2NBNA

Solution nmr structure of palmitated scp2l2 from aedes aegypti
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
MSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVIHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Nuclear Magnetic Resonance Studies of Sterol Carrier Protein 2 Like 2 (SCP2L2) Reveal the Insecticide Specific Structural Characteristics of SCP2 Proteins in Aedes aegypti Mosquitoes
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
molecule keywords Sterol carrier protein 2-like 2
total genus 19
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2nbnA00
3SXOA 5AJLA 2KSHA 2CX7A 2KSIA 5AIJA 3BKSA 1PZ4A 2HV2A 2NBMA 1IKTA 2CFZA 4NURA 2YHEA 3R1KA 4PDXA 4MY3A 3BKRA 5A23A 4QB9A 1WFRA 3UY5A 3N7ZA 3BN8A 2CG2A 2I00A 2QZTA 3RYOA 2C0LB 5EBVA 2OZGA 2CG3A 5EC4A 4MY0A 3SXNA 1C44A 1QNDA 4JD6A 4JGXA 2NBNA 3CNUA 4AV7A 2CFUA 4UEIA 3BDQA 5IV0A 4AXHA
chains in the Genus database with same CATH superfamily
2NSFA 3SXOA 5AJLA 2KSHA 2CX7A 2KSIA 5AIJA 3BKSA 1PZ4A 2HV2A 4ZY7A 2NBMA 1IKTA 2CFZA 4NURA 2YHEA 3R1KA 4PDXA 4MY3A 3BKRA 5A23A 4QB9A 1WFRA 3UY5A 3N7ZA 3BN8A 4NSSA 2CG2A 3SSMA 2I00A 3SSOA 2QZTA 3RYOA 2C0LB 5EBVA 2OZGA 2CG3A 5EC4A 4MY0A 3SXNA 1C44A 1QNDA 2NSGA 4JD6A 4JGXA 2NBNA 3CNUA 4AV7A 2CFUA 4UEIA 3SSNA 3BDQA 5IV0A 4AXHA
chains in the Genus database with same CATH topology
3SXOA 5AJLA 2KSHA 2CX7A 2KSIA 5AIJA 3BKSA 1PZ4A 2HV2A 2NBMA 1IKTA 2CFZA 4NURA 2YHEA 3R1KA 4PDXA 4MY3A 3BKRA 5A23A 4QB9A 1WFRA 3UY5A 3N7ZA 3BN8A 2CG2A 2I00A 2QZTA 3RYOA 2C0LB 5EBVA 2OZGA 2CG3A 5EC4A 4MY0A 3SXNA 1C44A 1QNDA 4JD6A 4JGXA 2NBNA 3CNUA 4AV7A 2CFUA 4UEIA 3BDQA 5IV0A 4AXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXO A;  5AJL A;  2KSH A;  2CX7 A;  2KSI A;  5AIJ A;  3BKS A;  1PZ4 A;  2HV2 A;  2NBM A;  1IKT A;  2CFZ A;  4NUR A;  2YHE A;  3R1K A;  4PDX A;  4MY3 A;  3BKR A;  5A23 A;  4QB9 A;  1WFR A;  3UY5 A;  3N7Z A;  3BN8 A;  2CG2 A;  2I00 A;  2QZT A;  3RYO A;  2C0L B;  5EBV A;  2OZG A;  2CG3 A;  5EC4 A;  4MY0 A;  3SXN A;  1C44 A;  1QND A;  4JD6 A;  4JGX A;  2NBN A;  3CNU A;  4AV7 A;  2CFU A;  4UEI A;  3BDQ A;  5IV0 A;  4AXH A; 
#chains in the Genus database with same CATH topology
 2NSF A;  3SXO A;  5AJL A;  2KSH A;  2CX7 A;  2KSI A;  5AIJ A;  3BKS A;  1PZ4 A;  2HV2 A;  4ZY7 A;  2NBM A;  1IKT A;  2CFZ A;  4NUR A;  2YHE A;  3R1K A;  4PDX A;  4MY3 A;  3BKR A;  5A23 A;  4QB9 A;  1WFR A;  3UY5 A;  3N7Z A;  3BN8 A;  4NSS A;  2CG2 A;  3SSM A;  2I00 A;  3SSO A;  2QZT A;  3RYO A;  2C0L B;  5EBV A;  2OZG A;  2CG3 A;  5EC4 A;  4MY0 A;  3SXN A;  1C44 A;  1QND A;  2NSG A;  4JD6 A;  4JGX A;  2NBN A;  3CNU A;  4AV7 A;  2CFU A;  4UEI A;  3SSN A;  3BDQ A;  5IV0 A;  4AXH A; 
#chains in the Genus database with same CATH homology
 3SXO A;  5AJL A;  2KSH A;  2CX7 A;  2KSI A;  5AIJ A;  3BKS A;  1PZ4 A;  2HV2 A;  2NBM A;  1IKT A;  2CFZ A;  4NUR A;  2YHE A;  3R1K A;  4PDX A;  4MY3 A;  3BKR A;  5A23 A;  4QB9 A;  1WFR A;  3UY5 A;  3N7Z A;  3BN8 A;  2CG2 A;  2I00 A;  2QZT A;  3RYO A;  2C0L B;  5EBV A;  2OZG A;  2CG3 A;  5EC4 A;  4MY0 A;  3SXN A;  1C44 A;  1QND A;  4JD6 A;  4JGX A;  2NBN A;  3CNU A;  4AV7 A;  2CFU A;  4UEI A;  3BDQ A;  5IV0 A;  4AXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...