1WFRA

Solution structure of the conserved hypothetical protein tt1886, possibly sterol carrier protein, from thermus thermophilus hb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
143
structure length
143
Chain Sequence
GSSGSSGMELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lipid binding protein
molecule keywords Hypothetical Protein TT1886
total genus 28
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1wfrA00
3SXNA 4MY3A 3R1KA 4QB9A 5AIJA 3BN8A 3BKSA 1C44A 2CX7A 1WFRA 2NBMA 2OZGA 2YHEA 1QNDA 3CNUA 2CFZA 3BDQA 3BKRA 5A23A 3UY5A 1IKTA 4UEIA 2QZTA 1PZ4A 2C0LB 2CFUA 4JGXA 4MY0A 4AXHA 2NBNA 2I00A 2KSHA 5EBVA 5AJLA 4JD6A 3N7ZA 5IV0A 4PDXA 3SXOA 2CG3A 5EC4A 4AV7A 2HV2A 2KSIA 2CG2A 4NURA 3RYOA
chains in the Genus database with same CATH superfamily
3SXNA 4MY3A 3R1KA 4QB9A 5AIJA 3BN8A 3BKSA 1C44A 2CX7A 1WFRA 2NBMA 2OZGA 2YHEA 1QNDA 2NSGA 3CNUA 4NSSA 2CFZA 3BDQA 3BKRA 3SSMA 5A23A 3UY5A 1IKTA 4UEIA 2QZTA 1PZ4A 2C0LB 2CFUA 4JGXA 4MY0A 3SSOA 4AXHA 2NBNA 2I00A 2KSHA 4ZY7A 5EBVA 5AJLA 3SSNA 4JD6A 3N7ZA 5IV0A 4PDXA 3SXOA 2CG3A 5EC4A 4AV7A 2HV2A 2KSIA 2CG2A 4NURA 2NSFA 3RYOA
chains in the Genus database with same CATH topology
3SXNA 4MY3A 3R1KA 4QB9A 5AIJA 3BN8A 3BKSA 1C44A 2CX7A 1WFRA 2NBMA 2OZGA 2YHEA 1QNDA 3CNUA 2CFZA 3BDQA 3BKRA 5A23A 3UY5A 1IKTA 4UEIA 2QZTA 1PZ4A 2C0LB 2CFUA 4JGXA 4MY0A 4AXHA 2NBNA 2I00A 2KSHA 5EBVA 5AJLA 4JD6A 3N7ZA 5IV0A 4PDXA 3SXOA 2CG3A 5EC4A 4AV7A 2HV2A 2KSIA 2CG2A 4NURA 3RYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXN A;  4MY3 A;  3R1K A;  4QB9 A;  5AIJ A;  3BN8 A;  3BKS A;  1C44 A;  2CX7 A;  1WFR A;  2NBM A;  2OZG A;  2YHE A;  1QND A;  3CNU A;  2CFZ A;  3BDQ A;  3BKR A;  5A23 A;  3UY5 A;  1IKT A;  4UEI A;  2QZT A;  1PZ4 A;  2C0L B;  2CFU A;  4JGX A;  4MY0 A;  4AXH A;  2NBN A;  2I00 A;  2KSH A;  5EBV A;  5AJL A;  4JD6 A;  3N7Z A;  5IV0 A;  4PDX A;  3SXO A;  2CG3 A;  5EC4 A;  4AV7 A;  2HV2 A;  2KSI A;  2CG2 A;  4NUR A;  3RYO A; 
#chains in the Genus database with same CATH topology
 3SXN A;  4MY3 A;  3R1K A;  4QB9 A;  5AIJ A;  3BN8 A;  3BKS A;  1C44 A;  2CX7 A;  1WFR A;  2NBM A;  2OZG A;  2YHE A;  1QND A;  2NSG A;  3CNU A;  4NSS A;  2CFZ A;  3BDQ A;  3BKR A;  3SSM A;  5A23 A;  3UY5 A;  1IKT A;  4UEI A;  2QZT A;  1PZ4 A;  2C0L B;  2CFU A;  4JGX A;  4MY0 A;  3SSO A;  4AXH A;  2NBN A;  2I00 A;  2KSH A;  4ZY7 A;  5EBV A;  5AJL A;  3SSN A;  4JD6 A;  3N7Z A;  5IV0 A;  4PDX A;  3SXO A;  2CG3 A;  5EC4 A;  4AV7 A;  2HV2 A;  2KSI A;  2CG2 A;  4NUR A;  2NSF A;  3RYO A; 
#chains in the Genus database with same CATH homology
 3SXN A;  4MY3 A;  3R1K A;  4QB9 A;  5AIJ A;  3BN8 A;  3BKS A;  1C44 A;  2CX7 A;  1WFR A;  2NBM A;  2OZG A;  2YHE A;  1QND A;  3CNU A;  2CFZ A;  3BDQ A;  3BKR A;  5A23 A;  3UY5 A;  1IKT A;  4UEI A;  2QZT A;  1PZ4 A;  2C0L B;  2CFU A;  4JGX A;  4MY0 A;  4AXH A;  2NBN A;  2I00 A;  2KSH A;  5EBV A;  5AJL A;  4JD6 A;  3N7Z A;  5IV0 A;  4PDX A;  3SXO A;  2CG3 A;  5EC4 A;  4AV7 A;  2HV2 A;  2KSI A;  2CG2 A;  4NUR A;  3RYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...