4UEIA

Solution structure of the sterol carrier protein domain 2 of helicoverpa armigera
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
b'GSSGNPEDFKVFKYMKILEEAMENDTENLIEKVRGIYGFKVRNGPNGAEGYWVINAKEGKGKVTYNGGEKPDVTFTISDEDVVDLISGKLNPQKAFFQGKIKIQGNMGLAMKLTDLQRQAAGRIESI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROL CARRIER PROTEIN 2/3-OXOACYL-COA THIOLASE
publication title NMR Structure and Function of Helicoverpa Armigera Sterol Carrier Protein-2, an Important Insecticidal Target from the Cotton Bollworm.
pubmed doi rcsb
source organism Helicoverpa armigera
molecule tags Transferase
total genus 32
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 4ueiA00
4MY3A 2NBNA 4MY0A 4NURA 2I00A 5A23A 3SXOA 2C0LB 5AIJA 4AV7A 2QZTA 3BDQA 3BN8A 1C44A 2CFUA 2YHEA 4QB9A 3RYOA 5EBVA 2CX7A 2OZGA 4JD6A 3CNUA 1IKTA 3BKRA 3N7ZA 2NBMA 3UY5A 4JGXA 3BKSA 5IV0A 1QNDA 4PDXA 2KSHA 1PZ4A 2CG2A 1WFRA 3SXNA 2CG3A 5EC4A 5AJLA 4UEIA 4AXHA 2CFZA 3R1KA 2HV2A 2KSIA
chains in the Genus database with same CATH superfamily
4MY3A 2NBNA 4MY0A 4NURA 2I00A 5A23A 3SXOA 2NSFA 2C0LB 5AIJA 3SSOA 4AV7A 2QZTA 4ZY7A 3BDQA 3BN8A 1C44A 2CFUA 2YHEA 4QB9A 3RYOA 5EBVA 2CX7A 2OZGA 4JD6A 3SSNA 3CNUA 1IKTA 3BKRA 3N7ZA 2NSGA 2NBMA 3UY5A 3SSMA 4JGXA 3BKSA 5IV0A 1QNDA 4PDXA 2KSHA 1PZ4A 2CG2A 1WFRA 3SXNA 2CG3A 5EC4A 5AJLA 4UEIA 4NSSA 4AXHA 2CFZA 3R1KA 2HV2A 2KSIA
chains in the Genus database with same CATH topology
4MY3A 2NBNA 4MY0A 4NURA 2I00A 5A23A 3SXOA 2C0LB 5AIJA 4AV7A 2QZTA 3BDQA 3BN8A 1C44A 2CFUA 2YHEA 4QB9A 3RYOA 5EBVA 2CX7A 2OZGA 4JD6A 3CNUA 1IKTA 3BKRA 3N7ZA 2NBMA 3UY5A 4JGXA 3BKSA 5IV0A 1QNDA 4PDXA 2KSHA 1PZ4A 2CG2A 1WFRA 3SXNA 2CG3A 5EC4A 5AJLA 4UEIA 4AXHA 2CFZA 3R1KA 2HV2A 2KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY3 A;  2NBN A;  4MY0 A;  4NUR A;  2I00 A;  5A23 A;  3SXO A;  2C0L B;  5AIJ A;  4AV7 A;  2QZT A;  3BDQ A;  3BN8 A;  1C44 A;  2CFU A;  2YHE A;  4QB9 A;  3RYO A;  5EBV A;  2CX7 A;  2OZG A;  4JD6 A;  3CNU A;  1IKT A;  3BKR A;  3N7Z A;  2NBM A;  3UY5 A;  4JGX A;  3BKS A;  5IV0 A;  1QND A;  4PDX A;  2KSH A;  1PZ4 A;  2CG2 A;  1WFR A;  3SXN A;  2CG3 A;  5EC4 A;  5AJL A;  4UEI A;  4AXH A;  2CFZ A;  3R1K A;  2HV2 A;  2KSI A; 
#chains in the Genus database with same CATH topology
 4MY3 A;  2NBN A;  4MY0 A;  4NUR A;  2I00 A;  5A23 A;  3SXO A;  2NSF A;  2C0L B;  5AIJ A;  3SSO A;  4AV7 A;  2QZT A;  4ZY7 A;  3BDQ A;  3BN8 A;  1C44 A;  2CFU A;  2YHE A;  4QB9 A;  3RYO A;  5EBV A;  2CX7 A;  2OZG A;  4JD6 A;  3SSN A;  3CNU A;  1IKT A;  3BKR A;  3N7Z A;  2NSG A;  2NBM A;  3UY5 A;  3SSM A;  4JGX A;  3BKS A;  5IV0 A;  1QND A;  4PDX A;  2KSH A;  1PZ4 A;  2CG2 A;  1WFR A;  3SXN A;  2CG3 A;  5EC4 A;  5AJL A;  4UEI A;  4NSS A;  4AXH A;  2CFZ A;  3R1K A;  2HV2 A;  2KSI A; 
#chains in the Genus database with same CATH homology
 4MY3 A;  2NBN A;  4MY0 A;  4NUR A;  2I00 A;  5A23 A;  3SXO A;  2C0L B;  5AIJ A;  4AV7 A;  2QZT A;  3BDQ A;  3BN8 A;  1C44 A;  2CFU A;  2YHE A;  4QB9 A;  3RYO A;  5EBV A;  2CX7 A;  2OZG A;  4JD6 A;  3CNU A;  1IKT A;  3BKR A;  3N7Z A;  2NBM A;  3UY5 A;  4JGX A;  3BKS A;  5IV0 A;  1QND A;  4PDX A;  2KSH A;  1PZ4 A;  2CG2 A;  1WFR A;  3SXN A;  2CG3 A;  5EC4 A;  5AJL A;  4UEI A;  4AXH A;  2CFZ A;  3R1K A;  2HV2 A;  2KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...