1QNDA

Sterol carrier protein-2, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
SSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NONSPECIFIC LIPID-TRANSFER PROTEIN
publication title NMR Structure of the Sterol Carrier Protein-2: Implications for the Biological Role
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transfer protein
total genus 20
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1qndA00
3N7ZA 4UEIA 4JD6A 2I00A 2OZGA 2HV2A 3SXOA 5EC4A 5AJLA 2CFUA 3BN8A 3UY5A 3SXNA 2CG2A 4JGXA 3CNUA 3R1KA 2CFZA 2KSIA 1QNDA 3BKSA 5AIJA 2YHEA 1C44A 1PZ4A 3BDQA 5EBVA 1WFRA 4AXHA 4MY3A 5IV0A 4PDXA 4AV7A 4NURA 4MY0A 2CG3A 5A23A 4QB9A 3BKRA 3RYOA 2QZTA 2CX7A 2C0LB 2KSHA 2NBMA 2NBNA 1IKTA
chains in the Genus database with same CATH superfamily
3N7ZA 4UEIA 4NSSA 4JD6A 2I00A 2OZGA 2HV2A 3SSOA 5EC4A 3SXOA 2NSGA 5AJLA 2CFUA 3BN8A 3UY5A 3SXNA 2CG2A 4JGXA 3CNUA 3R1KA 2NSFA 4ZY7A 2CFZA 2KSIA 1QNDA 3BKSA 5AIJA 2YHEA 1C44A 1PZ4A 3BDQA 5EBVA 1WFRA 3SSMA 4AXHA 4MY3A 5IV0A 4PDXA 4AV7A 4NURA 4MY0A 3SSNA 2CG3A 5A23A 4QB9A 3BKRA 3RYOA 2QZTA 2CX7A 2C0LB 2KSHA 2NBMA 2NBNA 1IKTA
chains in the Genus database with same CATH topology
3N7ZA 4UEIA 4JD6A 2I00A 2OZGA 2HV2A 3SXOA 5EC4A 5AJLA 2CFUA 3BN8A 3UY5A 3SXNA 2CG2A 4JGXA 3CNUA 3R1KA 2CFZA 2KSIA 1QNDA 3BKSA 5AIJA 2YHEA 1C44A 1PZ4A 3BDQA 5EBVA 1WFRA 4AXHA 4MY3A 5IV0A 4PDXA 4AV7A 4NURA 4MY0A 2CG3A 5A23A 4QB9A 3BKRA 3RYOA 2QZTA 2CX7A 2C0LB 2KSHA 2NBMA 2NBNA 1IKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7Z A;  4UEI A;  4JD6 A;  2I00 A;  2OZG A;  2HV2 A;  3SXO A;  5EC4 A;  5AJL A;  2CFU A;  3BN8 A;  3UY5 A;  3SXN A;  2CG2 A;  4JGX A;  3CNU A;  3R1K A;  2CFZ A;  2KSI A;  1QND A;  3BKS A;  5AIJ A;  2YHE A;  1C44 A;  1PZ4 A;  3BDQ A;  5EBV A;  1WFR A;  4AXH A;  4MY3 A;  5IV0 A;  4PDX A;  4AV7 A;  4NUR A;  4MY0 A;  2CG3 A;  5A23 A;  4QB9 A;  3BKR A;  3RYO A;  2QZT A;  2CX7 A;  2C0L B;  2KSH A;  2NBM A;  2NBN A;  1IKT A; 
#chains in the Genus database with same CATH topology
 3N7Z A;  4UEI A;  4NSS A;  4JD6 A;  2I00 A;  2OZG A;  2HV2 A;  3SSO A;  5EC4 A;  3SXO A;  2NSG A;  5AJL A;  2CFU A;  3BN8 A;  3UY5 A;  3SXN A;  2CG2 A;  4JGX A;  3CNU A;  3R1K A;  2NSF A;  4ZY7 A;  2CFZ A;  2KSI A;  1QND A;  3BKS A;  5AIJ A;  2YHE A;  1C44 A;  1PZ4 A;  3BDQ A;  5EBV A;  1WFR A;  3SSM A;  4AXH A;  4MY3 A;  5IV0 A;  4PDX A;  4AV7 A;  4NUR A;  4MY0 A;  3SSN A;  2CG3 A;  5A23 A;  4QB9 A;  3BKR A;  3RYO A;  2QZT A;  2CX7 A;  2C0L B;  2KSH A;  2NBM A;  2NBN A;  1IKT A; 
#chains in the Genus database with same CATH homology
 3N7Z A;  4UEI A;  4JD6 A;  2I00 A;  2OZG A;  2HV2 A;  3SXO A;  5EC4 A;  5AJL A;  2CFU A;  3BN8 A;  3UY5 A;  3SXN A;  2CG2 A;  4JGX A;  3CNU A;  3R1K A;  2CFZ A;  2KSI A;  1QND A;  3BKS A;  5AIJ A;  2YHE A;  1C44 A;  1PZ4 A;  3BDQ A;  5EBV A;  1WFR A;  4AXH A;  4MY3 A;  5IV0 A;  4PDX A;  4AV7 A;  4NUR A;  4MY0 A;  2CG3 A;  5A23 A;  4QB9 A;  3BKR A;  3RYO A;  2QZT A;  2CX7 A;  2C0L B;  2KSH A;  2NBM A;  2NBN A;  1IKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...