3BN8A

Crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
HHHMSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGYYFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKFQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sterol carrier protein 2
publication title Crystal structure of putative sterol carrier protein 2 (2649030) from Archaeoglobus fulgidus at 2.11 A resolution
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Transport protein
total genus 28
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bn8A00
1QNDA 2CFZA 2NBMA 2NBNA 3BKSA 3CNUA 2CG3A 4PDXA 4MY3A 5A23A 4MY0A 3UY5A 1PZ4A 3BKRA 3SXNA 2CFUA 1IKTA 1C44A 4NURA 4AV7A 4JD6A 3BDQA 4AXHA 2KSHA 2KSIA 5EC4A 5AJLA 5EBVA 2HV2A 5IV0A 2CG2A 3N7ZA 3R1KA 4JGXA 3RYOA 2OZGA 2CX7A 3SXOA 1WFRA 2YHEA 2C0LB 2QZTA 3BN8A 5AIJA 2I00A 4UEIA 4QB9A
chains in the Genus database with same CATH superfamily
3SSOA 1QNDA 2CFZA 2NBMA 2NBNA 2NSGA 3BKSA 3CNUA 2CG3A 4PDXA 4MY3A 5A23A 4MY0A 3UY5A 1PZ4A 3BKRA 3SXNA 2CFUA 1IKTA 1C44A 4NURA 4AV7A 4JD6A 3BDQA 4AXHA 2KSHA 2KSIA 5EC4A 5AJLA 4NSSA 5EBVA 2HV2A 5IV0A 2CG2A 3N7ZA 3R1KA 4JGXA 3RYOA 2OZGA 3SSMA 2CX7A 3SXOA 4ZY7A 1WFRA 2YHEA 2C0LB 2NSFA 2QZTA 3BN8A 5AIJA 2I00A 3SSNA 4UEIA 4QB9A
chains in the Genus database with same CATH topology
1QNDA 2CFZA 2NBMA 2NBNA 3BKSA 3CNUA 2CG3A 4PDXA 4MY3A 5A23A 4MY0A 3UY5A 1PZ4A 3BKRA 3SXNA 2CFUA 1IKTA 1C44A 4NURA 4AV7A 4JD6A 3BDQA 4AXHA 2KSHA 2KSIA 5EC4A 5AJLA 5EBVA 2HV2A 5IV0A 2CG2A 3N7ZA 3R1KA 4JGXA 3RYOA 2OZGA 2CX7A 3SXOA 1WFRA 2YHEA 2C0LB 2QZTA 3BN8A 5AIJA 2I00A 4UEIA 4QB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QND A;  2CFZ A;  2NBM A;  2NBN A;  3BKS A;  3CNU A;  2CG3 A;  4PDX A;  4MY3 A;  5A23 A;  4MY0 A;  3UY5 A;  1PZ4 A;  3BKR A;  3SXN A;  2CFU A;  1IKT A;  1C44 A;  4NUR A;  4AV7 A;  4JD6 A;  3BDQ A;  4AXH A;  2KSH A;  2KSI A;  5EC4 A;  5AJL A;  5EBV A;  2HV2 A;  5IV0 A;  2CG2 A;  3N7Z A;  3R1K A;  4JGX A;  3RYO A;  2OZG A;  2CX7 A;  3SXO A;  1WFR A;  2YHE A;  2C0L B;  2QZT A;  3BN8 A;  5AIJ A;  2I00 A;  4UEI A;  4QB9 A; 
#chains in the Genus database with same CATH topology
 3SSO A;  1QND A;  2CFZ A;  2NBM A;  2NBN A;  2NSG A;  3BKS A;  3CNU A;  2CG3 A;  4PDX A;  4MY3 A;  5A23 A;  4MY0 A;  3UY5 A;  1PZ4 A;  3BKR A;  3SXN A;  2CFU A;  1IKT A;  1C44 A;  4NUR A;  4AV7 A;  4JD6 A;  3BDQ A;  4AXH A;  2KSH A;  2KSI A;  5EC4 A;  5AJL A;  4NSS A;  5EBV A;  2HV2 A;  5IV0 A;  2CG2 A;  3N7Z A;  3R1K A;  4JGX A;  3RYO A;  2OZG A;  3SSM A;  2CX7 A;  3SXO A;  4ZY7 A;  1WFR A;  2YHE A;  2C0L B;  2NSF A;  2QZT A;  3BN8 A;  5AIJ A;  2I00 A;  3SSN A;  4UEI A;  4QB9 A; 
#chains in the Genus database with same CATH homology
 1QND A;  2CFZ A;  2NBM A;  2NBN A;  3BKS A;  3CNU A;  2CG3 A;  4PDX A;  4MY3 A;  5A23 A;  4MY0 A;  3UY5 A;  1PZ4 A;  3BKR A;  3SXN A;  2CFU A;  1IKT A;  1C44 A;  4NUR A;  4AV7 A;  4JD6 A;  3BDQ A;  4AXH A;  2KSH A;  2KSI A;  5EC4 A;  5AJL A;  5EBV A;  2HV2 A;  5IV0 A;  2CG2 A;  3N7Z A;  3R1K A;  4JGX A;  3RYO A;  2OZG A;  2CX7 A;  3SXO A;  1WFR A;  2YHE A;  2C0L B;  2QZT A;  3BN8 A;  5AIJ A;  2I00 A;  4UEI A;  4QB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...