1QNDA

Sterol carrier protein-2, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
b'SSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NONSPECIFIC LIPID-TRANSFER PROTEIN
publication title NMR Structure of the Sterol Carrier Protein-2: Implications for the Biological Role
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transfer protein
total genus 20
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1qndA00
2CX7A 1C44A 2C0LB 1QNDA 2CFZA 2NBMA 2NBNA 3RYOA 3UY5A 2KSIA 3R1KA 5EBVA 3SXNA 2CG3A 4AXHA 3BKRA 1PZ4A 4JD6A 4NURA 2HV2A 2I00A 3BDQA 2KSHA 1WFRA 5A23A 4MY0A 4JGXA 3BN8A 4UEIA 3CNUA 3N7ZA 2CG2A 5IV0A 4PDXA 5EC4A 5AIJA 4MY3A 2OZGA 5AJLA 4AV7A 2YHEA 2QZTA 1IKTA 3BKSA 2CFUA 3SXOA 4QB9A
chains in the Genus database with same CATH superfamily
2CX7A 1C44A 2C0LB 1QNDA 2CFZA 2NBMA 2NBNA 3RYOA 3UY5A 2KSIA 3R1KA 5EBVA 3SXNA 2CG3A 2NSFA 4AXHA 3BKRA 1PZ4A 4JD6A 4NSSA 2HV2A 2I00A 3BDQA 2KSHA 1WFRA 4NURA 4MY0A 5A23A 4JGXA 3BN8A 4UEIA 3SSNA 3CNUA 3N7ZA 4ZY7A 2NSGA 2CG2A 5IV0A 4PDXA 5EC4A 5AIJA 4MY3A 2OZGA 5AJLA 4AV7A 2YHEA 3SSOA 2QZTA 3SSMA 1IKTA 3BKSA 2CFUA 3SXOA 4QB9A
chains in the Genus database with same CATH topology
2CX7A 1C44A 2C0LB 1QNDA 2CFZA 2NBMA 2NBNA 3RYOA 3UY5A 2KSIA 3R1KA 5EBVA 3SXNA 2CG3A 4AXHA 3BKRA 1PZ4A 4JD6A 4NURA 2HV2A 2I00A 3BDQA 2KSHA 1WFRA 5A23A 4MY0A 4JGXA 3BN8A 4UEIA 3CNUA 3N7ZA 2CG2A 5IV0A 4PDXA 5EC4A 5AIJA 4MY3A 2OZGA 5AJLA 4AV7A 2YHEA 2QZTA 1IKTA 3BKSA 2CFUA 3SXOA 4QB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CX7 A;  1C44 A;  2C0L B;  1QND A;  2CFZ A;  2NBM A;  2NBN A;  3RYO A;  3UY5 A;  2KSI A;  3R1K A;  5EBV A;  3SXN A;  2CG3 A;  4AXH A;  3BKR A;  1PZ4 A;  4JD6 A;  4NUR A;  2HV2 A;  2I00 A;  3BDQ A;  2KSH A;  1WFR A;  5A23 A;  4MY0 A;  4JGX A;  3BN8 A;  4UEI A;  3CNU A;  3N7Z A;  2CG2 A;  5IV0 A;  4PDX A;  5EC4 A;  5AIJ A;  4MY3 A;  2OZG A;  5AJL A;  4AV7 A;  2YHE A;  2QZT A;  1IKT A;  3BKS A;  2CFU A;  3SXO A;  4QB9 A; 
#chains in the Genus database with same CATH topology
 2CX7 A;  1C44 A;  2C0L B;  1QND A;  2CFZ A;  2NBM A;  2NBN A;  3RYO A;  3UY5 A;  2KSI A;  3R1K A;  5EBV A;  3SXN A;  2CG3 A;  2NSF A;  4AXH A;  3BKR A;  1PZ4 A;  4JD6 A;  4NSS A;  2HV2 A;  2I00 A;  3BDQ A;  2KSH A;  1WFR A;  4NUR A;  4MY0 A;  5A23 A;  4JGX A;  3BN8 A;  4UEI A;  3SSN A;  3CNU A;  3N7Z A;  4ZY7 A;  2NSG A;  2CG2 A;  5IV0 A;  4PDX A;  5EC4 A;  5AIJ A;  4MY3 A;  2OZG A;  5AJL A;  4AV7 A;  2YHE A;  3SSO A;  2QZT A;  3SSM A;  1IKT A;  3BKS A;  2CFU A;  3SXO A;  4QB9 A; 
#chains in the Genus database with same CATH homology
 2CX7 A;  1C44 A;  2C0L B;  1QND A;  2CFZ A;  2NBM A;  2NBN A;  3RYO A;  3UY5 A;  2KSI A;  3R1K A;  5EBV A;  3SXN A;  2CG3 A;  4AXH A;  3BKR A;  1PZ4 A;  4JD6 A;  4NUR A;  2HV2 A;  2I00 A;  3BDQ A;  2KSH A;  1WFR A;  5A23 A;  4MY0 A;  4JGX A;  3BN8 A;  4UEI A;  3CNU A;  3N7Z A;  2CG2 A;  5IV0 A;  4PDX A;  5EC4 A;  5AIJ A;  4MY3 A;  2OZG A;  5AJL A;  4AV7 A;  2YHE A;  2QZT A;  1IKT A;  3BKS A;  2CFU A;  3SXO A;  4QB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...