2KSIA

Solution nmr structure of sterol carrier protein - 2 from aedes aegypti (aescp-2) complex with c16 fatty acid (palmitate)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
b'MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2
publication title Solution NMR structure of Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2) complex with C16 fatty acid (palmitate)
rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2ksiA00
3UY5A 5AIJA 1WFRA 2KSIA 2CG3A 2KSHA 3CNUA 3N7ZA 3BDQA 3BKSA 3RYOA 2OZGA 3R1KA 4MY0A 4QB9A 5A23A 4UEIA 3SXOA 2I00A 2C0LB 4AXHA 4AV7A 2HV2A 2QZTA 5EBVA 1PZ4A 3BKRA 2CFUA 2CX7A 2CG2A 2YHEA 2NBNA 1IKTA 4PDXA 5IV0A 1C44A 5AJLA 3BN8A 4JD6A 4NURA 4MY3A 5EC4A 3SXNA 1QNDA 2CFZA 4JGXA 2NBMA
chains in the Genus database with same CATH superfamily
3SSMA 3UY5A 5AIJA 1WFRA 2KSIA 2CG3A 2KSHA 3CNUA 3N7ZA 3BDQA 3BKSA 3RYOA 2OZGA 2NSGA 3R1KA 4MY0A 4QB9A 5A23A 4UEIA 3SXOA 2I00A 2C0LB 4AXHA 4AV7A 2HV2A 2QZTA 5EBVA 1PZ4A 4NSSA 3BKRA 2CFUA 2CX7A 3SSOA 2CG2A 4ZY7A 2YHEA 2NSFA 2NBNA 1IKTA 4PDXA 5IV0A 1C44A 5AJLA 3BN8A 4JD6A 4NURA 4MY3A 5EC4A 3SXNA 1QNDA 2CFZA 3SSNA 4JGXA 2NBMA
chains in the Genus database with same CATH topology
3UY5A 5AIJA 1WFRA 2KSIA 2CG3A 2KSHA 3CNUA 3N7ZA 3BDQA 3BKSA 3RYOA 2OZGA 3R1KA 4MY0A 4QB9A 5A23A 4UEIA 3SXOA 2I00A 2C0LB 4AXHA 4AV7A 2HV2A 2QZTA 5EBVA 1PZ4A 3BKRA 2CFUA 2CX7A 2CG2A 2YHEA 2NBNA 1IKTA 4PDXA 5IV0A 1C44A 5AJLA 3BN8A 4JD6A 4NURA 4MY3A 5EC4A 3SXNA 1QNDA 2CFZA 4JGXA 2NBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UY5 A;  5AIJ A;  1WFR A;  2KSI A;  2CG3 A;  2KSH A;  3CNU A;  3N7Z A;  3BDQ A;  3BKS A;  3RYO A;  2OZG A;  3R1K A;  4MY0 A;  4QB9 A;  5A23 A;  4UEI A;  3SXO A;  2I00 A;  2C0L B;  4AXH A;  4AV7 A;  2HV2 A;  2QZT A;  5EBV A;  1PZ4 A;  3BKR A;  2CFU A;  2CX7 A;  2CG2 A;  2YHE A;  2NBN A;  1IKT A;  4PDX A;  5IV0 A;  1C44 A;  5AJL A;  3BN8 A;  4JD6 A;  4NUR A;  4MY3 A;  5EC4 A;  3SXN A;  1QND A;  2CFZ A;  4JGX A;  2NBM A; 
#chains in the Genus database with same CATH topology
 3SSM A;  3UY5 A;  5AIJ A;  1WFR A;  2KSI A;  2CG3 A;  2KSH A;  3CNU A;  3N7Z A;  3BDQ A;  3BKS A;  3RYO A;  2OZG A;  2NSG A;  3R1K A;  4MY0 A;  4QB9 A;  5A23 A;  4UEI A;  3SXO A;  2I00 A;  2C0L B;  4AXH A;  4AV7 A;  2HV2 A;  2QZT A;  5EBV A;  1PZ4 A;  4NSS A;  3BKR A;  2CFU A;  2CX7 A;  3SSO A;  2CG2 A;  4ZY7 A;  2YHE A;  2NSF A;  2NBN A;  1IKT A;  4PDX A;  5IV0 A;  1C44 A;  5AJL A;  3BN8 A;  4JD6 A;  4NUR A;  4MY3 A;  5EC4 A;  3SXN A;  1QND A;  2CFZ A;  3SSN A;  4JGX A;  2NBM A; 
#chains in the Genus database with same CATH homology
 3UY5 A;  5AIJ A;  1WFR A;  2KSI A;  2CG3 A;  2KSH A;  3CNU A;  3N7Z A;  3BDQ A;  3BKS A;  3RYO A;  2OZG A;  3R1K A;  4MY0 A;  4QB9 A;  5A23 A;  4UEI A;  3SXO A;  2I00 A;  2C0L B;  4AXH A;  4AV7 A;  2HV2 A;  2QZT A;  5EBV A;  1PZ4 A;  3BKR A;  2CFU A;  2CX7 A;  2CG2 A;  2YHE A;  2NBN A;  1IKT A;  4PDX A;  5IV0 A;  1C44 A;  5AJL A;  3BN8 A;  4JD6 A;  4NUR A;  4MY3 A;  5EC4 A;  3SXN A;  1QND A;  2CFZ A;  4JGX A;  2NBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...