1KWGA 4FMBB 4ZYUA 4XIJA 5BWBA 3DTVA 2FGJA 3Q7TA 1CQZA 1JDZA 3GNSA 3GLIE 3LVRE 4ADSG 3A36A 5JJLA 1RTTA 4OGWA 3FB4A 1I7QB 2I4IA 4BNMA 4LOAA 4BVBA 3IDQA 1B2RA 1JEEA 2R8EA 1H8HD 1TT7A 1NT4A 1GRCA 2O52A 1VI6A 2QLJA 4QDJA 1E1RA 4HN4B 4I8DA 4IZIA 3N0TA 2ZBQA 3GLIA 1N57A 2CL7X 2IHKA 4YHBA 5K0ZA 3EWIA 3O3NB 2G88A 4HGNA 1IMJA 2H7CA 3ZHUA 1LCIA 3K8OE 3ZBTA 1LPNA 1DJPA 2HDWA 1CNFA 3ACCA 4UZFA 5KHLB 2RAVA 4FHZA 1WD7A 1IN8A 2ANBA 2HHLA 3BMOA 3MMSA 3JAMA 1B73A 4IRMA 4YV1A 1SVIA 4MCAA 5YASA 2AYZA 3HVRA 1T3ZA 2YV3A 1RQRA 5JZOA 3OKFA 1TZBA 4KACA 3WJ7A 4BQFA 1JIJA 1HFEL 2D3WA 4F9GA 3GRYA 3PQ6A 1THTA 4HPXB 4MP8A 5ARBA 5LUAA 2B61A 1IBRA 5SY9A 1SQ6A 3I72A 5EYPB 3UPDA 2C7RA 3V7FA 1NASA 3QBTA 2QWXA 3DC2A 1HT3A 1Z26A 1FK8A 3R40A 1W0JD 3O3OB 4BLRA 3HSSA 1L3CA 2FMIA 4CKBB 3FBGA 1OX6A 4DXDA 1F12A 3NDIA 1CERA 3H5AA 2O05A 3FOCA 3LX8A 2ZRLA 2AEFA 4R01A 2CZCA 2LCIA 2YVKA 2WT9A 3C8UA 4X24A 3REGA 3UK6A 4NBRA 5EKUA 4ZO6A 1AGXA 2Q8QA 2HBRA 3NETA 3BMQA 3LUAA 4PZ0A 1NNI1 1TJYA 4PO1A 2YFQA 3E2PA 2P2YA 5B7NA 1U7HA 4JR1A 1EESA 3H1FA 1VA5A 1VI5A 3BHNA 2BUBA 2ORVA 4HZUA 4B71A 4E14A 4H6WA 3O8QB 2QQEA 4CIBA 3V8VA 1XI2A 3TQCA 5J5CA 1SHZA 2EP5A 5HYVA 1Q7TA 1MVLA 1WXWA 3CEPB 4G0OA 2VAVA 1P44A 2ISSD 4WE3A 2XLCA 3QA9A 2HUNA 3GA5A 2VBFA 4KLZA 4M9QA 4QM6A 3K1AA 3FNFA 1WLYA 1EVJA 3KT0A 3OT1A 1ZIPA 1QGDA 5DB4A 5B30A 5ICMA 4Z4HA 3UO8B 4MCIA 3KZKA 4IMIB 5P21A 3ZWCA 4RF3A 1L5HB 2DEUA 4DIFA 2PZLA 4Y30A 2O48X 3UC9A 2PUHA 4PSUA 5M3BA 3HPRA 4EPTA 1ZK4A 4ZRDA 4B87A 3PTLA 4K1XA 4II3A 4ZQBA 1D4FA 3M8KA 1YCHA 1XEXB 1XZCA 1QNFA 1Q2UA 1UDRA 2NV2B 3OZAA 4DYDA 1U3FA 3ZWDA 3HK2A 1XX6A 5EMKA 4CM8B 1JDUA 3O9VA 2X15A 4FDMA 2CKDA 4CL0A 2JIPA 3GFRA 1XOIA 4KX3A 3SR3A 5AUOB 2Z2YA 4XLTA 5ED4A 2P5SA 4CYMA 1RXUA 2AC2A 4QYIA 2ZSIA 1XTUA 5AM3A 1VHLA 1GTL1 4FMCF 2HT1A 1TJ4A 3HJTA 1ISIA 2AZDA 4LZNA 5ARDA 5FCDA 3UHJA 3WLTA 5BVGA 2A0UA 3B82A 4KPEC 2HFJA 1W2GA 1LXCA 3K0AB 4IFTA 4WINA 5REQA 4A4DA 3EEFA 4RMIA 4X62B 2QS9A 1XAIA 4IQ4A 1I1QB 4EABA 2FDCA 5JD5A 1M1NB 3EG5A 1GSOA 3AP1A 2YIMA 2GARA 4QQRA 4QTYA 3H13A 2JH3A 4QPNA 3SZUA 4QTXA 5IVDA 3TRIA 3Q85A 1PGJA 3I9OA 3WL4A 5ITWA 4MICA 4LHYA 4KR9A 3OZBA 3P2YA 5DHAA 2F1JA 3QWBA 1R15A 1RHJA 5B1YA 1OBVA 1E62A 1TQHA 4PZAA 5BMVA 5BPHA 4IV5A 1X1TA 3KBBA 4E07A 1Z4LA 1NMXA 3NWEA 4Q1VA 5DLYA 1XCBA 1HYBA 3T9FA 3ZHCA 4YP0A 5DK4A 4D26A 1F8XA 4PCAA 5C7OO 4KN6A 3F5FA 2ZAOA 2PVCA 1F6WA 3L7CA 3V8RA 4WECA 1AHPA 2VJKA 3ITEA 3UAWA 5FLXA 3KOZA 1U7XA 2P35A 1BJTA 1HTBA 4OBEA 3JQFA 5DHPA 3DDNA 3K94A 3P1JA 2OB1A 3T9BA 3IE2A 5IS2A 3H9GA 1UDBA 1JDPA 2XGSA 4AI6A 3RUEA 1OWOA 3LL4A 3DVAB 4IO1A 1UMKA 1J23A 1NW9B 3FDZA 2H00A 1CZKA 2JIRA 2PEYA 3KKQA 3LZDA 2Y9PB 2DQYA 3LUDA 3S2SA 2XNDD 3TXAA 1R7RA 4KBFA 1N92A 4OHCA 3PPXA 5KPJA 4J2TA 1IB0A 1KYIA 1RWBA 1HE8B 2C9DA 4OI1A 3U1TA 4PIMA 4RELA 1WS6A 3AEUB 3H2JA 1GL6A 2AR7A 1VE3A 2BMAA 3E03A 3NATA 3IR7A 4OKNA 1GG5A 5TMBA 2JJ1A 1T4CB 1K86A 1VJRA 1DBRA 2QAJA 4NOLA 5KKNB 2V97A 3NHBA 3QFHA 5LR6A 2H63A 3BIJA 2B7LA 4M0KA 4URWR 4BV8A 1Y37A 2X7HA 3FOZA 1QRDA 2BH2A 2WIFA 1SKYB 1O57A 2Z09A 3NYQA 4YV7A 1EPUA 2ATEA 1MP0A 3LK7A 1N1GA 2F59A 1N9GB 4ZCPA 4O5AA 1GR0A 4KOEC 4KWTA 4D9JA 4JEUA 1QE5A 2IEAA 1AQIA 4PPFA 1UJCA 1L1RA 3OCUA 3UWPA 4AY2A 1SXJE 4PTYA 3DE5X 4KMOA 3DMRA 1DO2A 3OFND 4GLJA 5CFRA 1ND5A 4V1CB 2XBLA 1E8MA 4JA0A 4QXPA 2UVQA 1VBFA 1Y1LA 5LUBA 1YRYE 2I03A 1V16B 1ES9A 1LLFA 2V5AA 1EX6A 3GG9A 1C30B 1FFSA 3EVAA 3W5HA 2R6R1 1EXVA 2X42A 3HDHA 5FD8A 2VI5A 3MWJA 1KIMA 2BBOA 3ORHA 3QFTA 1ZIXA 4S12A 5C2JB 5JPCA 5THQA 3E22B 1U0SY 4NE9A 3GHHA 1OU4A 3ODPA 4W1SA 3ELDA 5ES3A 3FNRA 1A77A 1N6HA 2F3PA 2I22A 3P0RA 4FZJA 3FWKA 3AVXA 2VPPA 4ENPA 5ESDA 1II8B 4ZCLA 1JQ5A 3AF2A 5KTMA 5DSZA 2XMQA 3U5ZB 3N7ZA 3EUAA 1T9HA 3I39X 4MYCA 3RW9A 4C0JA 2XVYA 3OFVA 4CMGA 4Z9FA 3NM4A 1GFWA 5M7EA 221PA 3B1YA 3RVOA 1HE3A 1B7GO 3A3NA 3TXYA 3HXPA 2QTTA 2HXYA 4MV6A 4D46A 4E2XA 4ENTA 3L40A 3GGSA 5AP9A 5IZCA 2FGKA 1IUPA 2FSIA 2OO5A 3CNUA 1K7CA 1FX0B 1Z07A 4J0GA 1KJZA 4LGCA 2GZMA 3A3YA 2C2OA 4QREA 5EESA 1P77A 1VFNA 2OENG 1W34A 2XTNA 1NXWA 1U7UA 3PUZA 1OXUA 4YQFA 1JA1A 1G7TA 2HI0A 4M88A 2DUMA 4ONEA 2FCRA 2GZSA 1ZJ6A 5CFLA 3QVLA 4AY3A 2RH4A 3C1OA 3RUFA 5JXGA 4PO3X 3DAOA 3FTFA 1WDTA 2GPAA 2BFBA 4B3HA 3OA0A 4G26A 4BBZA 1WHSA 2C8JA 2EL7A 3EQ7A 5LLDA 4HZGA 3C6ZA 2XYGA 3H7IA 5IJ9A 1D1QA 5A6VA 4TV8F 5A0FA 1QC5A 1II9A 1PN3A 3WYEA 4NH0A 1N6RA 5HF5A 4BNNA 2VHWA 3IB6A 1MX5A 5EP4A 1WETA 1WAMA 3E9ZA 3I0ZA 1VDMA 3KSMA 1HZZC 4IJ5A 3VPDA 3W4JA 1N2JA 4E31A 3BAFA 2RHCA 1Y1KE 4XJXA 3RVJA 2O54A 3EW7A 5B2EA 1Q5PA 1B6GA 4FQ5A 4ISBA 3SBDA 1E1MA 5KOHA 1PR2A 1J7KA 3ILSA 1KY5A 3WMGA 1NV8A 4N48A 3C7KA 3PGKA 1MQAA 3S2ZA 2YQZA 4OOFA 5IWAB 4Z9BA 1QGAA 4URYR 3ROGA 4RMHA 1YRAA 4NL4H 3UAYA 2GNOA 3IVMA 4F97A 2MSKA 5KSWB 1H8EA 4HH1A 2G1JA 3PNBA 4GYYA 5NLLA 4OA5A 4BJ1A 4YAUA 2FPGB 2OK8A 2O2YA 2YXDA 3T4XA 3OEHA 2C2HA 3BRWD 2ARKA 2BGLA 4LWOA 3ROTA 4H59A 3WJ2A 1PX2A 3T34A 3ZV5A 2WTMA 4W7IA 1H05A 4XH9B 3E53A 4OXYA 3B6ZA 2P9FA 2XTMA 3G6WA 4WGGA 5LZ4A 1A5BB 2BGKA 2E5FA 2VSOA 5CB6A 4YA6A 2FFHA 2A92A 2JZOA 4TLLB 2CNOA 2O8CB 5CT4A 4C30A 3WQSB 1KMCA 2XUOA 5TJ9A 2QMZA 3G5TA 4RJKA 5ES4B 4PTLA 3AVOA 1MBZA 4FM9A 5KMGA 1FX1A 2QU7A 1O08A 1A82A 2WAMA 4LY0A 4B3MB 3IQWA 1UKZA 3EXHC 1XE3A 1W0KA 1DKPA 3IODA 4UMEA 4YBRA 1M0EA 1DJMA 1NY6A 4F96A 4IVQA 4MDYA 3ORQA 3DFIA 5CLFA 2XIQA 3KR0A 5C7IO 1IPEA 2IHVA 3Q9UA 2B99A 4B47A 3I83A 4DMCA 4TSFA 3A3OA 2CHEA 1MA0A 1LSUA 4BMZA 4LOHA 3B2EA 4X20A 1YCDA 2W4IA 2FSHA 3RTBA 3F5DA 3NTXA 1PLJA 1KJIA 3QTTA 4N3AA 3U4MA 1JHDA 4YGYA 4JASB 1C3EA 4ND2A 2UYHA 1TK3A 2EFHB 1NV9A 4GEKA 4KE6A 2QX9A 4NBLA 4MVJM 3BH0A 1WRBA 1WUKS 2RGUA 3OLVA 1JR2A 1R6BX 2Z3VA 1ZU5A 1J2EA 2EKDA 5KVVA 1XU9A 4YMWA 1RP7A 1OH8A 4MQEA 1ACMA 1LPBB 1IG0A 2FPPA 2PX3A 4NFSA 2IS4A 3E3AA 2J5QA 4WHMA 1IKTA 1FDVA 4I1YA 1SY7A 4KMRA 3ZHTA 3EUEA 1J2YA 3OIDA 3KKZA 4GQIA 4PV7A 2DERA 1A7AA 1N7HA 1V25A 2QE7A 1NVAA 3O31A 3O9ZA 4PX5A 3RT9A 1J9EA 2XUKA 4IIBA 4QBHA 1LD3A 1F8UA 5HZGA 4JYCA 1X42A 3C39A 3K7EA 3TDMA 3S3TA 2O0JA 4BO7A 2XMZA 4G36A 1H4TA 4XIIA 1L4GA 4P82A 3TO5A 4EW3A 2QUIA 3QUCA 1W76A 4GVXA 1PBTA 5JXJA 3BGDA 4PYKA 1K5PA 5L53A 3N59A 2VQFB 2OV6A 3ENWA 2QF7A 2JPDA 2Q0HA 5HE9A 3WMWA 1SXJB 4US2R 4KNVA 2GPBA 1I7SB 3JVVA 3BKRA 3L05A 4LQLA 1BMFA 2JJQA 4CMKA 5DCWA 1ZJJA 4AJHA 4TYQA 4TS4A 2B1QA 3GJXC 4ENRA 4LV5B 1H23A 4UVDA 4X8LA 2L69A 4MYSA 4M1YA 2FQWA 5HKLA 2QX8A 4QJBA 3M7IA 4GOXA 2PS9A 4MV1A 3ROPA 1XMOB 1XP5A 3F8SA 2ZQYA 5MGNA 2ZLBA 2ZSUA 3ZIAD 4DJDC 1NVFA 4L8WB 4QNMA 5EG5A 1EG2A 1TA9A 3IO3A 4OHBA 4OBBA 5FIUA 1X7ZA 5FI3A 5J9FA 2IXGA 5CB4B 1WM1A 5E1BA 3L82B 3N8NA 4AO7A 1KS9A 2VRNA 2WINI 1PNQA 2C9BA 2JHPA 5E2AA 3GA7A 4AZVA 3SBEA 2D0DA 5B58T 4YLGA 2DPXA 3O4GA 2GBLA 1IOLA 4MB2A 3AO0B 3LA8A 4L8LA 4YN3A 1CYEA 2BISA 1EFUA 4DLBA 4M7RA 1DBPA 1PD1A 3GUCA 4YRAA 1ZH6A 2IV3A 5IDWA 1JPVA 3JXEA 1LBSA 1RSZA 4AG3A 3M9WA 1XF1A 2BSQA 4ZMBA 2B2XA 3D31A 3FRJA 5JNSA 3PHBE 2P1DA 3FZGA 1CS4C 1EX1A 1OZAA 1AS0A 1CDEA 1P8JA 1ZUD1 3C8ZA 4DQVA 3K2IA 2HLNA 1QE0A 2QM8A 3UFBA 5K4GA 1WUYA 1Y6JA 1TEHA 5ALMA 2GBPA 1U0GA 4MINA 5B1EA 2O50A 4UAVA 3FIUA 5PGMA 4D6PA 1C7IA 1DIAA 3P32A 3GLKA 3OZSA 2JJYA 5LKAA 1XV5A 3BICA 3MLEA 5I9IA 5IWCA 2D2IA 1YMVA 1KKMA 1P7CA 2JAXA 4JYPA 3BFPA 1T1RA 1PSWA 5DASA 3A9VA 2WV9A 2I67A 3A6ZA 4K5QA 4CIXA 4XUEA 4FDAA 1CUXA 5EIEA 3S2GA 3WLNA 1P2GA 1WCV1 4FEYA 4UHCA 1TEZA 3LP6A 3NBZC 4X71A 2IEDA 1ZBDA 3AX6A 3C15C 4OQQA 3WNDA 3RABA 5ERGB 1V2HE 3QLEA 1SKMA 3TW6A 4EG7A 5LNK6 4UHFA 4Q9LA 1J00A 3JQPA 2WWFA 4CM4B 2XYHA 3D6AA 1NM5A 3UANA 3R7WB 3I6BA 2DP4E 3HB0A 3Q87B 4F7WA 2Q62A 4IDBA 1XLUA 2HSWA 4JYMA 1XSEA 3ORYA 2CYCA 4RE6A 5HZKA 3I53A 2XT9A 2OORA 3WLPA 4HY3A 3N8DA 2YHAA 3AF5A 3MG9A 2C7OA 1O0SA 1SBTA 2R1VA 3N74A 1FFBA 3SLRA 4YRBA 5EXPA 2R6HA 4IAOA 4C6SA 1FS4A 2YNMA 5IJ9B 2GA9A 2BEJA 1YS1X 1Y48E 4D3XA 4G41A 1SB8A 5CB4A 4WNAB 1UPAA 4K6GA 2C95A 1RQXA 1ECCA 4JB3A 4L4RA 2VWHA 4XWTA 2ISQA 1HT2E 1JTVA 3AXSA 1BEEA 4CM5A 1W5FA 1GRRA 4XA8A 3O8NA 4KXQA 5K6AC 3IE0A 2QUKA 3UF0A 3V32A 4DHEA 1M67A 4I4TF 5M29A 3U4QB 2IZ5A 3DLIA 4OUDB 4M1TA 4O1MA 2Q4DA 3T9DA 2VNAA 1G8HA 3ZWXA 4BYGA 1XROA 1ZUNA 2HO4A 2FEXA 4Y2PA 3S99A 2RGXA 1KFJB 1KPGA 1PO7A 2HPAA 4JLMA 5I6DA 3CF6R 2C04A 3SHQA 1FLAA 3TR6A 4QHSA 2F8SA 4TMTA 4DKXA 2EZ8A 3IVGA 1JLKA 1LRKA 2VR1A 1DUIA 2Z58A 4NYIR 2C0CA 1XN1A 1II8A 3O0TA 1QRAA 3CLRD 5BOSA 3E3LA 5ISMA 2AE1A 2GN2A 3UA3A 3LHIA 4HUJA 3WGNA 4TYNA 1P4RA 2Y99A 3TVTA 1SUEA 4QBTA 2ZUSA 4OG2A 1H0KA 1K8RA 3KELA 1UJ2A 2EYQA 1RAAA 1IONA 3M9XA 4M89A 4WA8A 4ARBA 1OGIA 2ZI5A 3FLEA 4G1MB 4RKEA 2QTVA 3G0OA 2Y1FA 3TIFA 2WKRA 3IQEA 5JYDA 3M3DA 3I4FA 3WI7A 4LJ4A 2DXIA 2OLEA 2PD3A 1MJGM 1RXWA 1PWEA 2W9XA 2ECOA 4PCVA 4HQLA 4GX0A 2P0EA 3U9TA 2HF9A 2O7SA 3M49A 4FIDA 3MB5A 1BDBA 2Z6VA 2WHYA 2IPNA 3MELA 3QE3A 4ND8A 1OLSB 2QIPA 1L1FA 1GUDA 4TMYA 5J3JA 4HMQA 4UNSA 3SQNA 3NOQA 3CKMA 1CX9B 3CPJB 4KJZA 4CKYA 5LN1A 1AQNA 3MCZA 2W2TA 2A1TS 4ZAVA 4F7DA 2X6TA 3L8MA 5HQ3B 1PJAA 5LA6B 2YJ4A 2PRIA 4GZ5A 3QF4A 1V9CA 3TFQA 4BDTA 2QD2A 2ZKLA 3IIKA 1Y63A 3LT4A 4ZEVA 2MYUA 2V54A 5DN6A 2RK6A 3U1VA 4DLTA 1Y3IA 4OUKX 3CVXA 1J22A 3NJRA 5FI1B 3TQRA 2XDQA 4U2KA 1JFLA 1U7DA 3ROQA 1IQRA 1KZ1A 1DXQA 2C2MA 1CJKC 1E6EA 2O3SA 3OEWA 3TNDA 5AVXA 5IF9A 2QGZA 1TUIA 5AI4A 3HR4A 3K5PA 4UVEA 4UM7A 3HO1A 2AXEA 5AVRA 3KQOA 5FA6A 3WYBA 2XAUA 3L8YA 3NIDB 2F67A 1YVRA 2QMUA 2J67A 3PFFA 1TQ2A 3CJRA 1ICEA 3HGMA 1CQIB 1GTJ1 2COUA 3Q3GE 4UVGA 4AMGA 2LVBA 4NYJQ 3SBXA 2AC4A 3BG5A 3ECAA 3L0ZA 3R0ZA 5I8PA 4QPZA 4MKXA 3ZHRA 3CEHA 2XGGA 1RRGA 3G0GA 3K2EA 4LV8B 4LF5B 2B36A 2WB2A 1OX4A 1Z0FA 2IYZA 3AIKA 4OMCA 5A7HA 2YUTA 1ZIYA 2PQ2A 5T57A 4M0FA 4C3UA 5EJ9A 3OMWA 4I1OA 4NCIA 1HYEA 4UFOA 1OAOC 5F1PA 1KGDA 1G9XA 3CGWA 1NLMA 1DIBA 3DA8A 4BX2A 5D51S 2HC9A 1FDSA 3BRWA 3AM1A 1AHNA 3JQ8A 3N7TA 2UAGA 4PYMA 3D3NA 2BH9A 1ZIOA 2HQRA 3DUFA 1OLOA 3C6BA 1L7NA 5KSPA 5K99A 4U4AA 4UZSA 3ESYA 3O92A 3OO0A 1YWGO 2PR7A 3HBFA 5TGDA 4ZOBA 3MMPA 4Z0NA 2BBWA 2YWJA 4PLWA 4RCVA 4ZT6A 3FDIA 5DX8A 1AUOA 2NWQA 1BA3A 4PG7A 5KWVA 1XZGA 2WWYA 1PWYE 2P1ZA 2JGDA 4TMWA 5D1HA 1FSSA 2JLRA 4K3UA 2B1RA 2HFKA 4EJ0A 1VYHA 4DFDA 1D9XA 1OH6A 4RO0A 3NGXA 4HYTA 3QYAA 4X20B 1GT91 2J3IA 1TTPB 2J9YB 2DC1A 3JQAA 1QC5B 2YJGA 4UUMA 5AI5A 1A9RA 1JHPA 1AS3A 1SXHA 3MTDA 1R0SA 1ZHFA 1EWRA 4AU1A 3LE8A 4LSZA 5JCPA 2VJNA 5DNDA 3N6RA 5B3JA 2HLDA 3GJTA 3P9CA 1PE0A 4DNXA 2AD1A 2JVKA 3MCTA 4PW0A 5EYPA 3HDGA 4QLBA 1VLZA 5ECDA 5EAIA 1Y33E 4HNQA 3JSAA 4JAVC 3VBEA 3IURA 1SC3A 5D3MA 3MXOA 1EQUA 2NO0A 4WBSA 5EP1A 3WOHA 3ZVLA 4F21A 3BM5A 3N8HA 2CXOA 1C81A 1RXCA 4HNRA 2O07A 3THYB 1O9BA 4TMFA 1XWWA 1N78A 1NGSA 2G25A 3ER6A 3EXG1 3NORA 4HNUA 3L92A 3CF0A 2D5AA 1Y6QA 2PMFA 1G2QA 2XZPA 4RWEA 1WZIA 1CUYA 5E3IA 3WGOA 1YMUA 1BXRA 1EKXA 2CMDA 2GXUA 5ARCA 3THOA 5A5FA 4MS1A 4K7JA 1W0KD 3FYCA 4CG1A 4F9FA 1MAUA 2FMXA 1CR6A 4YR7A 5CDYA 2EOAA 4BNXA 4EY5A 3WAJA 1O4VA 1SU8A 4Z1OA 4RTQA 2BBSA 2HADA 4AF7A 1TYBE 4QBKA 2FK7A 2HA7A 2OBLA 1I5RA 2PRZA 4LXIA 4LA4A 4WI1A 1KMMA 1MC8A 3JV7A 5GPBA 1AKMA 1S7CA 4MRSA 1TQ4A 3SGLA 1XDSA 4AD8A 3GJSA 3GW8A 4RQBA 5BSUA 3NTUA 2ODTX 2B9VA 2H5JA 3SX0A 4D8UA 3CSUA 1FC0A 5C0OE 3JYLA 3L6RA 4D3SA 3OQVA 4QLAA 2X8BA 2CCJA 2CDBA 1Z12A 1P39A 3ORSA 3QIAA 4JLAA 4KLRA 4C3VA 2M6SA 4AQDA 5A9SB 3D6FA 2HYDA 2NU6B 4AV7A 4IDFA 5AOVA 4DNOA 2HHHB 1FP4A 1NPTO 1OTHA 2P6OA 4M54A 4U7WA 3OX2A 2OC4A 4QTZA 5LKRA 5LOVB 4DV5B 3H6HA 1PS0A 1LBHA 2FYTA 3H11A 4G56A 2NSHA 1K63A 4PHCA 3ZGZA 3I92A 1QIEA 1E89A 3IPAA 4RL6A 2FAXA 3VSBA 2WYVA 3OO1A 3H1BA 1BJKA 5BUZA 1EFAA 5TT0A 1JEYA 1SZJG 1OZFA 1ONPA 1QDUA 5CEFA 3NCHA 4ZVKA 4YIKA 3GELA 1XYYA 4WOBA 3ONDA 1JA0A 1F60A 2C58A 1FNCA 3PKIA 5JR3A 3ZQ6A 3AF3A 4L5BA 3B6KA 3N2IA 2WF9A 3S8EA 2Z8ZA 1KERA 4L73A 2NZWA 1FQOA 2P2SA 4ZAYA 3D4PA 3QVMA 4MWSA 5K2OA 3W8DA 4BN0A 3IC5A 5AW0A 3D6VA 4DARA 1T0HB 3I2GA 2J32A 2OGZA 2NVWA 1TUBA 2ZM6B 1IXYA 1FX0A 1OZ0A 3ABOB 2NSGA 2QG6A 3I62A 2G76A 3C0KA 1CTQA 3BA6A 1BXZA 1JFVA 1QWOA 1UPXA 2CJYA 4PX2A 4ZIRA 1M72A 4RMNA 2I65A 3EQZA 1Q0HA 4DR4B 1YE3A 1KQGA 3WNCA 3CX8A 1ENYA 1K92A 3EF0A 3NRCA 1AZWA 3FOAA 3H6KA 4GS5A 4JBXA 2PMBA 1G64A 1W6UA 1DINA 2Z08A 5CH8A 5CCDA 5C81A 5IUNC 2FPOA 1V8DA 4LQ4A 4Z3DA 1WZNA 2BD0A 2JCYA 3MUFA 3I8XA 2Q3MA 4K0RA 3Q0TA 3DS8A 2A1UB 2JHGA 3PNQA 1ZCBA 5JAUA 1QBGA 3K70D 1K6XA 3H87A 1XA3A 1U7OA 5BXYA 1G0NA 1DAEA 4P7GA 5EUBA 5I7EA 3A4LA 3IDAA 4U7FA 4EW6A 1C0IA 1NXTA 1V16A 1CWUA 4ENQA 1JFTA 1I13A 2HUPA 4JFAA 1KYVA 4TXJA 4Y6OA 3U48A 2RAUA 4YXFA 3F3KA 4HI0E 4OJTA 5EE3A 3VYWA 2XB4A 4GQBA 5E4JA 4FW8A 3ICPA 5IASA 1MEOA 3B3FA 4PO9A 3T0FA 1DPFA 1KTIA 1NOIA 3PFBA 5DPMA 1Z6PA 3B53X 5T8KC 4F06A 1FLVA 5HKAA 3LBFA 5L6LB 5IABA 3B7GA 3EXIB 4R69A 3Q0EA 5I8ZA 3A11A 3VZDA 5FLYA 3WLSA 3PXUA 3CLSC 3MMXA 3M6VA 5BV7A 4EY4A 3AHIA 1DG3A 5BQOA 4FR2A 3HL0A 2ODNA 3TG8A 5IV0A 3HCDA 5FOSA 2VYND 2ODWA 3SVLA 3D4BA 5JCJA 2YJ5A 4DB2A 3QPCA 4WZZA 3RLIA 3IQHX 4IMJB 3WLLA 1EIZA 3NIWA 3NU1A 5KOJA 3VR3A 2E7ZA 2Y05A 5K0GA 4UEWA 2PSHA 3EF3A 3O8DA 1VCIA 1ZJ5A 3K0HA 3MS2A 4G0YA 2Y1WA 3VSDA 2IDMA 3CSDA 4C0WA 1W93A 2RC5A 4JBHA 2DH6A 1FVHA 3SC4A 2NU9A 2W2KA 4BY9E 4F3CA 1TB4A 5FP0A 4BCDA 2QZPA 2X6QA 4BNLA 4G1CA 1M6YA 2FI1A 3PJGA 1RPJA 2Y1KA 3W9UA 1Y42X 3MWDB 3OOYA 2BFBB 3DWEX 4OHPA 1JFFB 3U1BA 2X5NA 4DQLA 4I1UA 3FPAA 3I5YA 1GPMA 3OURA 2IZ7A 3H9BA 4FSHA 4H3KB 4RVGA 2A2ZA 5A05A 5JSYA 4PN3A 3S5JA 1GPH1 1DWPA 2R6CA 4FJ0A 3ZBPA 3VYUB 1N5JA 1AF4A 2WSMA 5EIAA 1G9SA 2EFJA 1EXNA 4EMBA 3WS7A 4CMIA 1VPDA 1I7PA 4C7MA 6NULA 5EIBD 2NP7A 4EB0A 4BIMA 3A2NA 3NALA 4GLOA 1K2WA 4NY1A 4PWYA 2P5UA 3P9SA 4KBYA 4QGAA 3VSAA 4F6RB 3QMPA 1LI4A 4RULA 1XNRB 1SXJA 3EIEA 3NT5A 2VA9A 2QYHA 2O6LA 1NSYA 4RD3A 1O94A 2C7VA 3EJWA 2YDYA 1DZIA 1EDOA 2GHRA 4GMGA 4X3OA 2HCRA 3EXFA 4CEIA 2K2QB 4BO2A 3ZJVA 4GOOD 2GAJA 4YGXB 1U28A 2X0JA 2PFGA 2ZSKA 3I73A 3W04A 1ZH8A 4PPQA 3F67A 5I7HA 1XMIA 4E11A 2IBSA 1AV6A 5I45A 4P54A 4TOIA 4GOKA 4JJEA 4ZVNA 2X6RA 4YUVA 5HKBA 2A9OA 1ODLA 4EDHA 3GPCA 2ZRCA 4RVNA 1PJTA 3Q9LA 2ZUBA 2YIJA 1LNQA 5IJAA 3BJIC 4UPEA 4PFJA 1BFDA 2EQ5A 3X44A 3DMTA 1GPUA 1NJ1A 4F9TA 5LIRA 4U2BA 2AOTB 4R6XA 4BTLA 1ZVJA 2I9PA 1JN0A 4LCEA 3A31A 3I6IA 4YREA 3WLRA 1P6QA 2NLOA 3U7IA 4RACA 1YASA 3E7FA 5GGXA 1MABB 1XU7A 1W5EA 1AN9A 4WESA 3UN1A 2VRBA 4O3FA 5F5NA 2DFVA 4RFLA 3OHPA 1KPIA 4XFKA 2GRUA 2FOLA 1SG9A 3QH4A 4KCGA 4MGIR 4RPGA 2BEKA 3SDSA 3MBIA 1Z6XA 1I7LA 3ABRB 3EZGA 1MHTA 3OLYA 4C03A 2VJQA 4MVXA 3ADCA 5F76A 1EDDA 2DKFA 1JIVA 2J30A 3G85A 3LIPA 4BLWA 4QAQA 1A2BA 5ERYA 5IVKA 3K0CA 3EYAA 1GTRA 2GLTA 1Z2PX 2FQQA 2OCBA 1NF8A 3B9BA 3H9QA 4XGIA 3SVTA 2ZAMA 5KWIA 3ZDZB 5L4LA 4YJDA 2RHOA 5AVTA 3VYTB 2QSYA 4HXFB 4M0EA 4WXPA 3PQFA 3DBRB 4YAJA 2P6PA 3SYLA 4DR2B 3HA7A 4OSPA 4MITA 4NF2A 2Q3EA 4UREA 1KRWA 2PX0A 3P0HA 4BRUA 1FUKA 3SIRA 2QENA 3ZU4A 4BKMA 1L5GB 4EKNB 3TGWA 4IP0A 3ZEIA 1T6ZA 3IHTA 1UZLA 1M1NA 4OKSA 2Z4TA 1RPZA 4POAA 4EYEA 4WOCA 2Z04A 3W77A 4B6SA 4GR4A 4M0LA 1E3WB 2GN0A 2WIDA 3AU8A 4YRJA 2QRVA 3TSZA 4DJFC 4PVCA 1I2MA 3D7LA 4DV4B 1Z38A 5CJPA 3BUSA 3DMHA 4UU1A 1U11A 3D2AA 4U7JA 4AL4A 4BFTA 5CYGA 4I55B 1O0BA 1UXJA 1UIMA 3A9CA 2RKWA 4E5SA 4CL2A 3WZ2A 2JAQA 4EVIA 4E5PA 3ZLUA 1GPJA 5AHKA 1Y6ZA 5F2KA 4IPTA 2XQKA 4XQ9A 3EPHA 1ABFA 4B3TB 2EJBA 1E1LA 4UC0A 1TU4A 1W29A 5ALZA 2Q7XA 5L3QA 4TN5A 4P93A 3AF0A 2PGDA 4GT1A 5TPZA 1NF9A 5DBIA 2P2LA 4MPDA 1VKJA 5EERA 4Q12A 1DP4A 1E9DA 4PICA 4E2FA 2FOIA 1KYTA 2NO1A 1BCRA 2F62A 3PJFA 3HWWA 2D4HA 1TVCA 3DE4X 4X1IB 3OIWA 5TARA 4IYRA 1UKBA 1Z2EA 2G1KA 2OZPA 1AGNA 2PKCA 2WWHA 1Y9ZA 3ASZA 4MGKR 4ZODA 2ZANA 1O6ZA 2C5BA 1Z36A 2QR5A 1ZNYA 2IVZA 2BGUA 3E5MA 3EVCA 1RWKA 4R5MA 4X1IA 3ZLBA 4CBVA 1PGQA 1Q7CA 1UDXA 4PZYA 3G2JA 5FTLA 1U99A 4RYLA 3DCIA 3FMVA 1KO7A 5C32A 2A4MA 3FROA 4M1QA 3A6KA 1N8NA 2GYUA 5DBFA 3M33A 1TM7E 1A4IA 1A8HA 4WXEA 3HCCA 1P7WA 1QIJA 1FP2A 1I3CA 1KK2A 2XNKA 3LQRA 1Q7RA 4ZYXA 1XJQA 4WXMA 4M21A 3E9NA 1TJPB 1QH1B 4Q34A 2A1UA 5AO9A 5G3ZA 5AW3A 2C03A 1TKCA 2H1LA 3GBSA 1IBLB 1Z2CA 3NV9A 4NYMR 1R10A 1MKYA 1RVV1 2IYYA 4WOKA 5TT1A 4ERNA 4OM8A 1Z0UA 1FMLA 2C4MA 3QHPA 3GUVA 1QG4A 4MY3A 1KR2A 2GKGA 4KC0A 4EY8A 1KQ3A 1J0AA 5DM60 5J43A 2O14A 1IXZA 4OAPA 3N7AA 9GPBA 3I30X 4JI6B 3ELBA 1T24A 2J6HA 4L07A 3HXOA 2DULA 3FPGA 4U0JA 4FNOA 3EGXA 4ETWA 2VBCA 2I3DA 2CWWA 4OK6A 1WTAA 3LUPA 1SBQA 1L6IA 2VSQA 2YY7A 3FZQA 3GIDA 4YXWD 1QQ6A 2A8YA 1JIQA 1G3UA 3AF1A 1JAIA