1PZ4A

The structural determination of an insect (mosquito) sterol carrier protein-2 with a ligand bound c16 fatty acid at 1.35 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
113
structure length
113
Chain Sequence
GIRMSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sterol carrier protein 2
publication title The Structural Determination of an Insect Sterol Carrier Protein-2 with a Ligand-bound C16 Fatty Acid at 1.35A Resolution
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
total genus 34
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 1pz4A00
1WFRA 3N7ZA 4JGXA 3BN8A 1C44A 5AJLA 4MY0A 1QNDA 3BDQA 5AIJA 2CG3A 2KSIA 1PZ4A 1IKTA 3CNUA 4PDXA 4JD6A 2CX7A 2HV2A 2CFUA 2KSHA 4AV7A 5A23A 3RYOA 4UEIA 2CFZA 2I00A 5EC4A 4MY3A 3BKSA 2CG2A 3R1KA 4NURA 4QB9A 2OZGA 2NBNA 5IV0A 3BKRA 3SXNA 3UY5A 5EBVA 2YHEA 3SXOA 2QZTA 2NBMA 2C0LB 4AXHA
chains in the Genus database with same CATH superfamily
1WFRA 3N7ZA 4JGXA 4ZY7A 3BN8A 1C44A 5AJLA 4MY0A 1QNDA 3BDQA 5AIJA 2CG3A 2NSFA 2KSIA 1PZ4A 1IKTA 3CNUA 4PDXA 4JD6A 2CX7A 4NSSA 2HV2A 2CFUA 2KSHA 2NSGA 4AV7A 3RYOA 5A23A 3SSNA 4UEIA 2CFZA 2I00A 5EC4A 4MY3A 3BKSA 2CG2A 3R1KA 4NURA 4QB9A 2OZGA 2NBNA 3SSOA 5IV0A 3BKRA 3SXNA 3UY5A 5EBVA 2YHEA 3SSMA 3SXOA 2QZTA 2NBMA 2C0LB 4AXHA
chains in the Genus database with same CATH topology
1WFRA 3N7ZA 4JGXA 3BN8A 1C44A 5AJLA 4MY0A 1QNDA 3BDQA 5AIJA 2CG3A 2KSIA 1PZ4A 1IKTA 3CNUA 4PDXA 4JD6A 2CX7A 2HV2A 2CFUA 2KSHA 4AV7A 5A23A 3RYOA 4UEIA 2CFZA 2I00A 5EC4A 4MY3A 3BKSA 2CG2A 3R1KA 4NURA 4QB9A 2OZGA 2NBNA 5IV0A 3BKRA 3SXNA 3UY5A 5EBVA 2YHEA 3SXOA 2QZTA 2NBMA 2C0LB 4AXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFR A;  3N7Z A;  4JGX A;  3BN8 A;  1C44 A;  5AJL A;  4MY0 A;  1QND A;  3BDQ A;  5AIJ A;  2CG3 A;  2KSI A;  1PZ4 A;  1IKT A;  3CNU A;  4PDX A;  4JD6 A;  2CX7 A;  2HV2 A;  2CFU A;  2KSH A;  4AV7 A;  5A23 A;  3RYO A;  4UEI A;  2CFZ A;  2I00 A;  5EC4 A;  4MY3 A;  3BKS A;  2CG2 A;  3R1K A;  4NUR A;  4QB9 A;  2OZG A;  2NBN A;  5IV0 A;  3BKR A;  3SXN A;  3UY5 A;  5EBV A;  2YHE A;  3SXO A;  2QZT A;  2NBM A;  2C0L B;  4AXH A; 
#chains in the Genus database with same CATH topology
 1WFR A;  3N7Z A;  4JGX A;  4ZY7 A;  3BN8 A;  1C44 A;  5AJL A;  4MY0 A;  1QND A;  3BDQ A;  5AIJ A;  2CG3 A;  2NSF A;  2KSI A;  1PZ4 A;  1IKT A;  3CNU A;  4PDX A;  4JD6 A;  2CX7 A;  4NSS A;  2HV2 A;  2CFU A;  2KSH A;  2NSG A;  4AV7 A;  3RYO A;  5A23 A;  3SSN A;  4UEI A;  2CFZ A;  2I00 A;  5EC4 A;  4MY3 A;  3BKS A;  2CG2 A;  3R1K A;  4NUR A;  4QB9 A;  2OZG A;  2NBN A;  3SSO A;  5IV0 A;  3BKR A;  3SXN A;  3UY5 A;  5EBV A;  2YHE A;  3SSM A;  3SXO A;  2QZT A;  2NBM A;  2C0L B;  4AXH A; 
#chains in the Genus database with same CATH homology
 1WFR A;  3N7Z A;  4JGX A;  3BN8 A;  1C44 A;  5AJL A;  4MY0 A;  1QND A;  3BDQ A;  5AIJ A;  2CG3 A;  2KSI A;  1PZ4 A;  1IKT A;  3CNU A;  4PDX A;  4JD6 A;  2CX7 A;  2HV2 A;  2CFU A;  2KSH A;  4AV7 A;  5A23 A;  3RYO A;  4UEI A;  2CFZ A;  2I00 A;  5EC4 A;  4MY3 A;  3BKS A;  2CG2 A;  3R1K A;  4NUR A;  4QB9 A;  2OZG A;  2NBN A;  5IV0 A;  3BKR A;  3SXN A;  3UY5 A;  5EBV A;  2YHE A;  3SXO A;  2QZT A;  2NBM A;  2C0L B;  4AXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...