3BN8A

Crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
HHHMSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGYYFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKFQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative sterol carrier protein 2 (2649030) from Archaeoglobus fulgidus at 2.11 A resolution
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Transport protein
molecule keywords Putative sterol carrier protein 2
total genus 28
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bn8A00
2I00A 4MY0A 4AXHA 2NBNA 3UY5A 5A23A 5AJLA 2QZTA 2CG2A 4QB9A 3N7ZA 3RYOA 2CX7A 4MY3A 2OZGA 1IKTA 3R1KA 2KSIA 3BKSA 4JGXA 4NURA 1WFRA 1QNDA 5EBVA 2C0LB 4UEIA 2CG3A 5EC4A 3CNUA 2HV2A 4AV7A 1PZ4A 2KSHA 3BDQA 3SXOA 5AIJA 4JD6A 3BKRA 3SXNA 5IV0A 2NBMA 3BN8A 4PDXA 1C44A 2CFZA 2YHEA 2CFUA
chains in the Genus database with same CATH superfamily
2I00A 4MY0A 4AXHA 2NBNA 3UY5A 5A23A 5AJLA 2QZTA 2CG2A 4QB9A 3N7ZA 3RYOA 3SSOA 2NSFA 2CX7A 4MY3A 2OZGA 1IKTA 3R1KA 2KSIA 3BKSA 4JGXA 3SSNA 4NURA 2NSGA 1WFRA 4ZY7A 1QNDA 5EBVA 2C0LB 4UEIA 2CG3A 5EC4A 3CNUA 2HV2A 4AV7A 1PZ4A 2KSHA 3BDQA 3SXOA 5AIJA 4JD6A 3BKRA 3SXNA 5IV0A 2NBMA 3BN8A 4PDXA 1C44A 2CFZA 3SSMA 2YHEA 4NSSA 2CFUA
chains in the Genus database with same CATH topology
2I00A 4MY0A 4AXHA 2NBNA 3UY5A 5A23A 5AJLA 2QZTA 2CG2A 4QB9A 3N7ZA 3RYOA 2CX7A 4MY3A 2OZGA 1IKTA 3R1KA 2KSIA 3BKSA 4JGXA 4NURA 1WFRA 1QNDA 5EBVA 2C0LB 4UEIA 2CG3A 5EC4A 3CNUA 2HV2A 4AV7A 1PZ4A 2KSHA 3BDQA 3SXOA 5AIJA 4JD6A 3BKRA 3SXNA 5IV0A 2NBMA 3BN8A 4PDXA 1C44A 2CFZA 2YHEA 2CFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I00 A;  4MY0 A;  4AXH A;  2NBN A;  3UY5 A;  5A23 A;  5AJL A;  2QZT A;  2CG2 A;  4QB9 A;  3N7Z A;  3RYO A;  2CX7 A;  4MY3 A;  2OZG A;  1IKT A;  3R1K A;  2KSI A;  3BKS A;  4JGX A;  4NUR A;  1WFR A;  1QND A;  5EBV A;  2C0L B;  4UEI A;  2CG3 A;  5EC4 A;  3CNU A;  2HV2 A;  4AV7 A;  1PZ4 A;  2KSH A;  3BDQ A;  3SXO A;  5AIJ A;  4JD6 A;  3BKR A;  3SXN A;  5IV0 A;  2NBM A;  3BN8 A;  4PDX A;  1C44 A;  2CFZ A;  2YHE A;  2CFU A; 
#chains in the Genus database with same CATH topology
 2I00 A;  4MY0 A;  4AXH A;  2NBN A;  3UY5 A;  5A23 A;  5AJL A;  2QZT A;  2CG2 A;  4QB9 A;  3N7Z A;  3RYO A;  3SSO A;  2NSF A;  2CX7 A;  4MY3 A;  2OZG A;  1IKT A;  3R1K A;  2KSI A;  3BKS A;  4JGX A;  3SSN A;  4NUR A;  2NSG A;  1WFR A;  4ZY7 A;  1QND A;  5EBV A;  2C0L B;  4UEI A;  2CG3 A;  5EC4 A;  3CNU A;  2HV2 A;  4AV7 A;  1PZ4 A;  2KSH A;  3BDQ A;  3SXO A;  5AIJ A;  4JD6 A;  3BKR A;  3SXN A;  5IV0 A;  2NBM A;  3BN8 A;  4PDX A;  1C44 A;  2CFZ A;  3SSM A;  2YHE A;  4NSS A;  2CFU A; 
#chains in the Genus database with same CATH homology
 2I00 A;  4MY0 A;  4AXH A;  2NBN A;  3UY5 A;  5A23 A;  5AJL A;  2QZT A;  2CG2 A;  4QB9 A;  3N7Z A;  3RYO A;  2CX7 A;  4MY3 A;  2OZG A;  1IKT A;  3R1K A;  2KSI A;  3BKS A;  4JGX A;  4NUR A;  1WFR A;  1QND A;  5EBV A;  2C0L B;  4UEI A;  2CG3 A;  5EC4 A;  3CNU A;  2HV2 A;  4AV7 A;  1PZ4 A;  2KSH A;  3BDQ A;  3SXO A;  5AIJ A;  4JD6 A;  3BKR A;  3SXN A;  5IV0 A;  2NBM A;  3BN8 A;  4PDX A;  1C44 A;  2CFZ A;  2YHE A;  2CFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...