3BN8A

Crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
b'HHHMSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGYYFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKFQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sterol carrier protein 2
publication title Crystal structure of putative sterol carrier protein 2 (2649030) from Archaeoglobus fulgidus at 2.11 A resolution
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Transport protein
total genus 28
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bn8A00
5IV0A 2HV2A 4AXHA 5AJLA 1QNDA 5AIJA 1C44A 2I00A 3BDQA 4PDXA 2CG3A 2CX7A 3N7ZA 5EBVA 3CNUA 4MY3A 2CFZA 4JGXA 1WFRA 2CG2A 3UY5A 2NBNA 5A23A 2NBMA 2KSIA 4QB9A 1PZ4A 4MY0A 4AV7A 3R1KA 3SXNA 3SXOA 3BKSA 2C0LB 3RYOA 2OZGA 2CFUA 4UEIA 3BKRA 2KSHA 4NURA 3BN8A 4JD6A 1IKTA 5EC4A 2QZTA 2YHEA
chains in the Genus database with same CATH superfamily
5IV0A 2HV2A 4AXHA 5AJLA 1QNDA 3SSNA 5AIJA 4ZY7A 1C44A 2I00A 3BDQA 4PDXA 2NSFA 2CX7A 2CG3A 3N7ZA 5EBVA 3CNUA 4MY3A 2CFZA 4NSSA 4JGXA 1WFRA 2CG2A 3UY5A 2NBNA 5A23A 2NBMA 2KSIA 4QB9A 1PZ4A 4MY0A 3SSOA 4AV7A 3R1KA 3SXNA 3SXOA 3BKSA 2C0LB 3RYOA 2OZGA 2CFUA 4UEIA 3SSMA 3BKRA 2KSHA 4NURA 3BN8A 4JD6A 2NSGA 1IKTA 5EC4A 2QZTA 2YHEA
chains in the Genus database with same CATH topology
5IV0A 2HV2A 4AXHA 5AJLA 1QNDA 5AIJA 1C44A 2I00A 3BDQA 4PDXA 2CG3A 2CX7A 3N7ZA 5EBVA 3CNUA 4MY3A 2CFZA 4JGXA 1WFRA 2CG2A 3UY5A 2NBNA 5A23A 2NBMA 2KSIA 4QB9A 1PZ4A 4MY0A 4AV7A 3R1KA 3SXNA 3SXOA 3BKSA 2C0LB 3RYOA 2OZGA 2CFUA 4UEIA 3BKRA 2KSHA 4NURA 3BN8A 4JD6A 1IKTA 5EC4A 2QZTA 2YHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV0 A;  2HV2 A;  4AXH A;  5AJL A;  1QND A;  5AIJ A;  1C44 A;  2I00 A;  3BDQ A;  4PDX A;  2CG3 A;  2CX7 A;  3N7Z A;  5EBV A;  3CNU A;  4MY3 A;  2CFZ A;  4JGX A;  1WFR A;  2CG2 A;  3UY5 A;  2NBN A;  5A23 A;  2NBM A;  2KSI A;  4QB9 A;  1PZ4 A;  4MY0 A;  4AV7 A;  3R1K A;  3SXN A;  3SXO A;  3BKS A;  2C0L B;  3RYO A;  2OZG A;  2CFU A;  4UEI A;  3BKR A;  2KSH A;  4NUR A;  3BN8 A;  4JD6 A;  1IKT A;  5EC4 A;  2QZT A;  2YHE A; 
#chains in the Genus database with same CATH topology
 5IV0 A;  2HV2 A;  4AXH A;  5AJL A;  1QND A;  3SSN A;  5AIJ A;  4ZY7 A;  1C44 A;  2I00 A;  3BDQ A;  4PDX A;  2NSF A;  2CX7 A;  2CG3 A;  3N7Z A;  5EBV A;  3CNU A;  4MY3 A;  2CFZ A;  4NSS A;  4JGX A;  1WFR A;  2CG2 A;  3UY5 A;  2NBN A;  5A23 A;  2NBM A;  2KSI A;  4QB9 A;  1PZ4 A;  4MY0 A;  3SSO A;  4AV7 A;  3R1K A;  3SXN A;  3SXO A;  3BKS A;  2C0L B;  3RYO A;  2OZG A;  2CFU A;  4UEI A;  3SSM A;  3BKR A;  2KSH A;  4NUR A;  3BN8 A;  4JD6 A;  2NSG A;  1IKT A;  5EC4 A;  2QZT A;  2YHE A; 
#chains in the Genus database with same CATH homology
 5IV0 A;  2HV2 A;  4AXH A;  5AJL A;  1QND A;  5AIJ A;  1C44 A;  2I00 A;  3BDQ A;  4PDX A;  2CG3 A;  2CX7 A;  3N7Z A;  5EBV A;  3CNU A;  4MY3 A;  2CFZ A;  4JGX A;  1WFR A;  2CG2 A;  3UY5 A;  2NBN A;  5A23 A;  2NBM A;  2KSI A;  4QB9 A;  1PZ4 A;  4MY0 A;  4AV7 A;  3R1K A;  3SXN A;  3SXO A;  3BKS A;  2C0L B;  3RYO A;  2OZG A;  2CFU A;  4UEI A;  3BKR A;  2KSH A;  4NUR A;  3BN8 A;  4JD6 A;  1IKT A;  5EC4 A;  2QZT A;  2YHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...