4UEIA

Solution structure of the sterol carrier protein domain 2 of helicoverpa armigera
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
GSSGNPEDFKVFKYMKILEEAMENDTENLIEKVRGIYGFKVRNGPNGAEGYWVINAKEGKGKVTYNGGEKPDVTFTISDEDVVDLISGKLNPQKAFFQGKIKIQGNMGLAMKLTDLQRQAAGRIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROL CARRIER PROTEIN 2/3-OXOACYL-COA THIOLASE
publication title NMR Structure and Function of Helicoverpa Armigera Sterol Carrier Protein-2, an Important Insecticidal Target from the Cotton Bollworm.
pubmed doi rcsb
source organism Helicoverpa armigera
molecule tags Transferase
total genus 32
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 4ueiA00
4NURA 2CX7A 2QZTA 3BKRA 2NBMA 3BDQA 1IKTA 4MY3A 2NBNA 5AJLA 4AXHA 2C0LB 2HV2A 2CFZA 3BN8A 5EBVA 4JD6A 2I00A 5IV0A 2CG2A 2CFUA 5EC4A 4JGXA 4AV7A 3RYOA 2KSHA 1C44A 2KSIA 3SXNA 2OZGA 3R1KA 1PZ4A 1QNDA 2CG3A 3CNUA 4UEIA 3N7ZA 5AIJA 4QB9A 4PDXA 5A23A 3BKSA 3UY5A 4MY0A 2YHEA 3SXOA 1WFRA
chains in the Genus database with same CATH superfamily
4NURA 2CX7A 2QZTA 3BKRA 2NBMA 3BDQA 1IKTA 4MY3A 4NSSA 2NBNA 5AJLA 4AXHA 2C0LB 2HV2A 2CFZA 3BN8A 5EBVA 4JD6A 2I00A 5IV0A 2CG2A 3SSOA 2CFUA 3SSMA 5EC4A 4JGXA 4AV7A 2NSGA 3RYOA 2KSHA 1C44A 2KSIA 3SXNA 4ZY7A 2OZGA 3R1KA 1PZ4A 1QNDA 2CG3A 3CNUA 4UEIA 3N7ZA 5AIJA 3SSNA 2NSFA 4QB9A 4PDXA 5A23A 3BKSA 3UY5A 4MY0A 2YHEA 3SXOA 1WFRA
chains in the Genus database with same CATH topology
4NURA 2CX7A 2QZTA 3BKRA 2NBMA 3BDQA 1IKTA 4MY3A 2NBNA 5AJLA 4AXHA 2C0LB 2HV2A 2CFZA 3BN8A 5EBVA 4JD6A 2I00A 5IV0A 2CG2A 2CFUA 5EC4A 4JGXA 4AV7A 3RYOA 2KSHA 1C44A 2KSIA 3SXNA 2OZGA 3R1KA 1PZ4A 1QNDA 2CG3A 3CNUA 4UEIA 3N7ZA 5AIJA 4QB9A 4PDXA 5A23A 3BKSA 3UY5A 4MY0A 2YHEA 3SXOA 1WFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUR A;  2CX7 A;  2QZT A;  3BKR A;  2NBM A;  3BDQ A;  1IKT A;  4MY3 A;  2NBN A;  5AJL A;  4AXH A;  2C0L B;  2HV2 A;  2CFZ A;  3BN8 A;  5EBV A;  4JD6 A;  2I00 A;  5IV0 A;  2CG2 A;  2CFU A;  5EC4 A;  4JGX A;  4AV7 A;  3RYO A;  2KSH A;  1C44 A;  2KSI A;  3SXN A;  2OZG A;  3R1K A;  1PZ4 A;  1QND A;  2CG3 A;  3CNU A;  4UEI A;  3N7Z A;  5AIJ A;  4QB9 A;  4PDX A;  5A23 A;  3BKS A;  3UY5 A;  4MY0 A;  2YHE A;  3SXO A;  1WFR A; 
#chains in the Genus database with same CATH topology
 4NUR A;  2CX7 A;  2QZT A;  3BKR A;  2NBM A;  3BDQ A;  1IKT A;  4MY3 A;  4NSS A;  2NBN A;  5AJL A;  4AXH A;  2C0L B;  2HV2 A;  2CFZ A;  3BN8 A;  5EBV A;  4JD6 A;  2I00 A;  5IV0 A;  2CG2 A;  3SSO A;  2CFU A;  3SSM A;  5EC4 A;  4JGX A;  4AV7 A;  2NSG A;  3RYO A;  2KSH A;  1C44 A;  2KSI A;  3SXN A;  4ZY7 A;  2OZG A;  3R1K A;  1PZ4 A;  1QND A;  2CG3 A;  3CNU A;  4UEI A;  3N7Z A;  5AIJ A;  3SSN A;  2NSF A;  4QB9 A;  4PDX A;  5A23 A;  3BKS A;  3UY5 A;  4MY0 A;  2YHE A;  3SXO A;  1WFR A; 
#chains in the Genus database with same CATH homology
 4NUR A;  2CX7 A;  2QZT A;  3BKR A;  2NBM A;  3BDQ A;  1IKT A;  4MY3 A;  2NBN A;  5AJL A;  4AXH A;  2C0L B;  2HV2 A;  2CFZ A;  3BN8 A;  5EBV A;  4JD6 A;  2I00 A;  5IV0 A;  2CG2 A;  2CFU A;  5EC4 A;  4JGX A;  4AV7 A;  3RYO A;  2KSH A;  1C44 A;  2KSI A;  3SXN A;  2OZG A;  3R1K A;  1PZ4 A;  1QND A;  2CG3 A;  3CNU A;  4UEI A;  3N7Z A;  5AIJ A;  4QB9 A;  4PDX A;  5A23 A;  3BKS A;  3UY5 A;  4MY0 A;  2YHE A;  3SXO A;  1WFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...