2KSHA

Solution nmr structure of apo sterol carrier protein - 2 from aedes aegypti (aescp-2)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of apo Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2)
rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
molecule keywords Sterol carrier protein 2
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2kshA00
4MY0A 3SXOA 2CX7A 3BKRA 2KSHA 2KSIA 1PZ4A 2CFZA 1WFRA 4NURA 3BKSA 3R1KA 2OZGA 2CFUA 4QB9A 4UEIA 5EC4A 5EBVA 4AV7A 4JD6A 2QZTA 3BN8A 4PDXA 5AJLA 2CG2A 3UY5A 1QNDA 2HV2A 1IKTA 3N7ZA 3RYOA 4AXHA 5IV0A 2NBNA 2NBMA 4JGXA 3CNUA 2CG3A 2C0LB 4MY3A 3SXNA 3BDQA 5AIJA 2I00A 1C44A 2YHEA 5A23A
chains in the Genus database with same CATH superfamily
4MY0A 3SXOA 4NSSA 2CX7A 3BKRA 2KSHA 2KSIA 1PZ4A 2CFZA 1WFRA 4NURA 3BKSA 3R1KA 2OZGA 2CFUA 4QB9A 4UEIA 3SSOA 5EC4A 5EBVA 4AV7A 4ZY7A 4JD6A 2QZTA 3BN8A 4PDXA 5AJLA 3SSMA 2CG2A 3SSNA 3UY5A 1QNDA 2NSGA 2HV2A 1IKTA 3N7ZA 3RYOA 2NSFA 4AXHA 5IV0A 2NBNA 2NBMA 4JGXA 3CNUA 2CG3A 2C0LB 4MY3A 3SXNA 3BDQA 5AIJA 2I00A 1C44A 2YHEA 5A23A
chains in the Genus database with same CATH topology
4MY0A 3SXOA 2CX7A 3BKRA 2KSHA 2KSIA 1PZ4A 2CFZA 1WFRA 4NURA 3BKSA 3R1KA 2OZGA 2CFUA 4QB9A 4UEIA 5EC4A 5EBVA 4AV7A 4JD6A 2QZTA 3BN8A 4PDXA 5AJLA 2CG2A 3UY5A 1QNDA 2HV2A 1IKTA 3N7ZA 3RYOA 4AXHA 5IV0A 2NBNA 2NBMA 4JGXA 3CNUA 2CG3A 2C0LB 4MY3A 3SXNA 3BDQA 5AIJA 2I00A 1C44A 2YHEA 5A23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY0 A;  3SXO A;  2CX7 A;  3BKR A;  2KSH A;  2KSI A;  1PZ4 A;  2CFZ A;  1WFR A;  4NUR A;  3BKS A;  3R1K A;  2OZG A;  2CFU A;  4QB9 A;  4UEI A;  5EC4 A;  5EBV A;  4AV7 A;  4JD6 A;  2QZT A;  3BN8 A;  4PDX A;  5AJL A;  2CG2 A;  3UY5 A;  1QND A;  2HV2 A;  1IKT A;  3N7Z A;  3RYO A;  4AXH A;  5IV0 A;  2NBN A;  2NBM A;  4JGX A;  3CNU A;  2CG3 A;  2C0L B;  4MY3 A;  3SXN A;  3BDQ A;  5AIJ A;  2I00 A;  1C44 A;  2YHE A;  5A23 A; 
#chains in the Genus database with same CATH topology
 4MY0 A;  3SXO A;  4NSS A;  2CX7 A;  3BKR A;  2KSH A;  2KSI A;  1PZ4 A;  2CFZ A;  1WFR A;  4NUR A;  3BKS A;  3R1K A;  2OZG A;  2CFU A;  4QB9 A;  4UEI A;  3SSO A;  5EC4 A;  5EBV A;  4AV7 A;  4ZY7 A;  4JD6 A;  2QZT A;  3BN8 A;  4PDX A;  5AJL A;  3SSM A;  2CG2 A;  3SSN A;  3UY5 A;  1QND A;  2NSG A;  2HV2 A;  1IKT A;  3N7Z A;  3RYO A;  2NSF A;  4AXH A;  5IV0 A;  2NBN A;  2NBM A;  4JGX A;  3CNU A;  2CG3 A;  2C0L B;  4MY3 A;  3SXN A;  3BDQ A;  5AIJ A;  2I00 A;  1C44 A;  2YHE A;  5A23 A; 
#chains in the Genus database with same CATH homology
 4MY0 A;  3SXO A;  2CX7 A;  3BKR A;  2KSH A;  2KSI A;  1PZ4 A;  2CFZ A;  1WFR A;  4NUR A;  3BKS A;  3R1K A;  2OZG A;  2CFU A;  4QB9 A;  4UEI A;  5EC4 A;  5EBV A;  4AV7 A;  4JD6 A;  2QZT A;  3BN8 A;  4PDX A;  5AJL A;  2CG2 A;  3UY5 A;  1QND A;  2HV2 A;  1IKT A;  3N7Z A;  3RYO A;  4AXH A;  5IV0 A;  2NBN A;  2NBM A;  4JGX A;  3CNU A;  2CG3 A;  2C0L B;  4MY3 A;  3SXN A;  3BDQ A;  5AIJ A;  2I00 A;  1C44 A;  2YHE A;  5A23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...