2KSIA

Solution nmr structure of sterol carrier protein - 2 from aedes aegypti (aescp-2) complex with c16 fatty acid (palmitate)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Sterol carrier protein 2
publication title Solution NMR structure of Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2) complex with C16 fatty acid (palmitate)
rcsb
source organism Aedes aegypti
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2ksiA00
1C44A 4MY0A 2KSIA 5EBVA 2CG2A 2CFZA 4PDXA 3N7ZA 2NBNA 1IKTA 2KSHA 3BN8A 2CG3A 4AV7A 3CNUA 4JD6A 5EC4A 4JGXA 1QNDA 2I00A 4NURA 2CFUA 5AIJA 1WFRA 5AJLA 3R1KA 3SXNA 2QZTA 5IV0A 2C0LB 4UEIA 3RYOA 3BKRA 4MY3A 3SXOA 2CX7A 3UY5A 5A23A 4AXHA 3BKSA 3BDQA 1PZ4A 2OZGA 2NBMA 2YHEA 2HV2A 4QB9A
chains in the Genus database with same CATH superfamily
3SSNA 1C44A 4MY0A 2KSIA 5EBVA 2CG2A 2CFZA 4PDXA 3N7ZA 2NBNA 1IKTA 2KSHA 3BN8A 2CG3A 4NSSA 4AV7A 3CNUA 4JD6A 5EC4A 3SSMA 4JGXA 3SSOA 1QNDA 2I00A 4NURA 2CFUA 5AIJA 1WFRA 5AJLA 2NSGA 3R1KA 2QZTA 3SXNA 5IV0A 2C0LB 4UEIA 3RYOA 3BKRA 4MY3A 3SXOA 2CX7A 3UY5A 5A23A 2NSFA 4AXHA 3BKSA 3BDQA 1PZ4A 2OZGA 2NBMA 2YHEA 2HV2A 4ZY7A 4QB9A
chains in the Genus database with same CATH topology
1C44A 4MY0A 2KSIA 5EBVA 2CG2A 2CFZA 4PDXA 3N7ZA 2NBNA 1IKTA 2KSHA 3BN8A 2CG3A 4AV7A 3CNUA 4JD6A 5EC4A 4JGXA 1QNDA 2I00A 4NURA 2CFUA 5AIJA 1WFRA 5AJLA 3R1KA 3SXNA 2QZTA 5IV0A 2C0LB 4UEIA 3RYOA 3BKRA 4MY3A 3SXOA 2CX7A 3UY5A 5A23A 4AXHA 3BKSA 3BDQA 1PZ4A 2OZGA 2NBMA 2YHEA 2HV2A 4QB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C44 A;  4MY0 A;  2KSI A;  5EBV A;  2CG2 A;  2CFZ A;  4PDX A;  3N7Z A;  2NBN A;  1IKT A;  2KSH A;  3BN8 A;  2CG3 A;  4AV7 A;  3CNU A;  4JD6 A;  5EC4 A;  4JGX A;  1QND A;  2I00 A;  4NUR A;  2CFU A;  5AIJ A;  1WFR A;  5AJL A;  3R1K A;  3SXN A;  2QZT A;  5IV0 A;  2C0L B;  4UEI A;  3RYO A;  3BKR A;  4MY3 A;  3SXO A;  2CX7 A;  3UY5 A;  5A23 A;  4AXH A;  3BKS A;  3BDQ A;  1PZ4 A;  2OZG A;  2NBM A;  2YHE A;  2HV2 A;  4QB9 A; 
#chains in the Genus database with same CATH topology
 3SSN A;  1C44 A;  4MY0 A;  2KSI A;  5EBV A;  2CG2 A;  2CFZ A;  4PDX A;  3N7Z A;  2NBN A;  1IKT A;  2KSH A;  3BN8 A;  2CG3 A;  4NSS A;  4AV7 A;  3CNU A;  4JD6 A;  5EC4 A;  3SSM A;  4JGX A;  3SSO A;  1QND A;  2I00 A;  4NUR A;  2CFU A;  5AIJ A;  1WFR A;  5AJL A;  2NSG A;  3R1K A;  2QZT A;  3SXN A;  5IV0 A;  2C0L B;  4UEI A;  3RYO A;  3BKR A;  4MY3 A;  3SXO A;  2CX7 A;  3UY5 A;  5A23 A;  2NSF A;  4AXH A;  3BKS A;  3BDQ A;  1PZ4 A;  2OZG A;  2NBM A;  2YHE A;  2HV2 A;  4ZY7 A;  4QB9 A; 
#chains in the Genus database with same CATH homology
 1C44 A;  4MY0 A;  2KSI A;  5EBV A;  2CG2 A;  2CFZ A;  4PDX A;  3N7Z A;  2NBN A;  1IKT A;  2KSH A;  3BN8 A;  2CG3 A;  4AV7 A;  3CNU A;  4JD6 A;  5EC4 A;  4JGX A;  1QND A;  2I00 A;  4NUR A;  2CFU A;  5AIJ A;  1WFR A;  5AJL A;  3R1K A;  3SXN A;  2QZT A;  5IV0 A;  2C0L B;  4UEI A;  3RYO A;  3BKR A;  4MY3 A;  3SXO A;  2CX7 A;  3UY5 A;  5A23 A;  4AXH A;  3BKS A;  3BDQ A;  1PZ4 A;  2OZG A;  2NBM A;  2YHE A;  2HV2 A;  4QB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...