3BN8A

Crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
HHHMSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGYYFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKFQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative sterol carrier protein 2 (2649030) from Archaeoglobus fulgidus at 2.11 A resolution
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Transport protein
molecule keywords Putative sterol carrier protein 2
total genus 28
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bn8A00
2QZTA 3CNUA 3N7ZA 4PDXA 2KSHA 2KSIA 2CX7A 3BN8A 5EBVA 5A23A 2OZGA 1PZ4A 3BKSA 4AV7A 4NURA 2HV2A 1C44A 3R1KA 5AJLA 5AIJA 4QB9A 3BDQA 3BKRA 2CFUA 2CFZA 4AXHA 4MY0A 2NBNA 5EC4A 2C0LB 2I00A 3UY5A 1QNDA 3RYOA 2NBMA 4JGXA 1IKTA 4MY3A 2YHEA 3SXNA 4UEIA 5IV0A 2CG3A 4JD6A 3SXOA 1WFRA 2CG2A
chains in the Genus database with same CATH superfamily
2QZTA 3CNUA 3N7ZA 4PDXA 2KSHA 3SSOA 2KSIA 2CX7A 3BN8A 5EBVA 5A23A 2OZGA 1PZ4A 3BKSA 4AV7A 4NURA 2HV2A 1C44A 3R1KA 5AJLA 4ZY7A 4QB9A 5AIJA 3BDQA 3BKRA 2CFUA 2NSFA 2CFZA 4AXHA 4MY0A 2NBNA 5EC4A 2C0LB 4NSSA 2I00A 3SSMA 3UY5A 1QNDA 3RYOA 2NBMA 4JGXA 1IKTA 4MY3A 2YHEA 3SXNA 4UEIA 5IV0A 2CG3A 4JD6A 3SSNA 3SXOA 2NSGA 1WFRA 2CG2A
chains in the Genus database with same CATH topology
2QZTA 3CNUA 3N7ZA 4PDXA 2KSHA 2KSIA 2CX7A 3BN8A 5EBVA 5A23A 2OZGA 1PZ4A 3BKSA 4AV7A 4NURA 2HV2A 1C44A 3R1KA 5AJLA 5AIJA 4QB9A 3BDQA 3BKRA 2CFUA 2CFZA 4AXHA 4MY0A 2NBNA 5EC4A 2C0LB 2I00A 3UY5A 1QNDA 3RYOA 2NBMA 4JGXA 1IKTA 4MY3A 2YHEA 3SXNA 4UEIA 5IV0A 2CG3A 4JD6A 3SXOA 1WFRA 2CG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZT A;  3CNU A;  3N7Z A;  4PDX A;  2KSH A;  2KSI A;  2CX7 A;  3BN8 A;  5EBV A;  5A23 A;  2OZG A;  1PZ4 A;  3BKS A;  4AV7 A;  4NUR A;  2HV2 A;  1C44 A;  3R1K A;  5AJL A;  5AIJ A;  4QB9 A;  3BDQ A;  3BKR A;  2CFU A;  2CFZ A;  4AXH A;  4MY0 A;  2NBN A;  5EC4 A;  2C0L B;  2I00 A;  3UY5 A;  1QND A;  3RYO A;  2NBM A;  4JGX A;  1IKT A;  4MY3 A;  2YHE A;  3SXN A;  4UEI A;  5IV0 A;  2CG3 A;  4JD6 A;  3SXO A;  1WFR A;  2CG2 A; 
#chains in the Genus database with same CATH topology
 2QZT A;  3CNU A;  3N7Z A;  4PDX A;  2KSH A;  3SSO A;  2KSI A;  2CX7 A;  3BN8 A;  5EBV A;  5A23 A;  2OZG A;  1PZ4 A;  3BKS A;  4AV7 A;  4NUR A;  2HV2 A;  1C44 A;  3R1K A;  5AJL A;  4ZY7 A;  4QB9 A;  5AIJ A;  3BDQ A;  3BKR A;  2CFU A;  2NSF A;  2CFZ A;  4AXH A;  4MY0 A;  2NBN A;  5EC4 A;  2C0L B;  4NSS A;  2I00 A;  3SSM A;  3UY5 A;  1QND A;  3RYO A;  2NBM A;  4JGX A;  1IKT A;  4MY3 A;  2YHE A;  3SXN A;  4UEI A;  5IV0 A;  2CG3 A;  4JD6 A;  3SSN A;  3SXO A;  2NSG A;  1WFR A;  2CG2 A; 
#chains in the Genus database with same CATH homology
 2QZT A;  3CNU A;  3N7Z A;  4PDX A;  2KSH A;  2KSI A;  2CX7 A;  3BN8 A;  5EBV A;  5A23 A;  2OZG A;  1PZ4 A;  3BKS A;  4AV7 A;  4NUR A;  2HV2 A;  1C44 A;  3R1K A;  5AJL A;  5AIJ A;  4QB9 A;  3BDQ A;  3BKR A;  2CFU A;  2CFZ A;  4AXH A;  4MY0 A;  2NBN A;  5EC4 A;  2C0L B;  2I00 A;  3UY5 A;  1QND A;  3RYO A;  2NBM A;  4JGX A;  1IKT A;  4MY3 A;  2YHE A;  3SXN A;  4UEI A;  5IV0 A;  2CG3 A;  4JD6 A;  3SXO A;  1WFR A;  2CG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...