1QNDA

Sterol carrier protein-2, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
SSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Sterol Carrier Protein-2: Implications for the Biological Role
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transfer protein
molecule keywords NONSPECIFIC LIPID-TRANSFER PROTEIN
total genus 20
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1qndA00
2C0LB 1IKTA 4JGXA 5EBVA 2KSHA 2YHEA 5EC4A 2OZGA 5IV0A 2HV2A 3SXNA 4NURA 3BN8A 4UEIA 4PDXA 3UY5A 2CFZA 3RYOA 1C44A 3N7ZA 1WFRA 4JD6A 2I00A 2NBMA 2CG3A 5AJLA 5AIJA 4AV7A 1QNDA 3R1KA 4QB9A 3SXOA 1PZ4A 2CX7A 3BDQA 4AXHA 2KSIA 2QZTA 3BKSA 5A23A 3BKRA 4MY0A 4MY3A 2CFUA 2NBNA 3CNUA 2CG2A
chains in the Genus database with same CATH superfamily
2C0LB 1IKTA 4JGXA 5EBVA 2KSHA 2YHEA 5EC4A 2OZGA 5IV0A 2HV2A 3SXNA 3SSNA 4NURA 3BN8A 4UEIA 3SSMA 2NSGA 4PDXA 3UY5A 4NSSA 2CFZA 3RYOA 1C44A 3N7ZA 1WFRA 4JD6A 2I00A 2NBMA 2CG3A 5AJLA 5AIJA 4AV7A 1QNDA 4ZY7A 3R1KA 4QB9A 2NSFA 3SXOA 1PZ4A 2CX7A 3BDQA 4AXHA 3SSOA 2KSIA 2QZTA 3BKSA 5A23A 3BKRA 4MY0A 4MY3A 2CFUA 2NBNA 3CNUA 2CG2A
chains in the Genus database with same CATH topology
2C0LB 1IKTA 4JGXA 5EBVA 2KSHA 2YHEA 5EC4A 2OZGA 5IV0A 2HV2A 3SXNA 4NURA 3BN8A 4UEIA 4PDXA 3UY5A 2CFZA 3RYOA 1C44A 3N7ZA 1WFRA 4JD6A 2I00A 2NBMA 2CG3A 5AJLA 5AIJA 4AV7A 1QNDA 3R1KA 4QB9A 3SXOA 1PZ4A 2CX7A 3BDQA 4AXHA 2KSIA 2QZTA 3BKSA 5A23A 3BKRA 4MY0A 4MY3A 2CFUA 2NBNA 3CNUA 2CG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0L B;  1IKT A;  4JGX A;  5EBV A;  2KSH A;  2YHE A;  5EC4 A;  2OZG A;  5IV0 A;  2HV2 A;  3SXN A;  4NUR A;  3BN8 A;  4UEI A;  4PDX A;  3UY5 A;  2CFZ A;  3RYO A;  1C44 A;  3N7Z A;  1WFR A;  4JD6 A;  2I00 A;  2NBM A;  2CG3 A;  5AJL A;  5AIJ A;  4AV7 A;  1QND A;  3R1K A;  4QB9 A;  3SXO A;  1PZ4 A;  2CX7 A;  3BDQ A;  4AXH A;  2KSI A;  2QZT A;  3BKS A;  5A23 A;  3BKR A;  4MY0 A;  4MY3 A;  2CFU A;  2NBN A;  3CNU A;  2CG2 A; 
#chains in the Genus database with same CATH topology
 2C0L B;  1IKT A;  4JGX A;  5EBV A;  2KSH A;  2YHE A;  5EC4 A;  2OZG A;  5IV0 A;  2HV2 A;  3SXN A;  3SSN A;  4NUR A;  3BN8 A;  4UEI A;  3SSM A;  2NSG A;  4PDX A;  3UY5 A;  4NSS A;  2CFZ A;  3RYO A;  1C44 A;  3N7Z A;  1WFR A;  4JD6 A;  2I00 A;  2NBM A;  2CG3 A;  5AJL A;  5AIJ A;  4AV7 A;  1QND A;  4ZY7 A;  3R1K A;  4QB9 A;  2NSF A;  3SXO A;  1PZ4 A;  2CX7 A;  3BDQ A;  4AXH A;  3SSO A;  2KSI A;  2QZT A;  3BKS A;  5A23 A;  3BKR A;  4MY0 A;  4MY3 A;  2CFU A;  2NBN A;  3CNU A;  2CG2 A; 
#chains in the Genus database with same CATH homology
 2C0L B;  1IKT A;  4JGX A;  5EBV A;  2KSH A;  2YHE A;  5EC4 A;  2OZG A;  5IV0 A;  2HV2 A;  3SXN A;  4NUR A;  3BN8 A;  4UEI A;  4PDX A;  3UY5 A;  2CFZ A;  3RYO A;  1C44 A;  3N7Z A;  1WFR A;  4JD6 A;  2I00 A;  2NBM A;  2CG3 A;  5AJL A;  5AIJ A;  4AV7 A;  1QND A;  3R1K A;  4QB9 A;  3SXO A;  1PZ4 A;  2CX7 A;  3BDQ A;  4AXH A;  2KSI A;  2QZT A;  3BKS A;  5A23 A;  3BKR A;  4MY0 A;  4MY3 A;  2CFU A;  2NBN A;  3CNU A;  2CG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...