1PZ4A

The structural determination of an insect (mosquito) sterol carrier protein-2 with a ligand bound c16 fatty acid at 1.35 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
113
structure length
113
Chain Sequence
GIRMSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Determination of an Insect Sterol Carrier Protein-2 with a Ligand-bound C16 Fatty Acid at 1.35A Resolution
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords sterol carrier protein 2
total genus 34
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1pz4A00
3CNUA 1QNDA 2CG3A 5EC4A 5A23A 2CFZA 3RYOA 3SXNA 1WFRA 1IKTA 4AXHA 2HV2A 2KSHA 4AV7A 1C44A 3R1KA 3BKRA 2I00A 2CX7A 4MY3A 3N7ZA 1PZ4A 4QB9A 2CFUA 5AJLA 2NBNA 2CG2A 2C0LB 3BN8A 2QZTA 2YHEA 2OZGA 4PDXA 5AIJA 5IV0A 4NURA 4MY0A 2KSIA 3BDQA 4JGXA 3BKSA 2NBMA 4UEIA 3SXOA 5EBVA 3UY5A 4JD6A
chains in the Genus database with same CATH superfamily
3CNUA 1QNDA 2CG3A 5EC4A 5A23A 2CFZA 3RYOA 3SXNA 4ZY7A 1WFRA 3SSNA 1IKTA 4AXHA 2HV2A 2KSHA 4AV7A 1C44A 3R1KA 3BKRA 2I00A 2CX7A 2NSGA 4MY3A 3N7ZA 1PZ4A 4QB9A 2CFUA 5AJLA 2NBNA 2CG2A 2C0LB 3BN8A 2QZTA 2YHEA 2OZGA 3SSOA 4NSSA 4PDXA 3SSMA 5AIJA 5IV0A 4NURA 4MY0A 2KSIA 3BDQA 4JGXA 3BKSA 2NBMA 4UEIA 3SXOA 5EBVA 3UY5A 4JD6A 2NSFA
chains in the Genus database with same CATH topology
3CNUA 1QNDA 2CG3A 5EC4A 5A23A 2CFZA 3RYOA 3SXNA 1WFRA 1IKTA 4AXHA 2HV2A 2KSHA 4AV7A 1C44A 3R1KA 3BKRA 2I00A 2CX7A 4MY3A 3N7ZA 1PZ4A 4QB9A 2CFUA 5AJLA 2NBNA 2CG2A 2C0LB 3BN8A 2QZTA 2YHEA 2OZGA 4PDXA 5AIJA 5IV0A 4NURA 4MY0A 2KSIA 3BDQA 4JGXA 3BKSA 2NBMA 4UEIA 3SXOA 5EBVA 3UY5A 4JD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNU A;  1QND A;  2CG3 A;  5EC4 A;  5A23 A;  2CFZ A;  3RYO A;  3SXN A;  1WFR A;  1IKT A;  4AXH A;  2HV2 A;  2KSH A;  4AV7 A;  1C44 A;  3R1K A;  3BKR A;  2I00 A;  2CX7 A;  4MY3 A;  3N7Z A;  1PZ4 A;  4QB9 A;  2CFU A;  5AJL A;  2NBN A;  2CG2 A;  2C0L B;  3BN8 A;  2QZT A;  2YHE A;  2OZG A;  4PDX A;  5AIJ A;  5IV0 A;  4NUR A;  4MY0 A;  2KSI A;  3BDQ A;  4JGX A;  3BKS A;  2NBM A;  4UEI A;  3SXO A;  5EBV A;  3UY5 A;  4JD6 A; 
#chains in the Genus database with same CATH topology
 3CNU A;  1QND A;  2CG3 A;  5EC4 A;  5A23 A;  2CFZ A;  3RYO A;  3SXN A;  4ZY7 A;  1WFR A;  3SSN A;  1IKT A;  4AXH A;  2HV2 A;  2KSH A;  4AV7 A;  1C44 A;  3R1K A;  3BKR A;  2I00 A;  2CX7 A;  2NSG A;  4MY3 A;  3N7Z A;  1PZ4 A;  4QB9 A;  2CFU A;  5AJL A;  2NBN A;  2CG2 A;  2C0L B;  3BN8 A;  2QZT A;  2YHE A;  2OZG A;  3SSO A;  4NSS A;  4PDX A;  3SSM A;  5AIJ A;  5IV0 A;  4NUR A;  4MY0 A;  2KSI A;  3BDQ A;  4JGX A;  3BKS A;  2NBM A;  4UEI A;  3SXO A;  5EBV A;  3UY5 A;  4JD6 A;  2NSF A; 
#chains in the Genus database with same CATH homology
 3CNU A;  1QND A;  2CG3 A;  5EC4 A;  5A23 A;  2CFZ A;  3RYO A;  3SXN A;  1WFR A;  1IKT A;  4AXH A;  2HV2 A;  2KSH A;  4AV7 A;  1C44 A;  3R1K A;  3BKR A;  2I00 A;  2CX7 A;  4MY3 A;  3N7Z A;  1PZ4 A;  4QB9 A;  2CFU A;  5AJL A;  2NBN A;  2CG2 A;  2C0L B;  3BN8 A;  2QZT A;  2YHE A;  2OZG A;  4PDX A;  5AIJ A;  5IV0 A;  4NUR A;  4MY0 A;  2KSI A;  3BDQ A;  4JGX A;  3BKS A;  2NBM A;  4UEI A;  3SXO A;  5EBV A;  3UY5 A;  4JD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...