3BN8A

Crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
HHHMSEAKELIKKMCDLQNSNEEIQKEMAGWSGVVQYKLDGYYFYVEYKSDGTCEFKEGVHSSPTFTVVAPPDFWLAVLKGQEDPVSGFMMGKYRIEGNIMEAQRLAGVIKKFQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative sterol carrier protein 2 (2649030) from Archaeoglobus fulgidus at 2.11 A resolution
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Transport protein
molecule keywords Putative sterol carrier protein 2
total genus 28
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 3bn8A00
5A23A 4MY3A 5IV0A 3BDQA 3SXOA 1QNDA 2NBMA 1PZ4A 2KSIA 4PDXA 2OZGA 2CFUA 4AXHA 1IKTA 3SXNA 2YHEA 3N7ZA 1WFRA 2KSHA 4MY0A 4JD6A 4AV7A 2QZTA 2C0LB 2CFZA 2NBNA 5AJLA 2CG3A 5EC4A 3BKSA 5EBVA 2I00A 5AIJA 3RYOA 4UEIA 2HV2A 3BKRA 4QB9A 3UY5A 4NURA 4JGXA 3BN8A 3R1KA 1C44A 2CG2A 2CX7A 3CNUA
chains in the Genus database with same CATH superfamily
5A23A 4MY3A 3SSMA 5IV0A 3BDQA 3SXOA 1QNDA 2NBMA 1PZ4A 3SSNA 2KSIA 4PDXA 2OZGA 2CFUA 4AXHA 1IKTA 3SXNA 2YHEA 3SSOA 3N7ZA 1WFRA 2KSHA 4MY0A 4JD6A 4AV7A 2QZTA 2C0LB 2CFZA 4NSSA 2NBNA 5AJLA 2CG3A 5EC4A 3BKSA 5EBVA 2I00A 5AIJA 2NSFA 4UEIA 3RYOA 4ZY7A 2HV2A 3BKRA 4QB9A 3UY5A 4NURA 2NSGA 4JGXA 3BN8A 3R1KA 1C44A 2CG2A 2CX7A 3CNUA
chains in the Genus database with same CATH topology
5A23A 4MY3A 5IV0A 3BDQA 3SXOA 1QNDA 2NBMA 1PZ4A 2KSIA 4PDXA 2OZGA 2CFUA 4AXHA 1IKTA 3SXNA 2YHEA 3N7ZA 1WFRA 2KSHA 4MY0A 4JD6A 4AV7A 2QZTA 2C0LB 2CFZA 2NBNA 5AJLA 2CG3A 5EC4A 3BKSA 5EBVA 2I00A 5AIJA 3RYOA 4UEIA 2HV2A 3BKRA 4QB9A 3UY5A 4NURA 4JGXA 3BN8A 3R1KA 1C44A 2CG2A 2CX7A 3CNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A23 A;  4MY3 A;  5IV0 A;  3BDQ A;  3SXO A;  1QND A;  2NBM A;  1PZ4 A;  2KSI A;  4PDX A;  2OZG A;  2CFU A;  4AXH A;  1IKT A;  3SXN A;  2YHE A;  3N7Z A;  1WFR A;  2KSH A;  4MY0 A;  4JD6 A;  4AV7 A;  2QZT A;  2C0L B;  2CFZ A;  2NBN A;  5AJL A;  2CG3 A;  5EC4 A;  3BKS A;  5EBV A;  2I00 A;  5AIJ A;  3RYO A;  4UEI A;  2HV2 A;  3BKR A;  4QB9 A;  3UY5 A;  4NUR A;  4JGX A;  3BN8 A;  3R1K A;  1C44 A;  2CG2 A;  2CX7 A;  3CNU A; 
#chains in the Genus database with same CATH topology
 5A23 A;  4MY3 A;  3SSM A;  5IV0 A;  3BDQ A;  3SXO A;  1QND A;  2NBM A;  1PZ4 A;  3SSN A;  2KSI A;  4PDX A;  2OZG A;  2CFU A;  4AXH A;  1IKT A;  3SXN A;  2YHE A;  3SSO A;  3N7Z A;  1WFR A;  2KSH A;  4MY0 A;  4JD6 A;  4AV7 A;  2QZT A;  2C0L B;  2CFZ A;  4NSS A;  2NBN A;  5AJL A;  2CG3 A;  5EC4 A;  3BKS A;  5EBV A;  2I00 A;  5AIJ A;  2NSF A;  4UEI A;  3RYO A;  4ZY7 A;  2HV2 A;  3BKR A;  4QB9 A;  3UY5 A;  4NUR A;  2NSG A;  4JGX A;  3BN8 A;  3R1K A;  1C44 A;  2CG2 A;  2CX7 A;  3CNU A; 
#chains in the Genus database with same CATH homology
 5A23 A;  4MY3 A;  5IV0 A;  3BDQ A;  3SXO A;  1QND A;  2NBM A;  1PZ4 A;  2KSI A;  4PDX A;  2OZG A;  2CFU A;  4AXH A;  1IKT A;  3SXN A;  2YHE A;  3N7Z A;  1WFR A;  2KSH A;  4MY0 A;  4JD6 A;  4AV7 A;  2QZT A;  2C0L B;  2CFZ A;  2NBN A;  5AJL A;  2CG3 A;  5EC4 A;  3BKS A;  5EBV A;  2I00 A;  5AIJ A;  3RYO A;  4UEI A;  2HV2 A;  3BKR A;  4QB9 A;  3UY5 A;  4NUR A;  4JGX A;  3BN8 A;  3R1K A;  1C44 A;  2CG2 A;  2CX7 A;  3CNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...