2NBNA

Solution nmr structure of palmitated scp2l2 from aedes aegypti
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
MSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVIHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2-like 2
publication title Solution Nuclear Magnetic Resonance Studies of Sterol Carrier Protein 2 Like 2 (SCP2L2) Reveal the Insecticide Specific Structural Characteristics of SCP2 Proteins in Aedes aegypti Mosquitoes
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid transport
total genus 19
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2nbnA00
2I00A 2KSHA 4PDXA 3SXOA 2HV2A 3N7ZA 3CNUA 5EBVA 2OZGA 2YHEA 2QZTA 2NBMA 3BKSA 2CG3A 2CX7A 2CFUA 4AV7A 1PZ4A 3UY5A 2CFZA 3BN8A 4AXHA 3RYOA 5A23A 5EC4A 3SXNA 2C0LB 3BKRA 4MY0A 4MY3A 4JD6A 1IKTA 3R1KA 3BDQA 1C44A 5IV0A 5AIJA 5AJLA 4NURA 2NBNA 1QNDA 2KSIA 4UEIA 4QB9A 2CG2A 4JGXA 1WFRA
chains in the Genus database with same CATH superfamily
2I00A 2KSHA 4PDXA 3SXOA 2HV2A 3N7ZA 3CNUA 5EBVA 2OZGA 2YHEA 2QZTA 2NBMA 3BKSA 2CG3A 2CX7A 2CFUA 4AV7A 1PZ4A 3UY5A 2CFZA 3SSNA 3BN8A 4AXHA 3RYOA 5A23A 5EC4A 3SXNA 2C0LB 3BKRA 4MY0A 4MY3A 3SSOA 4JD6A 1IKTA 4NSSA 3R1KA 3BDQA 1C44A 5IV0A 5AIJA 2NSGA 5AJLA 4NURA 2NBNA 4ZY7A 3SSMA 1QNDA 2KSIA 2NSFA 4UEIA 4QB9A 2CG2A 4JGXA 1WFRA
chains in the Genus database with same CATH topology
2I00A 2KSHA 4PDXA 3SXOA 2HV2A 3N7ZA 3CNUA 5EBVA 2OZGA 2YHEA 2QZTA 2NBMA 3BKSA 2CG3A 2CX7A 2CFUA 4AV7A 1PZ4A 3UY5A 2CFZA 3BN8A 4AXHA 3RYOA 5A23A 5EC4A 3SXNA 2C0LB 3BKRA 4MY0A 4MY3A 4JD6A 1IKTA 3R1KA 3BDQA 1C44A 5IV0A 5AIJA 5AJLA 4NURA 2NBNA 1QNDA 2KSIA 4UEIA 4QB9A 2CG2A 4JGXA 1WFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I00 A;  2KSH A;  4PDX A;  3SXO A;  2HV2 A;  3N7Z A;  3CNU A;  5EBV A;  2OZG A;  2YHE A;  2QZT A;  2NBM A;  3BKS A;  2CG3 A;  2CX7 A;  2CFU A;  4AV7 A;  1PZ4 A;  3UY5 A;  2CFZ A;  3BN8 A;  4AXH A;  3RYO A;  5A23 A;  5EC4 A;  3SXN A;  2C0L B;  3BKR A;  4MY0 A;  4MY3 A;  4JD6 A;  1IKT A;  3R1K A;  3BDQ A;  1C44 A;  5IV0 A;  5AIJ A;  5AJL A;  4NUR A;  2NBN A;  1QND A;  2KSI A;  4UEI A;  4QB9 A;  2CG2 A;  4JGX A;  1WFR A; 
#chains in the Genus database with same CATH topology
 2I00 A;  2KSH A;  4PDX A;  3SXO A;  2HV2 A;  3N7Z A;  3CNU A;  5EBV A;  2OZG A;  2YHE A;  2QZT A;  2NBM A;  3BKS A;  2CG3 A;  2CX7 A;  2CFU A;  4AV7 A;  1PZ4 A;  3UY5 A;  2CFZ A;  3SSN A;  3BN8 A;  4AXH A;  3RYO A;  5A23 A;  5EC4 A;  3SXN A;  2C0L B;  3BKR A;  4MY0 A;  4MY3 A;  3SSO A;  4JD6 A;  1IKT A;  4NSS A;  3R1K A;  3BDQ A;  1C44 A;  5IV0 A;  5AIJ A;  2NSG A;  5AJL A;  4NUR A;  2NBN A;  4ZY7 A;  3SSM A;  1QND A;  2KSI A;  2NSF A;  4UEI A;  4QB9 A;  2CG2 A;  4JGX A;  1WFR A; 
#chains in the Genus database with same CATH homology
 2I00 A;  2KSH A;  4PDX A;  3SXO A;  2HV2 A;  3N7Z A;  3CNU A;  5EBV A;  2OZG A;  2YHE A;  2QZT A;  2NBM A;  3BKS A;  2CG3 A;  2CX7 A;  2CFU A;  4AV7 A;  1PZ4 A;  3UY5 A;  2CFZ A;  3BN8 A;  4AXH A;  3RYO A;  5A23 A;  5EC4 A;  3SXN A;  2C0L B;  3BKR A;  4MY0 A;  4MY3 A;  4JD6 A;  1IKT A;  3R1K A;  3BDQ A;  1C44 A;  5IV0 A;  5AIJ A;  5AJL A;  4NUR A;  2NBN A;  1QND A;  2KSI A;  4UEI A;  4QB9 A;  2CG2 A;  4JGX A;  1WFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...