The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
168
|
structure length |
168
|
Chain Sequence |
AMADLEQKVLEMEASTYDGVFIWKISDFPRKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The structural basis for the recognition of diverse receptor sequences by TRAF2.
pubmed doi rcsb |
| molecule keywords |
TUMOR NECROSIS FACTOR RECEPTOR ASSOCIATED FACTOR 2
|
| molecule tags |
Apoptosis
|
| source organism |
Homo sapiens
|
| total genus |
41
|
| structure length |
168
|
| sequence length |
168
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature |
ec
2.3.2.27: RING-type E3 ubiquitin transferase. |
| pdb deposition date | 1999-09-07 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A | Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A |
#chains in the Genus database with same CATH superfamily 3HQH A; 3HQM A; 1D01 A; 1CZY A; 1L0A A; 3MQR A; 4I7D A; 1LB5 A; 4GWN A; 1QSC A; 4Z8M A; 1CA9 A; 2F1X A; 1YZE A; 1YY6 A; 2AN6 A; 2GKW A; 4GWM A; 2A25 A; 1CZZ A; 2FOJ A; 2FOO A; 3IVB A; 1FLL A; 3IVV A; 3IVQ A; 4X3G A; 5E1T A; 4C9Z A; 3HQL A; 4JJQ A; 4CA1 A; 1ZMS A; 1KZZ A; 3HSV A; 4KG9 A; 5H9M A; 1CA4 A; 4I7C A; 4YSI A; 3MQS C; 1LB4 A; 2F1Z A; 4M4E A; 3HU6 A; 1D0J A; 1K2F A; 1FLK A; 3HQI A; 1D0A A; 4O1V A; 3ZJB A; 4K8U A; 2FOP A; 4GHU A; 1F3V B; 2F1W A; 4I7B A; 2F1Y A; 4GJH A; 2CR2 A; 1LB6 A; 1RF3 A; 2XXN A; 1D00 A; #chains in the Genus database with same CATH topology 3HQH A; 3HQM A; 1D01 A; 1CZY A; 1L0A A; 3MQR A; 4I7D A; 1LB5 A; 4GWN A; 1QSC A; 4Z8M A; 1CA9 A; 2F1X A; 1YZE A; 1YY6 A; 2AN6 A; 2GKW A; 4GWM A; 2A25 A; 1CZZ A; 2FOJ A; 2FOO A; 3IVB A; 1FLL A; 3IVV A; 3IVQ A; 4X3G A; 5E1T A; 4C9Z A; 3HQL A; 4JJQ A; 4CA1 A; 1ZMS A; 1KZZ A; 3HSV A; 4KG9 A; 5H9M A; 1CA4 A; 4I7C A; 4YSI A; 3MQS C; 1LB4 A; 2F1Z A; 4M4E A; 3HU6 A; 1D0J A; 1K2F A; 1FLK A; 3HQI A; 1D0A A; 4O1V A; 3ZJB A; 4K8U A; 2FOP A; 4GHU A; 1F3V B; 2F1W A; 4I7B A; 2F1Y A; 4GJH A; 2CR2 A; 1LB6 A; 1RF3 A; 2XXN A; 1D00 A; #chains in the Genus database with same CATH homology 3HQH A; 3HQM A; 1D01 A; 1CZY A; 1L0A A; 3MQR A; 4I7D A; 1LB5 A; 4GWN A; 1QSC A; 4Z8M A; 1CA9 A; 2F1X A; 1YZE A; 1YY6 A; 2AN6 A; 2GKW A; 4GWM A; 2A25 A; 1CZZ A; 2FOJ A; 2FOO A; 3IVB A; 1FLL A; 3IVV A; 3IVQ A; 4X3G A; 5E1T A; 4C9Z A; 3HQL A; 4JJQ A; 4CA1 A; 1ZMS A; 1KZZ A; 3HSV A; 4KG9 A; 5H9M A; 1CA4 A; 4I7C A; 4YSI A; 3MQS C; 1LB4 A; 2F1Z A; 4M4E A; 3HU6 A; 1D0J A; 1K2F A; 1FLK A; 3HQI A; 1D0A A; 4O1V A; 3ZJB A; 4K8U A; 2FOP A; 4GHU A; 1F3V B; 2F1W A; 4I7B A; 2F1Y A; 4GJH A; 2CR2 A; 1LB6 A; 1RF3 A; 2XXN A; 1D00 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...