1WFRA

Solution structure of the conserved hypothetical protein tt1886, possibly sterol carrier protein, from thermus thermophilus hb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
143
structure length
143
Chain Sequence
GSSGSSGMELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lipid binding protein
molecule keywords Hypothetical Protein TT1886
total genus 28
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1wfrA00
2NBMA 3R1KA 4PDXA 5EBVA 5AIJA 2CFUA 2KSHA 2QZTA 2CG3A 3BDQA 5IV0A 2NBNA 2CX7A 4MY0A 2OZGA 5A23A 3RYOA 4NURA 1C44A 5AJLA 3SXNA 3BKSA 3CNUA 2YHEA 4JGXA 3SXOA 3N7ZA 4UEIA 1IKTA 2CFZA 3UY5A 4MY3A 5EC4A 2CG2A 2I00A 4AXHA 4QB9A 4JD6A 3BN8A 1QNDA 2C0LB 2HV2A 1WFRA 2KSIA 3BKRA 1PZ4A 4AV7A
chains in the Genus database with same CATH superfamily
2NBMA 3R1KA 4PDXA 5EBVA 3SSNA 2CFUA 5AIJA 2KSHA 2QZTA 2CG3A 3BDQA 5IV0A 2NSGA 2NBNA 2CX7A 4MY0A 2OZGA 3SSMA 5A23A 3RYOA 2NSFA 1C44A 4NURA 5AJLA 3SXNA 3BKSA 3CNUA 2YHEA 4JGXA 3SXOA 3N7ZA 4UEIA 1IKTA 2CFZA 3UY5A 4MY3A 5EC4A 2CG2A 3SSOA 2I00A 4ZY7A 4AXHA 4QB9A 4JD6A 3BN8A 1QNDA 2C0LB 2HV2A 1WFRA 2KSIA 3BKRA 4NSSA 1PZ4A 4AV7A
chains in the Genus database with same CATH topology
2NBMA 3R1KA 4PDXA 5EBVA 5AIJA 2CFUA 2KSHA 2QZTA 2CG3A 3BDQA 5IV0A 2NBNA 2CX7A 4MY0A 2OZGA 5A23A 3RYOA 4NURA 1C44A 5AJLA 3SXNA 3BKSA 3CNUA 2YHEA 4JGXA 3SXOA 3N7ZA 4UEIA 1IKTA 2CFZA 3UY5A 4MY3A 5EC4A 2CG2A 2I00A 4AXHA 4QB9A 4JD6A 3BN8A 1QNDA 2C0LB 2HV2A 1WFRA 2KSIA 3BKRA 1PZ4A 4AV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBM A;  3R1K A;  4PDX A;  5EBV A;  5AIJ A;  2CFU A;  2KSH A;  2QZT A;  2CG3 A;  3BDQ A;  5IV0 A;  2NBN A;  2CX7 A;  4MY0 A;  2OZG A;  5A23 A;  3RYO A;  4NUR A;  1C44 A;  5AJL A;  3SXN A;  3BKS A;  3CNU A;  2YHE A;  4JGX A;  3SXO A;  3N7Z A;  4UEI A;  1IKT A;  2CFZ A;  3UY5 A;  4MY3 A;  5EC4 A;  2CG2 A;  2I00 A;  4AXH A;  4QB9 A;  4JD6 A;  3BN8 A;  1QND A;  2C0L B;  2HV2 A;  1WFR A;  2KSI A;  3BKR A;  1PZ4 A;  4AV7 A; 
#chains in the Genus database with same CATH topology
 2NBM A;  3R1K A;  4PDX A;  5EBV A;  3SSN A;  2CFU A;  5AIJ A;  2KSH A;  2QZT A;  2CG3 A;  3BDQ A;  5IV0 A;  2NSG A;  2NBN A;  2CX7 A;  4MY0 A;  2OZG A;  3SSM A;  5A23 A;  3RYO A;  2NSF A;  1C44 A;  4NUR A;  5AJL A;  3SXN A;  3BKS A;  3CNU A;  2YHE A;  4JGX A;  3SXO A;  3N7Z A;  4UEI A;  1IKT A;  2CFZ A;  3UY5 A;  4MY3 A;  5EC4 A;  2CG2 A;  3SSO A;  2I00 A;  4ZY7 A;  4AXH A;  4QB9 A;  4JD6 A;  3BN8 A;  1QND A;  2C0L B;  2HV2 A;  1WFR A;  2KSI A;  3BKR A;  4NSS A;  1PZ4 A;  4AV7 A; 
#chains in the Genus database with same CATH homology
 2NBM A;  3R1K A;  4PDX A;  5EBV A;  5AIJ A;  2CFU A;  2KSH A;  2QZT A;  2CG3 A;  3BDQ A;  5IV0 A;  2NBN A;  2CX7 A;  4MY0 A;  2OZG A;  5A23 A;  3RYO A;  4NUR A;  1C44 A;  5AJL A;  3SXN A;  3BKS A;  3CNU A;  2YHE A;  4JGX A;  3SXO A;  3N7Z A;  4UEI A;  1IKT A;  2CFZ A;  3UY5 A;  4MY3 A;  5EC4 A;  2CG2 A;  2I00 A;  4AXH A;  4QB9 A;  4JD6 A;  3BN8 A;  1QND A;  2C0L B;  2HV2 A;  1WFR A;  2KSI A;  3BKR A;  1PZ4 A;  4AV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...