2KSHA

Solution nmr structure of apo sterol carrier protein - 2 from aedes aegypti (aescp-2)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
b'MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2
publication title Solution NMR structure of apo Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2)
rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2kshA00
4AXHA 3UY5A 4NURA 5EBVA 4PDXA 2QZTA 1PZ4A 2NBNA 4JGXA 2CFUA 2C0LB 1QNDA 2I00A 1WFRA 2CX7A 5A23A 3BDQA 3BN8A 4MY0A 3SXOA 3SXNA 4QB9A 5AJLA 3CNUA 2HV2A 4MY3A 2YHEA 2CFZA 4JD6A 5IV0A 2CG3A 2CG2A 3BKSA 3RYOA 3BKRA 2OZGA 5AIJA 1C44A 2KSHA 2KSIA 3R1KA 1IKTA 4UEIA 5EC4A 4AV7A 3N7ZA 2NBMA
chains in the Genus database with same CATH superfamily
4AXHA 3UY5A 4NURA 5EBVA 4PDXA 2QZTA 1PZ4A 2NBNA 3SSNA 4JGXA 2CFUA 2C0LB 1QNDA 2I00A 1WFRA 2CX7A 5A23A 3BDQA 3BN8A 4MY0A 3SXOA 3SXNA 4QB9A 5AJLA 3CNUA 2HV2A 4MY3A 2YHEA 2CFZA 4ZY7A 4JD6A 5IV0A 2CG3A 2CG2A 3BKSA 3SSOA 2NSGA 3RYOA 4NSSA 3BKRA 2OZGA 5AIJA 3SSMA 1C44A 2KSHA 2KSIA 3R1KA 1IKTA 4UEIA 5EC4A 4AV7A 2NSFA 3N7ZA 2NBMA
chains in the Genus database with same CATH topology
4AXHA 3UY5A 4NURA 5EBVA 4PDXA 2QZTA 1PZ4A 2NBNA 4JGXA 2CFUA 2C0LB 1QNDA 2I00A 1WFRA 2CX7A 5A23A 3BDQA 3BN8A 4MY0A 3SXOA 3SXNA 4QB9A 5AJLA 3CNUA 2HV2A 4MY3A 2YHEA 2CFZA 4JD6A 5IV0A 2CG3A 2CG2A 3BKSA 3RYOA 3BKRA 2OZGA 5AIJA 1C44A 2KSHA 2KSIA 3R1KA 1IKTA 4UEIA 5EC4A 4AV7A 3N7ZA 2NBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXH A;  3UY5 A;  4NUR A;  5EBV A;  4PDX A;  2QZT A;  1PZ4 A;  2NBN A;  4JGX A;  2CFU A;  2C0L B;  1QND A;  2I00 A;  1WFR A;  2CX7 A;  5A23 A;  3BDQ A;  3BN8 A;  4MY0 A;  3SXO A;  3SXN A;  4QB9 A;  5AJL A;  3CNU A;  2HV2 A;  4MY3 A;  2YHE A;  2CFZ A;  4JD6 A;  5IV0 A;  2CG3 A;  2CG2 A;  3BKS A;  3RYO A;  3BKR A;  2OZG A;  5AIJ A;  1C44 A;  2KSH A;  2KSI A;  3R1K A;  1IKT A;  4UEI A;  5EC4 A;  4AV7 A;  3N7Z A;  2NBM A; 
#chains in the Genus database with same CATH topology
 4AXH A;  3UY5 A;  4NUR A;  5EBV A;  4PDX A;  2QZT A;  1PZ4 A;  2NBN A;  3SSN A;  4JGX A;  2CFU A;  2C0L B;  1QND A;  2I00 A;  1WFR A;  2CX7 A;  5A23 A;  3BDQ A;  3BN8 A;  4MY0 A;  3SXO A;  3SXN A;  4QB9 A;  5AJL A;  3CNU A;  2HV2 A;  4MY3 A;  2YHE A;  2CFZ A;  4ZY7 A;  4JD6 A;  5IV0 A;  2CG3 A;  2CG2 A;  3BKS A;  3SSO A;  2NSG A;  3RYO A;  4NSS A;  3BKR A;  2OZG A;  5AIJ A;  3SSM A;  1C44 A;  2KSH A;  2KSI A;  3R1K A;  1IKT A;  4UEI A;  5EC4 A;  4AV7 A;  2NSF A;  3N7Z A;  2NBM A; 
#chains in the Genus database with same CATH homology
 4AXH A;  3UY5 A;  4NUR A;  5EBV A;  4PDX A;  2QZT A;  1PZ4 A;  2NBN A;  4JGX A;  2CFU A;  2C0L B;  1QND A;  2I00 A;  1WFR A;  2CX7 A;  5A23 A;  3BDQ A;  3BN8 A;  4MY0 A;  3SXO A;  3SXN A;  4QB9 A;  5AJL A;  3CNU A;  2HV2 A;  4MY3 A;  2YHE A;  2CFZ A;  4JD6 A;  5IV0 A;  2CG3 A;  2CG2 A;  3BKS A;  3RYO A;  3BKR A;  2OZG A;  5AIJ A;  1C44 A;  2KSH A;  2KSI A;  3R1K A;  1IKT A;  4UEI A;  5EC4 A;  4AV7 A;  3N7Z A;  2NBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...