The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
143
|
structure length |
143
|
Chain Sequence |
GSSGSSGMELFTEAWAQAYCRKLNESEAYRKAASTWEGSLALAVRPDPKAGFPKGVAVVLDLWHGACRGAKAVEGEAEADFVIEADLATWQEVLEGRLEPLSALMRGLLELKKGTIAALAPYAQAAQELVKVAREVASGPSSG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Lipid binding protein
|
molecule keywords |
Hypothetical Protein TT1886
|
publication title |
Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8
rcsb |
source organism |
Thermus thermophilus
|
total genus |
28
|
structure length |
143
|
sequence length |
143
|
ec nomenclature | |
pdb deposition date | 2004-05-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02036 | SCP2 | SCP-2 sterol transfer family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Nonspecific Lipid-transfer Protein; Chain A | SCP2 sterol-binding domain |
#chains in the Genus database with same CATH superfamily 3UY5 A; 4MY3 A; 5AJL A; 4QB9 A; 3R1K A; 2QZT A; 3N7Z A; 4PDX A; 4AV7 A; 2CG2 A; 3BKS A; 3CNU A; 1C44 A; 2YHE A; 4JD6 A; 3SXN A; 1IKT A; 2NBN A; 3BKR A; 2CG3 A; 3BDQ A; 5EBV A; 3SXO A; 5A23 A; 3RYO A; 2CFZ A; 4MY0 A; 2KSI A; 4UEI A; 5IV0 A; 1PZ4 A; 4NUR A; 2C0L B; 1QND A; 2CX7 A; 5EC4 A; 4AXH A; 1WFR A; 4JGX A; 5AIJ A; 2CFU A; 2HV2 A; 3BN8 A; 2I00 A; 2OZG A; 2NBM A; 2KSH A; #chains in the Genus database with same CATH topology 3UY5 A; 4MY3 A; 5AJL A; 3SSM A; 4QB9 A; 3R1K A; 2QZT A; 3N7Z A; 4PDX A; 4AV7 A; 4NSS A; 2CG2 A; 3BKS A; 3CNU A; 1C44 A; 2YHE A; 4JD6 A; 3SXN A; 1IKT A; 2NBN A; 3BKR A; 2NSG A; 2CG3 A; 3BDQ A; 5EBV A; 3SXO A; 5A23 A; 3RYO A; 2CFZ A; 4MY0 A; 2KSI A; 4UEI A; 5IV0 A; 1PZ4 A; 4NUR A; 2C0L B; 1QND A; 2CX7 A; 5EC4 A; 4AXH A; 1WFR A; 2NSF A; 4ZY7 A; 4JGX A; 5AIJ A; 2CFU A; 2HV2 A; 3SSN A; 3BN8 A; 3SSO A; 2I00 A; 2OZG A; 2NBM A; 2KSH A; #chains in the Genus database with same CATH homology 3UY5 A; 4MY3 A; 5AJL A; 4QB9 A; 3R1K A; 2QZT A; 3N7Z A; 4PDX A; 4AV7 A; 2CG2 A; 3BKS A; 3CNU A; 1C44 A; 2YHE A; 4JD6 A; 3SXN A; 1IKT A; 2NBN A; 3BKR A; 2CG3 A; 3BDQ A; 5EBV A; 3SXO A; 5A23 A; 3RYO A; 2CFZ A; 4MY0 A; 2KSI A; 4UEI A; 5IV0 A; 1PZ4 A; 4NUR A; 2C0L B; 1QND A; 2CX7 A; 5EC4 A; 4AXH A; 1WFR A; 4JGX A; 5AIJ A; 2CFU A; 2HV2 A; 3BN8 A; 2I00 A; 2OZG A; 2NBM A; 2KSH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...