2KSIA

Solution nmr structure of sterol carrier protein - 2 from aedes aegypti (aescp-2) complex with c16 fatty acid (palmitate)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2) complex with C16 fatty acid (palmitate)
rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords Sterol carrier protein 2
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2ksiA00
5EC4A 5EBVA 4PDXA 4QB9A 1PZ4A 2NBMA 2HV2A 5AIJA 1IKTA 2KSIA 2QZTA 3SXNA 4MY3A 2CFZA 2I00A 4JGXA 3RYOA 2CX7A 3BKRA 4UEIA 3SXOA 5IV0A 2YHEA 5A23A 3BN8A 2NBNA 2CG3A 1C44A 3BKSA 3BDQA 1WFRA 4NURA 3R1KA 2KSHA 2CG2A 5AJLA 2C0LB 4MY0A 4AV7A 3UY5A 4AXHA 3CNUA 3N7ZA 2OZGA 1QNDA 4JD6A 2CFUA
chains in the Genus database with same CATH superfamily
5EC4A 3SSNA 5EBVA 4PDXA 4QB9A 1PZ4A 2NBMA 2HV2A 5AIJA 1IKTA 2KSIA 2QZTA 3SXNA 4MY3A 2CFZA 2I00A 3SSOA 4ZY7A 4JGXA 3RYOA 2CX7A 3BKRA 4UEIA 3SXOA 5IV0A 2YHEA 5A23A 3BN8A 2NBNA 2CG3A 1C44A 3BKSA 3BDQA 1WFRA 4NURA 3R1KA 2KSHA 2CG2A 5AJLA 2C0LB 2NSFA 4MY0A 3SSMA 4AV7A 3UY5A 4AXHA 2NSGA 3CNUA 4NSSA 3N7ZA 2OZGA 1QNDA 4JD6A 2CFUA
chains in the Genus database with same CATH topology
5EC4A 5EBVA 4PDXA 4QB9A 1PZ4A 2NBMA 2HV2A 5AIJA 1IKTA 2KSIA 2QZTA 3SXNA 4MY3A 2CFZA 2I00A 4JGXA 3RYOA 2CX7A 3BKRA 4UEIA 3SXOA 5IV0A 2YHEA 5A23A 3BN8A 2NBNA 2CG3A 1C44A 3BKSA 3BDQA 1WFRA 4NURA 3R1KA 2KSHA 2CG2A 5AJLA 2C0LB 4MY0A 4AV7A 3UY5A 4AXHA 3CNUA 3N7ZA 2OZGA 1QNDA 4JD6A 2CFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC4 A;  5EBV A;  4PDX A;  4QB9 A;  1PZ4 A;  2NBM A;  2HV2 A;  5AIJ A;  1IKT A;  2KSI A;  2QZT A;  3SXN A;  4MY3 A;  2CFZ A;  2I00 A;  4JGX A;  3RYO A;  2CX7 A;  3BKR A;  4UEI A;  3SXO A;  5IV0 A;  2YHE A;  5A23 A;  3BN8 A;  2NBN A;  2CG3 A;  1C44 A;  3BKS A;  3BDQ A;  1WFR A;  4NUR A;  3R1K A;  2KSH A;  2CG2 A;  5AJL A;  2C0L B;  4MY0 A;  4AV7 A;  3UY5 A;  4AXH A;  3CNU A;  3N7Z A;  2OZG A;  1QND A;  4JD6 A;  2CFU A; 
#chains in the Genus database with same CATH topology
 5EC4 A;  3SSN A;  5EBV A;  4PDX A;  4QB9 A;  1PZ4 A;  2NBM A;  2HV2 A;  5AIJ A;  1IKT A;  2KSI A;  2QZT A;  3SXN A;  4MY3 A;  2CFZ A;  2I00 A;  3SSO A;  4ZY7 A;  4JGX A;  3RYO A;  2CX7 A;  3BKR A;  4UEI A;  3SXO A;  5IV0 A;  2YHE A;  5A23 A;  3BN8 A;  2NBN A;  2CG3 A;  1C44 A;  3BKS A;  3BDQ A;  1WFR A;  4NUR A;  3R1K A;  2KSH A;  2CG2 A;  5AJL A;  2C0L B;  2NSF A;  4MY0 A;  3SSM A;  4AV7 A;  3UY5 A;  4AXH A;  2NSG A;  3CNU A;  4NSS A;  3N7Z A;  2OZG A;  1QND A;  4JD6 A;  2CFU A; 
#chains in the Genus database with same CATH homology
 5EC4 A;  5EBV A;  4PDX A;  4QB9 A;  1PZ4 A;  2NBM A;  2HV2 A;  5AIJ A;  1IKT A;  2KSI A;  2QZT A;  3SXN A;  4MY3 A;  2CFZ A;  2I00 A;  4JGX A;  3RYO A;  2CX7 A;  3BKR A;  4UEI A;  3SXO A;  5IV0 A;  2YHE A;  5A23 A;  3BN8 A;  2NBN A;  2CG3 A;  1C44 A;  3BKS A;  3BDQ A;  1WFR A;  4NUR A;  3R1K A;  2KSH A;  2CG2 A;  5AJL A;  2C0L B;  4MY0 A;  4AV7 A;  3UY5 A;  4AXH A;  3CNU A;  3N7Z A;  2OZG A;  1QND A;  4JD6 A;  2CFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...