4UEIA

Solution structure of the sterol carrier protein domain 2 of helicoverpa armigera
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
GSSGNPEDFKVFKYMKILEEAMENDTENLIEKVRGIYGFKVRNGPNGAEGYWVINAKEGKGKVTYNGGEKPDVTFTISDEDVVDLISGKLNPQKAFFQGKIKIQGNMGLAMKLTDLQRQAAGRIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure and Function of Helicoverpa Armigera Sterol Carrier Protein-2, an Important Insecticidal Target from the Cotton Bollworm.
pubmed doi rcsb
source organism Helicoverpa armigera
molecule tags Transferase
molecule keywords STEROL CARRIER PROTEIN 2/3-OXOACYL-COA THIOLASE
total genus 32
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 4ueiA00
2CG3A 2CFZA 2KSIA 3SXOA 3BDQA 1C44A 2OZGA 4MY3A 3SXNA 3R1KA 5AIJA 4JD6A 4QB9A 5A23A 1WFRA 2NBMA 3N7ZA 4AXHA 2HV2A 3BKSA 2CFUA 2I00A 2CX7A 1QNDA 2NBNA 3BKRA 4JGXA 1PZ4A 4UEIA 3UY5A 5EC4A 1IKTA 2CG2A 4MY0A 4PDXA 4AV7A 5IV0A 2KSHA 2YHEA 3BN8A 5EBVA 2QZTA 2C0LB 3CNUA 3RYOA 4NURA 5AJLA
chains in the Genus database with same CATH superfamily
2CG3A 2CFZA 2KSIA 3SXOA 3BDQA 1C44A 2OZGA 4MY3A 3SSMA 3SXNA 3R1KA 5AIJA 4JD6A 4QB9A 5A23A 1WFRA 2NBMA 4ZY7A 3N7ZA 4AXHA 2HV2A 3BKSA 2NSGA 2CFUA 2I00A 2CX7A 1QNDA 2NBNA 3BKRA 4JGXA 1PZ4A 4UEIA 3UY5A 5EC4A 1IKTA 2CG2A 4MY0A 4PDXA 4NSSA 4AV7A 5IV0A 2KSHA 2YHEA 3BN8A 5EBVA 3SSNA 2QZTA 2C0LB 2NSFA 3CNUA 3RYOA 4NURA 3SSOA 5AJLA
chains in the Genus database with same CATH topology
2CG3A 2CFZA 2KSIA 3SXOA 3BDQA 1C44A 2OZGA 4MY3A 3SXNA 3R1KA 5AIJA 4JD6A 4QB9A 5A23A 1WFRA 2NBMA 3N7ZA 4AXHA 2HV2A 3BKSA 2CFUA 2I00A 2CX7A 1QNDA 2NBNA 3BKRA 4JGXA 1PZ4A 4UEIA 3UY5A 5EC4A 1IKTA 2CG2A 4MY0A 4PDXA 4AV7A 5IV0A 2KSHA 2YHEA 3BN8A 5EBVA 2QZTA 2C0LB 3CNUA 3RYOA 4NURA 5AJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CG3 A;  2CFZ A;  2KSI A;  3SXO A;  3BDQ A;  1C44 A;  2OZG A;  4MY3 A;  3SXN A;  3R1K A;  5AIJ A;  4JD6 A;  4QB9 A;  5A23 A;  1WFR A;  2NBM A;  3N7Z A;  4AXH A;  2HV2 A;  3BKS A;  2CFU A;  2I00 A;  2CX7 A;  1QND A;  2NBN A;  3BKR A;  4JGX A;  1PZ4 A;  4UEI A;  3UY5 A;  5EC4 A;  1IKT A;  2CG2 A;  4MY0 A;  4PDX A;  4AV7 A;  5IV0 A;  2KSH A;  2YHE A;  3BN8 A;  5EBV A;  2QZT A;  2C0L B;  3CNU A;  3RYO A;  4NUR A;  5AJL A; 
#chains in the Genus database with same CATH topology
 2CG3 A;  2CFZ A;  2KSI A;  3SXO A;  3BDQ A;  1C44 A;  2OZG A;  4MY3 A;  3SSM A;  3SXN A;  3R1K A;  5AIJ A;  4JD6 A;  4QB9 A;  5A23 A;  1WFR A;  2NBM A;  4ZY7 A;  3N7Z A;  4AXH A;  2HV2 A;  3BKS A;  2NSG A;  2CFU A;  2I00 A;  2CX7 A;  1QND A;  2NBN A;  3BKR A;  4JGX A;  1PZ4 A;  4UEI A;  3UY5 A;  5EC4 A;  1IKT A;  2CG2 A;  4MY0 A;  4PDX A;  4NSS A;  4AV7 A;  5IV0 A;  2KSH A;  2YHE A;  3BN8 A;  5EBV A;  3SSN A;  2QZT A;  2C0L B;  2NSF A;  3CNU A;  3RYO A;  4NUR A;  3SSO A;  5AJL A; 
#chains in the Genus database with same CATH homology
 2CG3 A;  2CFZ A;  2KSI A;  3SXO A;  3BDQ A;  1C44 A;  2OZG A;  4MY3 A;  3SXN A;  3R1K A;  5AIJ A;  4JD6 A;  4QB9 A;  5A23 A;  1WFR A;  2NBM A;  3N7Z A;  4AXH A;  2HV2 A;  3BKS A;  2CFU A;  2I00 A;  2CX7 A;  1QND A;  2NBN A;  3BKR A;  4JGX A;  1PZ4 A;  4UEI A;  3UY5 A;  5EC4 A;  1IKT A;  2CG2 A;  4MY0 A;  4PDX A;  4AV7 A;  5IV0 A;  2KSH A;  2YHE A;  3BN8 A;  5EBV A;  2QZT A;  2C0L B;  3CNU A;  3RYO A;  4NUR A;  5AJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...