2C0LB

Tpr domain of human pex5p in complex with human mscp2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
b'SASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/receptor
total genus 35
structure length 122
sequence length 122
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2c0lB00
3N7ZA 4MY3A 1PZ4A 3BN8A 3R1KA 2QZTA 2YHEA 2CFUA 2I00A 1WFRA 3RYOA 2NBNA 2KSIA 4MY0A 3BDQA 4JD6A 2OZGA 5EBVA 1QNDA 5IV0A 2CG3A 3UY5A 2HV2A 4AV7A 5EC4A 2CX7A 2C0LB 4QB9A 1IKTA 4UEIA 5AJLA 3SXNA 5A23A 4JGXA 4AXHA 2CG2A 4PDXA 2CFZA 2KSHA 3BKRA 3CNUA 3SXOA 4NURA 3BKSA 2NBMA 1C44A 5AIJA
chains in the Genus database with same CATH superfamily
3N7ZA 4MY3A 1PZ4A 3SSNA 3BN8A 3R1KA 2QZTA 2YHEA 2CFUA 2I00A 1WFRA 4NSSA 2NBNA 2KSIA 4MY0A 3RYOA 3BDQA 4JD6A 2OZGA 5EBVA 1QNDA 5IV0A 3SSMA 2CG3A 2NSFA 3UY5A 2HV2A 4AV7A 5EC4A 2CX7A 4ZY7A 2C0LB 4QB9A 1IKTA 4UEIA 5AJLA 3SXNA 5A23A 4JGXA 3SSOA 4AXHA 2CG2A 4PDXA 2CFZA 2NSGA 2KSHA 3BKRA 3CNUA 3SXOA 4NURA 3BKSA 2NBMA 1C44A 5AIJA
chains in the Genus database with same CATH topology
3N7ZA 4MY3A 1PZ4A 3BN8A 3R1KA 2QZTA 2YHEA 2CFUA 2I00A 1WFRA 3RYOA 2NBNA 2KSIA 4MY0A 3BDQA 4JD6A 2OZGA 5EBVA 1QNDA 5IV0A 2CG3A 3UY5A 2HV2A 4AV7A 5EC4A 2CX7A 2C0LB 4QB9A 1IKTA 4UEIA 5AJLA 3SXNA 5A23A 4JGXA 4AXHA 2CG2A 4PDXA 2CFZA 2KSHA 3BKRA 3CNUA 3SXOA 4NURA 3BKSA 2NBMA 1C44A 5AIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7Z A;  4MY3 A;  1PZ4 A;  3BN8 A;  3R1K A;  2QZT A;  2YHE A;  2CFU A;  2I00 A;  1WFR A;  3RYO A;  2NBN A;  2KSI A;  4MY0 A;  3BDQ A;  4JD6 A;  2OZG A;  5EBV A;  1QND A;  5IV0 A;  2CG3 A;  3UY5 A;  2HV2 A;  4AV7 A;  5EC4 A;  2CX7 A;  2C0L B;  4QB9 A;  1IKT A;  4UEI A;  5AJL A;  3SXN A;  5A23 A;  4JGX A;  4AXH A;  2CG2 A;  4PDX A;  2CFZ A;  2KSH A;  3BKR A;  3CNU A;  3SXO A;  4NUR A;  3BKS A;  2NBM A;  1C44 A;  5AIJ A; 
#chains in the Genus database with same CATH topology
 3N7Z A;  4MY3 A;  1PZ4 A;  3SSN A;  3BN8 A;  3R1K A;  2QZT A;  2YHE A;  2CFU A;  2I00 A;  1WFR A;  4NSS A;  2NBN A;  2KSI A;  4MY0 A;  3RYO A;  3BDQ A;  4JD6 A;  2OZG A;  5EBV A;  1QND A;  5IV0 A;  3SSM A;  2CG3 A;  2NSF A;  3UY5 A;  2HV2 A;  4AV7 A;  5EC4 A;  2CX7 A;  4ZY7 A;  2C0L B;  4QB9 A;  1IKT A;  4UEI A;  5AJL A;  3SXN A;  5A23 A;  4JGX A;  3SSO A;  4AXH A;  2CG2 A;  4PDX A;  2CFZ A;  2NSG A;  2KSH A;  3BKR A;  3CNU A;  3SXO A;  4NUR A;  3BKS A;  2NBM A;  1C44 A;  5AIJ A; 
#chains in the Genus database with same CATH homology
 3N7Z A;  4MY3 A;  1PZ4 A;  3BN8 A;  3R1K A;  2QZT A;  2YHE A;  2CFU A;  2I00 A;  1WFR A;  3RYO A;  2NBN A;  2KSI A;  4MY0 A;  3BDQ A;  4JD6 A;  2OZG A;  5EBV A;  1QND A;  5IV0 A;  2CG3 A;  3UY5 A;  2HV2 A;  4AV7 A;  5EC4 A;  2CX7 A;  2C0L B;  4QB9 A;  1IKT A;  4UEI A;  5AJL A;  3SXN A;  5A23 A;  4JGX A;  4AXH A;  2CG2 A;  4PDX A;  2CFZ A;  2KSH A;  3BKR A;  3CNU A;  3SXO A;  4NUR A;  3BKS A;  2NBM A;  1C44 A;  5AIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...