2C0LB

Tpr domain of human pex5p in complex with human mscp2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
SASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/receptor
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
total genus 35
structure length 122
sequence length 122
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2c0lB00
2QZTA 3BKRA 2OZGA 1QNDA 4JD6A 2HV2A 4JGXA 4NURA 4QB9A 2KSIA 2CG3A 2CG2A 3SXNA 4UEIA 2I00A 3BKSA 4AXHA 5IV0A 3CNUA 1IKTA 3BDQA 5AJLA 2C0LB 2YHEA 1C44A 2CX7A 2CFZA 4MY3A 3UY5A 3R1KA 4MY0A 5EC4A 4AV7A 5A23A 1WFRA 1PZ4A 2KSHA 3RYOA 3N7ZA 5EBVA 4PDXA 2CFUA 2NBMA 3SXOA 3BN8A 2NBNA 5AIJA
chains in the Genus database with same CATH superfamily
2QZTA 2NSFA 3BKRA 2OZGA 1QNDA 4JD6A 2HV2A 4JGXA 4NURA 3SSNA 4QB9A 3SSOA 2NSGA 2KSIA 2CG3A 2CG2A 3SXNA 4UEIA 2I00A 3BKSA 4AXHA 5IV0A 3CNUA 1IKTA 3BDQA 5AJLA 2C0LB 2YHEA 1C44A 2CX7A 2CFZA 4MY3A 3UY5A 3R1KA 4MY0A 5EC4A 4AV7A 5A23A 1WFRA 1PZ4A 2KSHA 3RYOA 3N7ZA 3SSMA 4NSSA 4ZY7A 5EBVA 4PDXA 2CFUA 2NBMA 3SXOA 3BN8A 2NBNA 5AIJA
chains in the Genus database with same CATH topology
2QZTA 3BKRA 2OZGA 1QNDA 4JD6A 2HV2A 4JGXA 4NURA 4QB9A 2KSIA 2CG3A 2CG2A 3SXNA 4UEIA 2I00A 3BKSA 4AXHA 5IV0A 3CNUA 1IKTA 3BDQA 5AJLA 2C0LB 2YHEA 1C44A 2CX7A 2CFZA 4MY3A 3UY5A 3R1KA 4MY0A 5EC4A 4AV7A 5A23A 1WFRA 1PZ4A 2KSHA 3RYOA 3N7ZA 5EBVA 4PDXA 2CFUA 2NBMA 3SXOA 3BN8A 2NBNA 5AIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZT A;  3BKR A;  2OZG A;  1QND A;  4JD6 A;  2HV2 A;  4JGX A;  4NUR A;  4QB9 A;  2KSI A;  2CG3 A;  2CG2 A;  3SXN A;  4UEI A;  2I00 A;  3BKS A;  4AXH A;  5IV0 A;  3CNU A;  1IKT A;  3BDQ A;  5AJL A;  2C0L B;  2YHE A;  1C44 A;  2CX7 A;  2CFZ A;  4MY3 A;  3UY5 A;  3R1K A;  4MY0 A;  5EC4 A;  4AV7 A;  5A23 A;  1WFR A;  1PZ4 A;  2KSH A;  3RYO A;  3N7Z A;  5EBV A;  4PDX A;  2CFU A;  2NBM A;  3SXO A;  3BN8 A;  2NBN A;  5AIJ A; 
#chains in the Genus database with same CATH topology
 2QZT A;  2NSF A;  3BKR A;  2OZG A;  1QND A;  4JD6 A;  2HV2 A;  4JGX A;  4NUR A;  3SSN A;  4QB9 A;  3SSO A;  2NSG A;  2KSI A;  2CG3 A;  2CG2 A;  3SXN A;  4UEI A;  2I00 A;  3BKS A;  4AXH A;  5IV0 A;  3CNU A;  1IKT A;  3BDQ A;  5AJL A;  2C0L B;  2YHE A;  1C44 A;  2CX7 A;  2CFZ A;  4MY3 A;  3UY5 A;  3R1K A;  4MY0 A;  5EC4 A;  4AV7 A;  5A23 A;  1WFR A;  1PZ4 A;  2KSH A;  3RYO A;  3N7Z A;  3SSM A;  4NSS A;  4ZY7 A;  5EBV A;  4PDX A;  2CFU A;  2NBM A;  3SXO A;  3BN8 A;  2NBN A;  5AIJ A; 
#chains in the Genus database with same CATH homology
 2QZT A;  3BKR A;  2OZG A;  1QND A;  4JD6 A;  2HV2 A;  4JGX A;  4NUR A;  4QB9 A;  2KSI A;  2CG3 A;  2CG2 A;  3SXN A;  4UEI A;  2I00 A;  3BKS A;  4AXH A;  5IV0 A;  3CNU A;  1IKT A;  3BDQ A;  5AJL A;  2C0L B;  2YHE A;  1C44 A;  2CX7 A;  2CFZ A;  4MY3 A;  3UY5 A;  3R1K A;  4MY0 A;  5EC4 A;  4AV7 A;  5A23 A;  1WFR A;  1PZ4 A;  2KSH A;  3RYO A;  3N7Z A;  5EBV A;  4PDX A;  2CFU A;  2NBM A;  3SXO A;  3BN8 A;  2NBN A;  5AIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...