1WFRA

Solution structure of the conserved hypothetical protein tt1886, possibly sterol carrier protein, from thermus thermophilus hb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
143
structure length
143
Chain Sequence
GSSGSSGMELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein TT1886
publication title Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lipid binding protein
total genus 28
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1wfrA00
3R1KA 2CX7A 2I00A 3SXNA 3N7ZA 3SXOA 2QZTA 2KSIA 1WFRA 4MY3A 4JD6A 4NURA 5IV0A 3BKSA 5A23A 5EC4A 1IKTA 1PZ4A 3CNUA 2CFZA 4AV7A 3BDQA 3RYOA 3BKRA 5AJLA 1C44A 5AIJA 3BN8A 2CG2A 4PDXA 5EBVA 2C0LB 2NBNA 4QB9A 2KSHA 4UEIA 2HV2A 2YHEA 2CFUA 2CG3A 4AXHA 1QNDA 2NBMA 4MY0A 2OZGA 3UY5A 4JGXA
chains in the Genus database with same CATH superfamily
2NSGA 3R1KA 2CX7A 2I00A 3SXNA 3N7ZA 3SXOA 2QZTA 2KSIA 1WFRA 4MY3A 4JD6A 4NSSA 4NURA 3SSMA 5IV0A 3BKSA 5A23A 5EC4A 1IKTA 1PZ4A 3CNUA 2CFZA 4AV7A 3BDQA 3RYOA 3BKRA 5AJLA 1C44A 3SSNA 5AIJA 3BN8A 3SSOA 2CG2A 4PDXA 5EBVA 2C0LB 2NBNA 4QB9A 2KSHA 4UEIA 2HV2A 2YHEA 2CFUA 2NSFA 4ZY7A 2CG3A 4AXHA 1QNDA 2NBMA 4MY0A 2OZGA 3UY5A 4JGXA
chains in the Genus database with same CATH topology
3R1KA 2CX7A 2I00A 3SXNA 3N7ZA 3SXOA 2QZTA 2KSIA 1WFRA 4MY3A 4JD6A 4NURA 5IV0A 3BKSA 5A23A 5EC4A 1IKTA 1PZ4A 3CNUA 2CFZA 4AV7A 3BDQA 3RYOA 3BKRA 5AJLA 1C44A 5AIJA 3BN8A 2CG2A 4PDXA 5EBVA 2C0LB 2NBNA 4QB9A 2KSHA 4UEIA 2HV2A 2YHEA 2CFUA 2CG3A 4AXHA 1QNDA 2NBMA 4MY0A 2OZGA 3UY5A 4JGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1K A;  2CX7 A;  2I00 A;  3SXN A;  3N7Z A;  3SXO A;  2QZT A;  2KSI A;  1WFR A;  4MY3 A;  4JD6 A;  4NUR A;  5IV0 A;  3BKS A;  5A23 A;  5EC4 A;  1IKT A;  1PZ4 A;  3CNU A;  2CFZ A;  4AV7 A;  3BDQ A;  3RYO A;  3BKR A;  5AJL A;  1C44 A;  5AIJ A;  3BN8 A;  2CG2 A;  4PDX A;  5EBV A;  2C0L B;  2NBN A;  4QB9 A;  2KSH A;  4UEI A;  2HV2 A;  2YHE A;  2CFU A;  2CG3 A;  4AXH A;  1QND A;  2NBM A;  4MY0 A;  2OZG A;  3UY5 A;  4JGX A; 
#chains in the Genus database with same CATH topology
 2NSG A;  3R1K A;  2CX7 A;  2I00 A;  3SXN A;  3N7Z A;  3SXO A;  2QZT A;  2KSI A;  1WFR A;  4MY3 A;  4JD6 A;  4NSS A;  4NUR A;  3SSM A;  5IV0 A;  3BKS A;  5A23 A;  5EC4 A;  1IKT A;  1PZ4 A;  3CNU A;  2CFZ A;  4AV7 A;  3BDQ A;  3RYO A;  3BKR A;  5AJL A;  1C44 A;  3SSN A;  5AIJ A;  3BN8 A;  3SSO A;  2CG2 A;  4PDX A;  5EBV A;  2C0L B;  2NBN A;  4QB9 A;  2KSH A;  4UEI A;  2HV2 A;  2YHE A;  2CFU A;  2NSF A;  4ZY7 A;  2CG3 A;  4AXH A;  1QND A;  2NBM A;  4MY0 A;  2OZG A;  3UY5 A;  4JGX A; 
#chains in the Genus database with same CATH homology
 3R1K A;  2CX7 A;  2I00 A;  3SXN A;  3N7Z A;  3SXO A;  2QZT A;  2KSI A;  1WFR A;  4MY3 A;  4JD6 A;  4NUR A;  5IV0 A;  3BKS A;  5A23 A;  5EC4 A;  1IKT A;  1PZ4 A;  3CNU A;  2CFZ A;  4AV7 A;  3BDQ A;  3RYO A;  3BKR A;  5AJL A;  1C44 A;  5AIJ A;  3BN8 A;  2CG2 A;  4PDX A;  5EBV A;  2C0L B;  2NBN A;  4QB9 A;  2KSH A;  4UEI A;  2HV2 A;  2YHE A;  2CFU A;  2CG3 A;  4AXH A;  1QND A;  2NBM A;  4MY0 A;  2OZG A;  3UY5 A;  4JGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...