1QNDA

Sterol carrier protein-2, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
123
structure length
123
Chain Sequence
SSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Sterol Carrier Protein-2: Implications for the Biological Role
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transfer protein
molecule keywords NONSPECIFIC LIPID-TRANSFER PROTEIN
total genus 20
structure length 123
sequence length 123
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1qndA00
4QB9A 4AXHA 3N7ZA 4PDXA 2I00A 1IKTA 5AJLA 2CX7A 3BKSA 2CG3A 2HV2A 2NBNA 2QZTA 3RYOA 5IV0A 5A23A 4NURA 4MY3A 5AIJA 1C44A 3BDQA 3R1KA 2OZGA 1WFRA 2CG2A 1QNDA 2KSIA 3BN8A 2KSHA 4UEIA 4MY0A 1PZ4A 3CNUA 4AV7A 2CFUA 3BKRA 3SXNA 3UY5A 2C0LB 5EBVA 2YHEA 4JD6A 2CFZA 4JGXA 5EC4A 2NBMA 3SXOA
chains in the Genus database with same CATH superfamily
4QB9A 4AXHA 3N7ZA 4PDXA 3SSMA 2I00A 1IKTA 5AJLA 2CX7A 3BKSA 2CG3A 2HV2A 2QZTA 2NBNA 2NSGA 3RYOA 5IV0A 5A23A 4NURA 4MY3A 5AIJA 4NSSA 1C44A 3BDQA 3SSNA 3R1KA 2OZGA 2NSFA 1WFRA 2CG2A 1QNDA 2KSIA 3BN8A 2KSHA 4UEIA 4MY0A 1PZ4A 3CNUA 4ZY7A 4AV7A 2CFUA 3SSOA 3BKRA 3SXNA 3UY5A 2C0LB 5EBVA 2YHEA 4JD6A 2CFZA 4JGXA 5EC4A 2NBMA 3SXOA
chains in the Genus database with same CATH topology
4QB9A 4AXHA 3N7ZA 4PDXA 2I00A 1IKTA 5AJLA 2CX7A 3BKSA 2CG3A 2HV2A 2NBNA 2QZTA 3RYOA 5IV0A 5A23A 4NURA 4MY3A 5AIJA 1C44A 3BDQA 3R1KA 2OZGA 1WFRA 2CG2A 1QNDA 2KSIA 3BN8A 2KSHA 4UEIA 4MY0A 1PZ4A 3CNUA 4AV7A 2CFUA 3BKRA 3SXNA 3UY5A 2C0LB 5EBVA 2YHEA 4JD6A 2CFZA 4JGXA 5EC4A 2NBMA 3SXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB9 A;  4AXH A;  3N7Z A;  4PDX A;  2I00 A;  1IKT A;  5AJL A;  2CX7 A;  3BKS A;  2CG3 A;  2HV2 A;  2NBN A;  2QZT A;  3RYO A;  5IV0 A;  5A23 A;  4NUR A;  4MY3 A;  5AIJ A;  1C44 A;  3BDQ A;  3R1K A;  2OZG A;  1WFR A;  2CG2 A;  1QND A;  2KSI A;  3BN8 A;  2KSH A;  4UEI A;  4MY0 A;  1PZ4 A;  3CNU A;  4AV7 A;  2CFU A;  3BKR A;  3SXN A;  3UY5 A;  2C0L B;  5EBV A;  2YHE A;  4JD6 A;  2CFZ A;  4JGX A;  5EC4 A;  2NBM A;  3SXO A; 
#chains in the Genus database with same CATH topology
 4QB9 A;  4AXH A;  3N7Z A;  4PDX A;  3SSM A;  2I00 A;  1IKT A;  5AJL A;  2CX7 A;  3BKS A;  2CG3 A;  2HV2 A;  2QZT A;  2NBN A;  2NSG A;  3RYO A;  5IV0 A;  5A23 A;  4NUR A;  4MY3 A;  5AIJ A;  4NSS A;  1C44 A;  3BDQ A;  3SSN A;  3R1K A;  2OZG A;  2NSF A;  1WFR A;  2CG2 A;  1QND A;  2KSI A;  3BN8 A;  2KSH A;  4UEI A;  4MY0 A;  1PZ4 A;  3CNU A;  4ZY7 A;  4AV7 A;  2CFU A;  3SSO A;  3BKR A;  3SXN A;  3UY5 A;  2C0L B;  5EBV A;  2YHE A;  4JD6 A;  2CFZ A;  4JGX A;  5EC4 A;  2NBM A;  3SXO A; 
#chains in the Genus database with same CATH homology
 4QB9 A;  4AXH A;  3N7Z A;  4PDX A;  2I00 A;  1IKT A;  5AJL A;  2CX7 A;  3BKS A;  2CG3 A;  2HV2 A;  2NBN A;  2QZT A;  3RYO A;  5IV0 A;  5A23 A;  4NUR A;  4MY3 A;  5AIJ A;  1C44 A;  3BDQ A;  3R1K A;  2OZG A;  1WFR A;  2CG2 A;  1QND A;  2KSI A;  3BN8 A;  2KSH A;  4UEI A;  4MY0 A;  1PZ4 A;  3CNU A;  4AV7 A;  2CFU A;  3BKR A;  3SXN A;  3UY5 A;  2C0L B;  5EBV A;  2YHE A;  4JD6 A;  2CFZ A;  4JGX A;  5EC4 A;  2NBM A;  3SXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...