4UEIA

Solution structure of the sterol carrier protein domain 2 of helicoverpa armigera
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
127
structure length
127
Chain Sequence
GSSGNPEDFKVFKYMKILEEAMENDTENLIEKVRGIYGFKVRNGPNGAEGYWVINAKEGKGKVTYNGGEKPDVTFTISDEDVVDLISGKLNPQKAFFQGKIKIQGNMGLAMKLTDLQRQAAGRIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure and Function of Helicoverpa Armigera Sterol Carrier Protein-2, an Important Insecticidal Target from the Cotton Bollworm.
pubmed doi rcsb
source organism Helicoverpa armigera
molecule tags Transferase
molecule keywords STEROL CARRIER PROTEIN 2/3-OXOACYL-COA THIOLASE
total genus 32
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 4ueiA00
1WFRA 4AXHA 2CG3A 4AV7A 5AIJA 4JD6A 3N7ZA 4NURA 2YHEA 2NBMA 2HV2A 3BKSA 2CFUA 5EC4A 3CNUA 5AJLA 2QZTA 2CFZA 3RYOA 2CX7A 1C44A 2C0LB 3BDQA 3UY5A 4MY0A 2I00A 2NBNA 5A23A 3BKRA 4JGXA 2KSHA 5IV0A 1IKTA 2CG2A 3BN8A 3R1KA 3SXNA 3SXOA 4PDXA 2KSIA 4QB9A 5EBVA 1PZ4A 2OZGA 1QNDA 4UEIA 4MY3A
chains in the Genus database with same CATH superfamily
1WFRA 3SSMA 4NSSA 4AXHA 2CG3A 4AV7A 5AIJA 4JD6A 3N7ZA 4NURA 2YHEA 2NBMA 2HV2A 2NSFA 3BKSA 2CFUA 3SSOA 5EC4A 3CNUA 5AJLA 2QZTA 2CFZA 3RYOA 2CX7A 1C44A 2C0LB 3BDQA 3UY5A 4MY0A 2I00A 2NBNA 5A23A 3BKRA 4JGXA 2KSHA 5IV0A 1IKTA 2CG2A 3BN8A 3R1KA 3SXNA 3SSNA 3SXOA 2NSGA 4ZY7A 4PDXA 2KSIA 4QB9A 5EBVA 1PZ4A 2OZGA 1QNDA 4UEIA 4MY3A
chains in the Genus database with same CATH topology
1WFRA 4AXHA 2CG3A 4AV7A 5AIJA 4JD6A 3N7ZA 4NURA 2YHEA 2NBMA 2HV2A 3BKSA 2CFUA 5EC4A 3CNUA 5AJLA 2QZTA 2CFZA 3RYOA 2CX7A 1C44A 2C0LB 3BDQA 3UY5A 4MY0A 2I00A 2NBNA 5A23A 3BKRA 4JGXA 2KSHA 5IV0A 1IKTA 2CG2A 3BN8A 3R1KA 3SXNA 3SXOA 4PDXA 2KSIA 4QB9A 5EBVA 1PZ4A 2OZGA 1QNDA 4UEIA 4MY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFR A;  4AXH A;  2CG3 A;  4AV7 A;  5AIJ A;  4JD6 A;  3N7Z A;  4NUR A;  2YHE A;  2NBM A;  2HV2 A;  3BKS A;  2CFU A;  5EC4 A;  3CNU A;  5AJL A;  2QZT A;  2CFZ A;  3RYO A;  2CX7 A;  1C44 A;  2C0L B;  3BDQ A;  3UY5 A;  4MY0 A;  2I00 A;  2NBN A;  5A23 A;  3BKR A;  4JGX A;  2KSH A;  5IV0 A;  1IKT A;  2CG2 A;  3BN8 A;  3R1K A;  3SXN A;  3SXO A;  4PDX A;  2KSI A;  4QB9 A;  5EBV A;  1PZ4 A;  2OZG A;  1QND A;  4UEI A;  4MY3 A; 
#chains in the Genus database with same CATH topology
 1WFR A;  3SSM A;  4NSS A;  4AXH A;  2CG3 A;  4AV7 A;  5AIJ A;  4JD6 A;  3N7Z A;  4NUR A;  2YHE A;  2NBM A;  2HV2 A;  2NSF A;  3BKS A;  2CFU A;  3SSO A;  5EC4 A;  3CNU A;  5AJL A;  2QZT A;  2CFZ A;  3RYO A;  2CX7 A;  1C44 A;  2C0L B;  3BDQ A;  3UY5 A;  4MY0 A;  2I00 A;  2NBN A;  5A23 A;  3BKR A;  4JGX A;  2KSH A;  5IV0 A;  1IKT A;  2CG2 A;  3BN8 A;  3R1K A;  3SXN A;  3SSN A;  3SXO A;  2NSG A;  4ZY7 A;  4PDX A;  2KSI A;  4QB9 A;  5EBV A;  1PZ4 A;  2OZG A;  1QND A;  4UEI A;  4MY3 A; 
#chains in the Genus database with same CATH homology
 1WFR A;  4AXH A;  2CG3 A;  4AV7 A;  5AIJ A;  4JD6 A;  3N7Z A;  4NUR A;  2YHE A;  2NBM A;  2HV2 A;  3BKS A;  2CFU A;  5EC4 A;  3CNU A;  5AJL A;  2QZT A;  2CFZ A;  3RYO A;  2CX7 A;  1C44 A;  2C0L B;  3BDQ A;  3UY5 A;  4MY0 A;  2I00 A;  2NBN A;  5A23 A;  3BKR A;  4JGX A;  2KSH A;  5IV0 A;  1IKT A;  2CG2 A;  3BN8 A;  3R1K A;  3SXN A;  3SXO A;  4PDX A;  2KSI A;  4QB9 A;  5EBV A;  1PZ4 A;  2OZG A;  1QND A;  4UEI A;  4MY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...