2C0LB

Tpr domain of human pex5p in complex with human mscp2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
SASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/receptor
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
total genus 35
structure length 122
sequence length 122
ec nomenclature ec 2.3.1.176: Propanoyl-CoA C-acyltransferase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02036 SCP2 SCP-2 sterol transfer family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1050.10 Alpha Beta 2-Layer Sandwich Nonspecific Lipid-transfer Protein; Chain A SCP2 sterol-binding domain 2c0lB00
4MY0A 4QB9A 3R1KA 2NBMA 4UEIA 2HV2A 3BDQA 2KSHA 2CG2A 5EBVA 1IKTA 3RYOA 2QZTA 1C44A 3CNUA 4PDXA 3SXNA 4JD6A 4AXHA 3BKSA 2CFZA 2C0LB 4NURA 1QNDA 3UY5A 2CFUA 2NBNA 5EC4A 5IV0A 2CX7A 5A23A 5AIJA 2YHEA 4JGXA 4MY3A 1PZ4A 3N7ZA 4AV7A 3SXOA 5AJLA 3BN8A 2I00A 2KSIA 1WFRA 3BKRA 2OZGA 2CG3A
chains in the Genus database with same CATH superfamily
4MY0A 4QB9A 2NSFA 3R1KA 2NBMA 4UEIA 2HV2A 3BDQA 3SSMA 2KSHA 2CG2A 5EBVA 1IKTA 3RYOA 2QZTA 1C44A 3CNUA 4PDXA 3SXNA 4JD6A 4AXHA 4NSSA 3BKSA 2CFZA 2C0LB 4NURA 4ZY7A 1QNDA 3SSOA 3UY5A 2CFUA 2NBNA 5EC4A 5IV0A 2CX7A 5A23A 5AIJA 2YHEA 4JGXA 4MY3A 1PZ4A 3N7ZA 4AV7A 3SSNA 3SXOA 5AJLA 3BN8A 2I00A 2KSIA 1WFRA 3BKRA 2NSGA 2OZGA 2CG3A
chains in the Genus database with same CATH topology
4MY0A 4QB9A 3R1KA 2NBMA 4UEIA 2HV2A 3BDQA 2KSHA 2CG2A 5EBVA 1IKTA 3RYOA 2QZTA 1C44A 3CNUA 4PDXA 3SXNA 4JD6A 4AXHA 3BKSA 2CFZA 2C0LB 4NURA 1QNDA 3UY5A 2CFUA 2NBNA 5EC4A 5IV0A 2CX7A 5A23A 5AIJA 2YHEA 4JGXA 4MY3A 1PZ4A 3N7ZA 4AV7A 3SXOA 5AJLA 3BN8A 2I00A 2KSIA 1WFRA 3BKRA 2OZGA 2CG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY0 A;  4QB9 A;  3R1K A;  2NBM A;  4UEI A;  2HV2 A;  3BDQ A;  2KSH A;  2CG2 A;  5EBV A;  1IKT A;  3RYO A;  2QZT A;  1C44 A;  3CNU A;  4PDX A;  3SXN A;  4JD6 A;  4AXH A;  3BKS A;  2CFZ A;  2C0L B;  4NUR A;  1QND A;  3UY5 A;  2CFU A;  2NBN A;  5EC4 A;  5IV0 A;  2CX7 A;  5A23 A;  5AIJ A;  2YHE A;  4JGX A;  4MY3 A;  1PZ4 A;  3N7Z A;  4AV7 A;  3SXO A;  5AJL A;  3BN8 A;  2I00 A;  2KSI A;  1WFR A;  3BKR A;  2OZG A;  2CG3 A; 
#chains in the Genus database with same CATH topology
 4MY0 A;  4QB9 A;  2NSF A;  3R1K A;  2NBM A;  4UEI A;  2HV2 A;  3BDQ A;  3SSM A;  2KSH A;  2CG2 A;  5EBV A;  1IKT A;  3RYO A;  2QZT A;  1C44 A;  3CNU A;  4PDX A;  3SXN A;  4JD6 A;  4AXH A;  4NSS A;  3BKS A;  2CFZ A;  2C0L B;  4NUR A;  4ZY7 A;  1QND A;  3SSO A;  3UY5 A;  2CFU A;  2NBN A;  5EC4 A;  5IV0 A;  2CX7 A;  5A23 A;  5AIJ A;  2YHE A;  4JGX A;  4MY3 A;  1PZ4 A;  3N7Z A;  4AV7 A;  3SSN A;  3SXO A;  5AJL A;  3BN8 A;  2I00 A;  2KSI A;  1WFR A;  3BKR A;  2NSG A;  2OZG A;  2CG3 A; 
#chains in the Genus database with same CATH homology
 4MY0 A;  4QB9 A;  3R1K A;  2NBM A;  4UEI A;  2HV2 A;  3BDQ A;  2KSH A;  2CG2 A;  5EBV A;  1IKT A;  3RYO A;  2QZT A;  1C44 A;  3CNU A;  4PDX A;  3SXN A;  4JD6 A;  4AXH A;  3BKS A;  2CFZ A;  2C0L B;  4NUR A;  1QND A;  3UY5 A;  2CFU A;  2NBN A;  5EC4 A;  5IV0 A;  2CX7 A;  5A23 A;  5AIJ A;  2YHE A;  4JGX A;  4MY3 A;  1PZ4 A;  3N7Z A;  4AV7 A;  3SXO A;  5AJL A;  3BN8 A;  2I00 A;  2KSI A;  1WFR A;  3BKR A;  2OZG A;  2CG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...