2KSIA

Solution nmr structure of sterol carrier protein - 2 from aedes aegypti (aescp-2) complex with c16 fatty acid (palmitate)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2) complex with C16 fatty acid (palmitate)
rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords Sterol carrier protein 2
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2ksiA00
2CX7A 1WFRA 3BDQA 3BN8A 2NBNA 4AV7A 2NBMA 4MY3A 4UEIA 2CG3A 2CG2A 2CFUA 1C44A 5EC4A 3BKSA 4NURA 5A23A 3N7ZA 3SXNA 3UY5A 2KSIA 5EBVA 2YHEA 1PZ4A 2OZGA 1QNDA 2C0LB 3SXOA 4JD6A 4AXHA 3BKRA 2CFZA 5IV0A 1IKTA 2KSHA 4QB9A 2QZTA 3R1KA 4MY0A 2HV2A 2I00A 4JGXA 4PDXA 5AIJA 3CNUA 5AJLA 3RYOA
chains in the Genus database with same CATH superfamily
3SSOA 2CX7A 1WFRA 3BDQA 3BN8A 2NBNA 4AV7A 2NBMA 4MY3A 4UEIA 2CG3A 2CG2A 2CFUA 1C44A 3SSNA 4ZY7A 5EC4A 3BKSA 4NURA 5A23A 3N7ZA 3SXNA 3UY5A 2KSIA 5EBVA 2YHEA 1PZ4A 2NSFA 1QNDA 2C0LB 2OZGA 4NSSA 3SXOA 4JD6A 4AXHA 3BKRA 2CFZA 5IV0A 1IKTA 2KSHA 4QB9A 2QZTA 3R1KA 4MY0A 2HV2A 2I00A 4JGXA 4PDXA 5AIJA 3CNUA 5AJLA 3SSMA 3RYOA 2NSGA
chains in the Genus database with same CATH topology
2CX7A 1WFRA 3BDQA 3BN8A 2NBNA 4AV7A 2NBMA 4MY3A 4UEIA 2CG3A 2CG2A 2CFUA 1C44A 5EC4A 3BKSA 4NURA 5A23A 3N7ZA 3SXNA 3UY5A 2KSIA 5EBVA 2YHEA 1PZ4A 2OZGA 1QNDA 2C0LB 3SXOA 4JD6A 4AXHA 3BKRA 2CFZA 5IV0A 1IKTA 2KSHA 4QB9A 2QZTA 3R1KA 4MY0A 2HV2A 2I00A 4JGXA 4PDXA 5AIJA 3CNUA 5AJLA 3RYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX7 A;  1WFR A;  3BDQ A;  3BN8 A;  2NBN A;  4AV7 A;  2NBM A;  4MY3 A;  4UEI A;  2CG3 A;  2CG2 A;  2CFU A;  1C44 A;  5EC4 A;  3BKS A;  4NUR A;  5A23 A;  3N7Z A;  3SXN A;  3UY5 A;  2KSI A;  5EBV A;  2YHE A;  1PZ4 A;  2OZG A;  1QND A;  2C0L B;  3SXO A;  4JD6 A;  4AXH A;  3BKR A;  2CFZ A;  5IV0 A;  1IKT A;  2KSH A;  4QB9 A;  2QZT A;  3R1K A;  4MY0 A;  2HV2 A;  2I00 A;  4JGX A;  4PDX A;  5AIJ A;  3CNU A;  5AJL A;  3RYO A; 
#chains in the Genus database with same CATH topology
 3SSO A;  2CX7 A;  1WFR A;  3BDQ A;  3BN8 A;  2NBN A;  4AV7 A;  2NBM A;  4MY3 A;  4UEI A;  2CG3 A;  2CG2 A;  2CFU A;  1C44 A;  3SSN A;  4ZY7 A;  5EC4 A;  3BKS A;  4NUR A;  5A23 A;  3N7Z A;  3SXN A;  3UY5 A;  2KSI A;  5EBV A;  2YHE A;  1PZ4 A;  2NSF A;  1QND A;  2C0L B;  2OZG A;  4NSS A;  3SXO A;  4JD6 A;  4AXH A;  3BKR A;  2CFZ A;  5IV0 A;  1IKT A;  2KSH A;  4QB9 A;  2QZT A;  3R1K A;  4MY0 A;  2HV2 A;  2I00 A;  4JGX A;  4PDX A;  5AIJ A;  3CNU A;  5AJL A;  3SSM A;  3RYO A;  2NSG A; 
#chains in the Genus database with same CATH homology
 2CX7 A;  1WFR A;  3BDQ A;  3BN8 A;  2NBN A;  4AV7 A;  2NBM A;  4MY3 A;  4UEI A;  2CG3 A;  2CG2 A;  2CFU A;  1C44 A;  5EC4 A;  3BKS A;  4NUR A;  5A23 A;  3N7Z A;  3SXN A;  3UY5 A;  2KSI A;  5EBV A;  2YHE A;  1PZ4 A;  2OZG A;  1QND A;  2C0L B;  3SXO A;  4JD6 A;  4AXH A;  3BKR A;  2CFZ A;  5IV0 A;  1IKT A;  2KSH A;  4QB9 A;  2QZT A;  3R1K A;  4MY0 A;  2HV2 A;  2I00 A;  4JGX A;  4PDX A;  5AIJ A;  3CNU A;  5AJL A;  3RYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...