2KSHA

Solution nmr structure of apo sterol carrier protein - 2 from aedes aegypti (aescp-2)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALPAKEAMAQDKMEVDGQVELIFLLEPFIASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sterol carrier protein 2
publication title Solution NMR structure of apo Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2)
rcsb
source organism Aedes aegypti
molecule tags Lipid binding protein
total genus 22
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2kshA00
4PDXA 3BKRA 3RYOA 5AIJA 3BN8A 5EBVA 3SXNA 5AJLA 4JD6A 4MY0A 2NBMA 2CFZA 4AV7A 1IKTA 2HV2A 1C44A 2OZGA 3CNUA 3SXOA 5EC4A 5A23A 4UEIA 3R1KA 2QZTA 2CX7A 2I00A 1QNDA 2KSHA 1PZ4A 4AXHA 2NBNA 1WFRA 2C0LB 3BDQA 2CG3A 2CFUA 3N7ZA 3BKSA 4MY3A 4JGXA 4QB9A 3UY5A 4NURA 5IV0A 2KSIA 2CG2A 2YHEA
chains in the Genus database with same CATH superfamily
4PDXA 3BKRA 3RYOA 5AIJA 3BN8A 5EBVA 3SXNA 5AJLA 4JD6A 4MY0A 2NBMA 2CFZA 4AV7A 1IKTA 2HV2A 1C44A 2OZGA 3CNUA 4ZY7A 3SXOA 5EC4A 5A23A 4UEIA 3R1KA 2QZTA 2CX7A 2I00A 2NSGA 1QNDA 2KSHA 1PZ4A 3SSNA 4NSSA 4AXHA 2NBNA 1WFRA 2C0LB 3BDQA 3SSMA 2CG3A 2CFUA 3N7ZA 3BKSA 4MY3A 4JGXA 3SSOA 4QB9A 3UY5A 4NURA 5IV0A 2KSIA 2CG2A 2NSFA 2YHEA
chains in the Genus database with same CATH topology
4PDXA 3BKRA 3RYOA 5AIJA 3BN8A 5EBVA 3SXNA 5AJLA 4JD6A 4MY0A 2NBMA 2CFZA 4AV7A 1IKTA 2HV2A 1C44A 2OZGA 3CNUA 3SXOA 5EC4A 5A23A 4UEIA 3R1KA 2QZTA 2CX7A 2I00A 1QNDA 2KSHA 1PZ4A 4AXHA 2NBNA 1WFRA 2C0LB 3BDQA 2CG3A 2CFUA 3N7ZA 3BKSA 4MY3A 4JGXA 4QB9A 3UY5A 4NURA 5IV0A 2KSIA 2CG2A 2YHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDX A;  3BKR A;  3RYO A;  5AIJ A;  3BN8 A;  5EBV A;  3SXN A;  5AJL A;  4JD6 A;  4MY0 A;  2NBM A;  2CFZ A;  4AV7 A;  1IKT A;  2HV2 A;  1C44 A;  2OZG A;  3CNU A;  3SXO A;  5EC4 A;  5A23 A;  4UEI A;  3R1K A;  2QZT A;  2CX7 A;  2I00 A;  1QND A;  2KSH A;  1PZ4 A;  4AXH A;  2NBN A;  1WFR A;  2C0L B;  3BDQ A;  2CG3 A;  2CFU A;  3N7Z A;  3BKS A;  4MY3 A;  4JGX A;  4QB9 A;  3UY5 A;  4NUR A;  5IV0 A;  2KSI A;  2CG2 A;  2YHE A; 
#chains in the Genus database with same CATH topology
 4PDX A;  3BKR A;  3RYO A;  5AIJ A;  3BN8 A;  5EBV A;  3SXN A;  5AJL A;  4JD6 A;  4MY0 A;  2NBM A;  2CFZ A;  4AV7 A;  1IKT A;  2HV2 A;  1C44 A;  2OZG A;  3CNU A;  4ZY7 A;  3SXO A;  5EC4 A;  5A23 A;  4UEI A;  3R1K A;  2QZT A;  2CX7 A;  2I00 A;  2NSG A;  1QND A;  2KSH A;  1PZ4 A;  3SSN A;  4NSS A;  4AXH A;  2NBN A;  1WFR A;  2C0L B;  3BDQ A;  3SSM A;  2CG3 A;  2CFU A;  3N7Z A;  3BKS A;  4MY3 A;  4JGX A;  3SSO A;  4QB9 A;  3UY5 A;  4NUR A;  5IV0 A;  2KSI A;  2CG2 A;  2NSF A;  2YHE A; 
#chains in the Genus database with same CATH homology
 4PDX A;  3BKR A;  3RYO A;  5AIJ A;  3BN8 A;  5EBV A;  3SXN A;  5AJL A;  4JD6 A;  4MY0 A;  2NBM A;  2CFZ A;  4AV7 A;  1IKT A;  2HV2 A;  1C44 A;  2OZG A;  3CNU A;  3SXO A;  5EC4 A;  5A23 A;  4UEI A;  3R1K A;  2QZT A;  2CX7 A;  2I00 A;  1QND A;  2KSH A;  1PZ4 A;  4AXH A;  2NBN A;  1WFR A;  2C0L B;  3BDQ A;  2CG3 A;  2CFU A;  3N7Z A;  3BKS A;  4MY3 A;  4JGX A;  4QB9 A;  3UY5 A;  4NUR A;  5IV0 A;  2KSI A;  2CG2 A;  2YHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...