2AN6A

Protein-peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
191
structure length
191
Chain Sequence
NSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of the substrate binding site of Siah ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords Ubiquitin ligase SIAH1A
total genus 36
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2an6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2an6A01
5B76A 2F1YA 5KH9A 4PTBA 2ECNA 1CA4A 3PURA 3T6RA 2ECWA 4LKAA 4Z8MA 3C5KA 3NG2A 2KWKA 5G04B 2CKLB 2JMIA 5FB1A 4PPEA 3I2DA 1D0AA 3LRQA 2KE1A 2H0DA 3N9LA 2CSYA 1D00A 2EA6A 1LB5A 1JM7B 2YQMA 4XI1A 2VPDA 1CA9A 3MQRA 1WGMA 2I50A 4YATA 4MSXA 2FUUA 4GWNA 3KV5A 4FO9A 1XWHA 2VPBA 1RMDA 1U6GB 2YREA 2JMJA 1CHCA 2M85A 2D8SA 1L0AA 4ZQLA 2KGGA 1FLLA 2L5UA 5LKUA 4W4UA 2CR2A 2VP7A 5TBNA 1WEMA 2LGVA 3IVVA 3DPLR 4LJNA 2MD8C 2FOPA 4GB0A 5D1KB 2FSAA 5TABA 5LKXA 2LV9A 5FEYA 5C11A 2LRIC 4KG9A 3L1ZB 3RPGB 2KREA 4ZDTA 3U5OA 4A0CD 3ZVZB 3PUQA 2AN6A 2YT5A 4Q6FA 1WE9A 2LGKA 2ECGA 4BHWA 2F6NA 2KWJA 2Y1NA 3FL2A 3C6WA 4B86C 3GV4A 4P5OB 2JRJA 2QIZA 4UI9B 3EB5A 2ECTA 4YABA 1FBVA 1YZEA 2F42A 4IC3A 4R7EA 4WZ2A 4C9ZA 2L75A 3HSVA 2FUIA 3O36A 2F6JA 4CCGX 1IYMA 4YC9A 3ZJBA 3ZVYA 1Z6UA 2XEUA 4CA1A 4A4CA 4QF2A 2EODA 1JM7A 4V3LC 3O7AA 1FP0A 2G6QA 5B8DA 1WESA 2MA6A 2G45A 5AIUA 5DINA 2C2LA 2JMDA 4GHUA 4K8UA 5B75A 4L7XA 5EYAF 3KNVA 2LGGA 5G0FA 3V43A 4YADA 2YURA 2M6MA 2E6SA 4AYCA 1Z60A 3ZYQA 2Y43A 3O34A 3L1XA 2MIQA 4GJHA 2KGIA 2E6RA 1N87A 5H1UA 1WEWA 5G05B 3N9NA 2UZGA 2LDRA 1HYIA 4N4FA 2CT2A 2LQ6A 3U5NA 3SOXA 3HQIA 1Z2QA 2YW8A 2YHNA 4X3GA 3IVBA 1WEEA 1WILA 1V87A 2VJFB 3U5MA 3MHSA 1CZZA 3KV6A 5LKTA 1K2FA 1RF3A 2KWNA 2QICA 5DKAA 1LDJB 4WZ3B 4S3OB 1E4UA 3N9MA 2KU3A 4UP5A 2G43A 2YU4A 4A49A 2IDAA 1ZBDB 2CSZA 4R8PK 3VK6A 3LQHA 2F1WA 2MT5A 2NAAA 4FJCA 4YBSA 1WEVA 3IVQA 4YBTA 2PUYA 5KH3A 4AYCB 3MHHA 2FOJA 3ZTGA 4B7YC 4I7BA 4ZUXU 2YSJA 2XXNA 2VNFA 1LB6A 1X4JA 4WA6A 4GNDA 4M4EA 3RPGC 3MQSC 3M63A 2ECVA 1WEUA 4L58A 3DQVR 4A4BA 2VJEB 3O33A 3SOWA 5FERA 2YUCA 3SOUA 3PHDA 1FLKA 3HCUA 2Y1MA 1DVPA 4QF3A 2LN0A 1VYXA 2K4DA 2VJEA 4FK5A 3O37A 5TRBA 4AP4A 2EGPA 1WEOA 2GKWA 3ASLA 2MNYA 4YBMA 5B78A 2XB1A 4N3WA 1WEQA 2L43A 2L80A 1F3VB 3HCTA 4MVTA 5I3LA 2YHOA 2QJ0A 5TDWA 5JG6A 1G25A 2HDPA 1X4UA 3IHPA 4LLBA 2F1ZA 3RTRB 5H9MA 3HQLA 2RSDA 4GNGA 2DX8A 2ECJA 4BBQA 5E1TA 5H1TA 1JOCA 5B79A 2H0DB 2MNZA 2KR4A 5D1LB 1WEPA 1VFYA 2KYUA 3LQJA 4UP0A 2YQLA 1WENA 3HCSA 1VD4A 2A25A 1WIMA 1D01A 4JJQA 2K17A 2MUMA 1CZYA 2KWOA 2MD7B 2FOOA 1YY6A 2YSMA 4O1VA 2HYED 3HQMA 1QSCA 4YAXA 3M62A 2YYRA 3N9QA 2F1XA 2OXQC 1MM2A 2C2VS 3L11A 2VJFA 2RI7A 2MA5A 1BORA 5AITA 1F62A 2L0BA 3SHBA 3ZNIA 3N9PA 5TDRA 1MM3A 3HTKC 3U5PA 3M99A 3HQHA 1WFKA 2VPEA 4LK9A 5LCWB 1D0JA 4AUQB 3LQIA 2VPGA 3ZPVE 3HU6A 2LXPC 1LB4A 4I7CA 4R2YA 2KIZA 5D1MB 1X4IA 4GNFA 3EB6A 5C13A 4IC2A 3N9OA 2BAYA 2ECIA 1KZZA 4WZ0A 1LDKC 3O70A 3T7LA 2K16A 4GNEA 4F52B 4TKPB 5FB0A 3O35A 4FIPA 2PNXA 4I7DA 3GL6A 3KQIA 2M1RA 4YSIA 5H1VA 5KH7A 5B77A 2M3HA 2KFTA 1HYJA 2K1JA 5LKZA 4GWMA 4S3OC 2ZETC 3ZPV1 2LGLA 2LXHC 4O64A 4V3KC 1T1HA 5J3XA 4AVXA 4NN2A 4LADB 1ZMSA 3QZVA 2CKLA
chains in the Genus database with same CATH superfamily
5B76A 2F1YA 5KH9A 4PTBA 3LDYA 2ECNA 1CA4A 2EXUA 5K3QA 3PURA 3T6RA 2ECWA 4LKAA 4Z8MA 3C5KA 3NG2A 2KWKA 5G04B 2CKLB 2JMIA 5FB1A 4PPEA 3I2DA 1D0AA 1MBMA 3LRQA 2KE1A 2H0DA 3N9LA 5SVIB 2CSYA 2RR4A 1D00A 2EA6A 1LB5A 1JM7B 2JM3A 2YQMA 4XI1A 2VPDA 1CA9A 3MQRA 5SVIA 2B0OE 3O47A 1WGMA 2I50A 4YATA 4MSXA 2FUUA 4GWNA 3KV5A 4FO9A 3Q1DA 1XWHA 2VPBA 1RMDA 1U6GB 3KDEC 2YREA 2JMJA 1CHCA 2M85A 2D8SA 3SUBA 1L0AA 4ZQLA 2KGGA 1FLLA 2L5UA 5LKUA 4W4UA 2CR2A 4QQ4A 2VP7A 2FD4A 5TBNA 1WEMA 4F1PA 2LGVA 3IVVA 3DPLR 4LJNA 2MD8C 2FOPA 4GB0A 2P57A 5D1KB 2FSAA 5TABA 5LKXA 2LV9A 5FEYA 5C11A 3E2DA 2LRIC 4KG9A 3L1ZB 2XOYA 3RPGB 2KREA 4ZDTA 2OWAA 3U5OA 4A0CD 3ZVZB 3PUQA 2AN6A 2JUNA 2YT5A 4Q6FA 1WE9A 2LGKA 2ECGA 4BHWA 2F6NA 2KWJA 2Y1NA 5SVXA 3FL2A 2L7PA 3C6WA 4B86C 3GV4A 4P5OB 2JRJA 2QIZA 4UI9B 3EB5A 2ECTA 4YABA 1FBVA 1YZEA 2F42A 4IC3A 4R7EA 4WZ2A 4C9ZA 2L75A 3HSVA 2FUIA 3O36A 2F6JA 4CCGX 1IYMA 4YC9A 3T9KA 3ZJBA 2XOCA 3ZVYA 2CONA 1Z6UA 2XEUA 4CA1A 4A4CA 4QF2A 2EODA 1JM7A 4V3LC 3O7AA 1DCQA 1FP0A 2G6QA 5B8DA 1WESA 2MA6A 2G45A 5AIUA 5DINA 2C2LA 2MKEA 2JMDA 4GHUA 4K8UA 5B75A 4L7XA 5EYAF 3KNVA 2CRRA 2LGGA 5G0FA 3V43A 4YADA 3H7HA 2YURA 2M6MA 2E6SA 4AYCA 3JUEA 1Z60A 3ZYQA 2Y43A 3O34A 3L1XA 2MIQA 3PLWA 4GJHA 2KGIA 2CRWA 2E6RA 1N87A 5H1UA 1WEWA 5G05B 3N9NA 2UZGA 2LDRA 3DDTA 4Z0OA 5SVYA 1HYIA 4N4FA 2M13A 2CT2A 2LQ6A 3U5NA 4O62A 3SOXA 3HQIA 1Z2QA 2DSMA 2YW8A 2EGMA 2YHNA 4X3GA 3IVBA 1WEEA 1WILA 3DWDA 1V87A 2VJFB 3U5MA 3MHSA 1CZZA 3KV6A 5LKTA 1K2FA 1RF3A 2KWNA 2QICA 5DKAA 1LDJB 4WZ3B 4S3OB 1E4UA 3N9MA 2KU3A 4UP5A 2G43A 2YU4A 4A49A 2IDAA 1ZBDB 2CSZA 4Z0RA 4R8PK 3VK6A 3LQHA 2F1WA 2MT5A 2CSVA 2NAAA 2KKXA 3MDBC 2IQJA 4FJCA 4YBSA 1WEVA 3IVQA 4YBTA 2PUYA 5KH3A 4AYCB 3MHHA 2FOJA 3ZTGA 3FJUB 4B7YC 4I7BA 4ZUXU 2YSJA 2XXNA 2VNFA 1LB6A 1X4JA 4WA6A 4GNDA 4M4EA 3RPGC 3MQSC 3M63A 2ECVA 1WEUA 4L58A 3DQVR 4A4BA 2VJEB 3O33A 3SOWA 5FERA 2YUCA 3SOUA 3M7KA 3PHDA 1FLKA 3HCUA 2Y1MA 1DVPA 4QF3A 2LN0A 1VYXA 2K4DA 2VJEA 4FK5A 3O37A 5TRBA 4AP4A 2EGPA 1WEOA 2GKWA 3FEHA 3ASLA 2MNYA 4YBMA 5B78A 2XB1A 4N3WA 1WEQA 2L43A 2L80A 1F3VB 2XP0A 3HCTA 4MVTA 5I3LA 2YHOA 2QJ0A 5TDWA 5JG6A 1G25A 2HDPA 1X4UA 3IHPA 4LLBA 2F1ZA 3RTRB 4OGEA 5H9MA 3HQLA 2RSDA 4GNGA 2DX8A 2ECJA 4BBQA 5E1TA 5H1TA 1JOCA 5B79A 2H0DB 2MNZA 2KR4A 5D1LB 1WEPA 1VFYA 2KYUA 3LQJA 4UP0A 2YQLA 1WENA 3HCSA 1VD4A 2A25A 1WIMA 1D01A 2XOZA 3LVRE 4JJQA 2K17A 2MUMA 1CZYA 2KWOA 2MD7B 2FOOA 1YY6A 2YSMA 4O1VA 2FFWA 2HYED 3HQMA 1QSCA 4YAXA 3M62A 2YYRA 3N9QA 2F1XA 2OXQC 3FM8C 1MM2A 2C2VS 3L11A 2VJFA 2RI7A 2MA5A 1BORA 5AITA 3LJUX 3FAOA 1F62A 2L0BA 2D8UA 2YVRA 3SHBA 3ZNIA 3N9PA 5TDRA 1MM3A 3HTKC 3U5PA 3M99A 3HQHA 1WFKA 2VPEA 4LK9A 5LCWB 1D0JA 4AUQB 2DJAA 3LQIA 2VPGA 3ZPVE 3FANA 3HU6A 2KKYA 1LB4A 2LXPC 4I7CA 4R2YA 2KIZA 5D1MB 1X4IA 4GNFA 3EB6A 5C13A 4IC2A 3N9OA 2BAYA 2ECIA 1KZZA 4WZ0A 1LDKC 3O70A 3T7LA 2E61A 2K16A 4GNEA 4F52B 4OGCA 4TKPB 5FB0A 3O35A 4FIPA 2PNXA 4I7DA 3GL6A 3KQIA 2M1RA 4YSIA 5H1VA 5KH7A 5B77A 2M3HA 2KFTA 2LAUA 1HYJA 2K1JA 4H9DA 5LKZA 3LVQE 4GWMA 4S3OC 2ZETC 3ZPV1 2LGLA 2LXHC 4O64A 4V3KC 1T1HA 5J3XA 4AVXA 4NN2A 4LADB 1ZMSA 3QZVA 2CKLA
chains in the Genus database with same CATH topology
5B76A 2F1YA 5KH9A 4PTBA 2ECNA 1CA4A 3PURA 3T6RA 2ECWA 4LKAA 4Z8MA 3C5KA 3NG2A 2KWKA 5G04B 2CKLB 2JMIA 5FB1A 4PPEA 3I2DA 1D0AA 3LRQA 2KE1A 2H0DA 3N9LA 2CSYA 1D00A 2EA6A 1LB5A 1JM7B 2YQMA 4XI1A 2VPDA 1CA9A 3MQRA 1WGMA 2I50A 4YATA 4MSXA 2FUUA 4GWNA 3KV5A 4FO9A 1XWHA 2VPBA 1RMDA 1U6GB 2YREA 2JMJA 1CHCA 2M85A 2D8SA 1L0AA 4ZQLA 2KGGA 1FLLA 2L5UA 5LKUA 4W4UA 2CR2A 2VP7A 5TBNA 1WEMA 2LGVA 3IVVA 3DPLR 4LJNA 2MD8C 2FOPA 4GB0A 5D1KB 2FSAA 5TABA 5LKXA 2LV9A 5FEYA 5C11A 2LRIC 4KG9A 3L1ZB 3RPGB 2KREA 4ZDTA 3U5OA 4A0CD 3ZVZB 3PUQA 2AN6A 2YT5A 4Q6FA 1WE9A 2LGKA 2ECGA 4BHWA 2F6NA 2KWJA 2Y1NA 3FL2A 3C6WA 4B86C 3GV4A 4P5OB 2JRJA 2QIZA 4UI9B 3EB5A 2ECTA 4YABA 1FBVA 1YZEA 2F42A 4IC3A 4R7EA 4WZ2A 4C9ZA 2L75A 3HSVA 2FUIA 3O36A 2F6JA 4CCGX 1IYMA 4YC9A 3ZJBA 3ZVYA 1Z6UA 2XEUA 4CA1A 4A4CA 4QF2A 2EODA 1JM7A 4V3LC 3O7AA 1FP0A 2G6QA 5B8DA 1WESA 2MA6A 2G45A 5AIUA 5DINA 2C2LA 2JMDA 4GHUA 4K8UA 5B75A 4L7XA 5EYAF 3KNVA 2LGGA 5G0FA 3V43A 4YADA 2YURA 2M6MA 2E6SA 4AYCA 1Z60A 3ZYQA 2Y43A 3O34A 3L1XA 2MIQA 4GJHA 2KGIA 2E6RA 1N87A 5H1UA 1WEWA 5G05B 3N9NA 2UZGA 2LDRA 1HYIA 4N4FA 2CT2A 2LQ6A 3U5NA 3SOXA 3HQIA 1Z2QA 2YW8A 2YHNA 4X3GA 3IVBA 1WEEA 1WILA 1V87A 2VJFB 3U5MA 3MHSA 1CZZA 3KV6A 5LKTA 1K2FA 1RF3A 2KWNA 2QICA 5DKAA 1LDJB 4WZ3B 4S3OB 1E4UA 3N9MA 2KU3A 4UP5A 2G43A 2YU4A 4A49A 2IDAA 1ZBDB 2CSZA 4R8PK 3VK6A 3LQHA 2F1WA 2MT5A 2NAAA 4FJCA 4YBSA 1WEVA 3IVQA 4YBTA 2PUYA 5KH3A 4AYCB 3MHHA 2FOJA 3ZTGA 4B7YC 4I7BA 4ZUXU 2YSJA 2XXNA 2VNFA 1LB6A 1X4JA 4WA6A 4GNDA 4M4EA 3RPGC 3MQSC 3M63A 2ECVA 1WEUA 4L58A 3DQVR 4A4BA 2VJEB 3O33A 3SOWA 5FERA 2YUCA 3SOUA 3PHDA 1FLKA 3HCUA 2Y1MA 1DVPA 4QF3A 2LN0A 1VYXA 2K4DA 2VJEA 4FK5A 3O37A 5TRBA 4AP4A 2EGPA 1WEOA 2GKWA 3ASLA 2MNYA 4YBMA 5B78A 2XB1A 4N3WA 1WEQA 2L43A 2L80A 1F3VB 3HCTA 4MVTA 5I3LA 2YHOA 2QJ0A 5TDWA 5JG6A 1G25A 2HDPA 1X4UA 3IHPA 4LLBA 2F1ZA 3RTRB 5H9MA 3HQLA 2RSDA 4GNGA 2DX8A 2ECJA 4BBQA 5E1TA 5H1TA 1JOCA 5B79A 2H0DB 2MNZA 2KR4A 5D1LB 1WEPA 1VFYA 2KYUA 3LQJA 4UP0A 2YQLA 1WENA 3HCSA 1VD4A 2A25A 1WIMA 1D01A 4JJQA 2K17A 2MUMA 1CZYA 2KWOA 2MD7B 2FOOA 1YY6A 2YSMA 4O1VA 2HYED 3HQMA 1QSCA 4YAXA 3M62A 2YYRA 3N9QA 2F1XA 2OXQC 1MM2A 2C2VS 3L11A 2VJFA 2RI7A 2MA5A 1BORA 5AITA 1F62A 2L0BA 3SHBA 3ZNIA 3N9PA 5TDRA 1MM3A 3HTKC 3U5PA 3M99A 3HQHA 1WFKA 2VPEA 4LK9A 5LCWB 1D0JA 4AUQB 3LQIA 2VPGA 3ZPVE 3HU6A 2LXPC 1LB4A 4I7CA 4R2YA 2KIZA 5D1MB 1X4IA 4GNFA 3EB6A 5C13A 4IC2A 3N9OA 2BAYA 2ECIA 1KZZA 4WZ0A 1LDKC 3O70A 3T7LA 2K16A 4GNEA 4F52B 4TKPB 5FB0A 3O35A 4FIPA 2PNXA 4I7DA 3GL6A 3KQIA 2M1RA 4YSIA 5H1VA 5KH7A 5B77A 2M3HA 2KFTA 1HYJA 2K1JA 5LKZA 4GWMA 4S3OC 2ZETC 3ZPV1 2LGLA 2LXHC 4O64A 4V3KC 1T1HA 5J3XA 4AVXA 4NN2A 4LADB 1ZMSA 3QZVA 2CKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B76 A;  2F1Y A;  5KH9 A;  4PTB A;  2ECN A;  1CA4 A;  3PUR A;  3T6R A;  2ECW A;  4LKA A;  4Z8M A;  3C5K A;  3NG2 A;  2KWK A;  5G04 B;  2CKL B;  2JMI A;  5FB1 A;  4PPE A;  3I2D A;  1D0A A;  3LRQ A;  2KE1 A;  2H0D A;  3N9L A;  2CSY A;  1D00 A;  2EA6 A;  1LB5 A;  1JM7 B;  2YQM A;  4XI1 A;  2VPD A;  1CA9 A;  3MQR A;  1WGM A;  2I50 A;  4YAT A;  4MSX A;  2FUU A;  4GWN A;  3KV5 A;  4FO9 A;  1XWH A;  2VPB A;  1RMD A;  1U6G B;  2YRE A;  2JMJ A;  1CHC A;  2M85 A;  2D8S A;  1L0A A;  4ZQL A;  2KGG A;  1FLL A;  2L5U A;  5LKU A;  4W4U A;  2CR2 A;  2VP7 A;  5TBN A;  1WEM A;  2LGV A;  3IVV A;  3DPL R;  4LJN A;  2MD8 C;  2FOP A;  4GB0 A;  5D1K B;  2FSA A;  5TAB A;  5LKX A;  2LV9 A;  5FEY A;  5C11 A;  2LRI C;  4KG9 A;  3L1Z B;  3RPG B;  2KRE A;  4ZDT A;  3U5O A;  4A0C D;  3ZVZ B;  3PUQ A;  2AN6 A;  2YT5 A;  4Q6F A;  1WE9 A;  2LGK A;  2ECG A;  4BHW A;  2F6N A;  2KWJ A;  2Y1N A;  3FL2 A;  3C6W A;  4B86 C;  3GV4 A;  4P5O B;  2JRJ A;  2QIZ A;  4UI9 B;  3EB5 A;  2ECT A;  4YAB A;  1FBV A;  1YZE A;  2F42 A;  4IC3 A;  4R7E A;  4WZ2 A;  4C9Z A;  2L75 A;  3HSV A;  2FUI A;  3O36 A;  2F6J A;  4CCG X;  1IYM A;  4YC9 A;  3ZJB A;  3ZVY A;  1Z6U A;  2XEU A;  4CA1 A;  4A4C A;  4QF2 A;  2EOD A;  1JM7 A;  4V3L C;  3O7A A;  1FP0 A;  2G6Q A;  5B8D A;  1WES A;  2MA6 A;  2G45 A;  5AIU A;  5DIN A;  2C2L A;  2JMD A;  4GHU A;  4K8U A;  5B75 A;  4L7X A;  5EYA F;  3KNV A;  2LGG A;  5G0F A;  3V43 A;  4YAD A;  2YUR A;  2M6M A;  2E6S A;  4AYC A;  1Z60 A;  3ZYQ A;  2Y43 A;  3O34 A;  3L1X A;  2MIQ A;  4GJH A;  2KGI A;  2E6R A;  1N87 A;  5H1U A;  1WEW A;  5G05 B;  3N9N A;  2UZG A;  2LDR A;  1HYI A;  4N4F A;  2CT2 A;  2LQ6 A;  3U5N A;  3SOX A;  3HQI A;  1Z2Q A;  2YW8 A;  2YHN A;  4X3G A;  3IVB A;  1WEE A;  1WIL A;  1V87 A;  2VJF B;  3U5M A;  3MHS A;  1CZZ A;  3KV6 A;  5LKT A;  1K2F A;  1RF3 A;  2KWN A;  2QIC A;  5DKA A;  1LDJ B;  4WZ3 B;  4S3O B;  1E4U A;  3N9M A;  2KU3 A;  4UP5 A;  2G43 A;  2YU4 A;  4A49 A;  2IDA A;  1ZBD B;  2CSZ A;  4R8P K;  3VK6 A;  3LQH A;  2F1W A;  2MT5 A;  2NAA A;  4FJC A;  4YBS A;  1WEV A;  3IVQ A;  4YBT A;  2PUY A;  5KH3 A;  4AYC B;  3MHH A;  2FOJ A;  3ZTG A;  4B7Y C;  4I7B A;  4ZUX U;  2YSJ A;  2XXN A;  2VNF A;  1LB6 A;  1X4J A;  4WA6 A;  4GND A;  4M4E A;  3RPG C;  3MQS C;  3M63 A;  2ECV A;  1WEU A;  4L58 A;  3DQV R;  4A4B A;  2VJE B;  3O33 A;  3SOW A;  5FER A;  2YUC A;  3SOU A;  3PHD A;  1FLK A;  3HCU A;  2Y1M A;  1DVP A;  4QF3 A;  2LN0 A;  1VYX A;  2K4D A;  2VJE A;  4FK5 A;  3O37 A;  5TRB A;  4AP4 A;  2EGP A;  1WEO A;  2GKW A;  3ASL A;  2MNY A;  4YBM A;  5B78 A;  2XB1 A;  4N3W A;  1WEQ A;  2L43 A;  2L80 A;  1F3V B;  3HCT A;  4MVT A;  5I3L A;  2YHO A;  2QJ0 A;  5TDW A;  5JG6 A;  1G25 A;  2HDP A;  1X4U A;  3IHP A;  4LLB A;  2F1Z A;  3RTR B;  5H9M A;  3HQL A;  2RSD A;  4GNG A;  2DX8 A;  2ECJ A;  4BBQ A;  5E1T A;  5H1T A;  1JOC A;  5B79 A;  2H0D B;  2MNZ A;  2KR4 A;  5D1L B;  1WEP A;  1VFY A;  2KYU A;  3LQJ A;  4UP0 A;  2YQL A;  1WEN A;  3HCS A;  1VD4 A;  2A25 A;  1WIM A;  1D01 A;  4JJQ A;  2K17 A;  2MUM A;  1CZY A;  2KWO A;  2MD7 B;  2FOO A;  1YY6 A;  2YSM A;  4O1V A;  2HYE D;  3HQM A;  1QSC A;  4YAX A;  3M62 A;  2YYR A;  3N9Q A;  2F1X A;  2OXQ C;  1MM2 A;  2C2V S;  3L11 A;  2VJF A;  2RI7 A;  2MA5 A;  1BOR A;  5AIT A;  1F62 A;  2L0B A;  3SHB A;  3ZNI A;  3N9P A;  5TDR A;  1MM3 A;  3HTK C;  3U5P A;  3M99 A;  3HQH A;  1WFK A;  2VPE A;  4LK9 A;  5LCW B;  1D0J A;  4AUQ B;  3LQI A;  2VPG A;  3ZPV E;  3HU6 A;  2LXP C;  1LB4 A;  4I7C A;  4R2Y A;  2KIZ A;  5D1M B;  1X4I A;  4GNF A;  3EB6 A;  5C13 A;  4IC2 A;  3N9O A;  2BAY A;  2ECI A;  1KZZ A;  4WZ0 A;  1LDK C;  3O70 A;  3T7L A;  2K16 A;  4GNE A;  4F52 B;  4TKP B;  5FB0 A;  3O35 A;  4FIP A;  2PNX A;  4I7D A;  3GL6 A;  3KQI A;  2M1R A;  4YSI A;  5H1V A;  5KH7 A;  5B77 A;  2M3H A;  2KFT A;  1HYJ A;  2K1J A;  5LKZ A;  4GWM A;  4S3O C;  2ZET C;  3ZPV 1;  2LGL A;  2LXH C;  4O64 A;  4V3K C;  1T1H A;  5J3X A;  4AVX A;  4NN2 A;  4LAD B;  1ZMS A;  3QZV A;  2CKL A; 
#chains in the Genus database with same CATH topology
 5B76 A;  2F1Y A;  5KH9 A;  4PTB A;  3LDY A;  2ECN A;  1CA4 A;  2EXU A;  5K3Q A;  3PUR A;  3T6R A;  2ECW A;  4LKA A;  4Z8M A;  3C5K A;  3NG2 A;  2KWK A;  5G04 B;  2CKL B;  2JMI A;  5FB1 A;  4PPE A;  3I2D A;  1D0A A;  1MBM A;  3LRQ A;  2KE1 A;  2H0D A;  3N9L A;  5SVI B;  2CSY A;  2RR4 A;  1D00 A;  2EA6 A;  1LB5 A;  1JM7 B;  2JM3 A;  2YQM A;  4XI1 A;  2VPD A;  1CA9 A;  3MQR A;  5SVI A;  2B0O E;  3O47 A;  1WGM A;  2I50 A;  4YAT A;  4MSX A;  2FUU A;  4GWN A;  3KV5 A;  4FO9 A;  3Q1D A;  1XWH A;  2VPB A;  1RMD A;  1U6G B;  3KDE C;  2YRE A;  2JMJ A;  1CHC A;  2M85 A;  2D8S A;  3SUB A;  1L0A A;  4ZQL A;  2KGG A;  1FLL A;  2L5U A;  5LKU A;  4W4U A;  2CR2 A;  4QQ4 A;  2VP7 A;  2FD4 A;  5TBN A;  1WEM A;  4F1P A;  2LGV A;  3IVV A;  3DPL R;  4LJN A;  2MD8 C;  2FOP A;  4GB0 A;  2P57 A;  5D1K B;  2FSA A;  5TAB A;  5LKX A;  2LV9 A;  5FEY A;  5C11 A;  3E2D A;  2LRI C;  4KG9 A;  3L1Z B;  2XOY A;  3RPG B;  2KRE A;  4ZDT A;  2OWA A;  3U5O A;  4A0C D;  3ZVZ B;  3PUQ A;  2AN6 A;  2JUN A;  2YT5 A;  4Q6F A;  1WE9 A;  2LGK A;  2ECG A;  4BHW A;  2F6N A;  2KWJ A;  2Y1N A;  5SVX A;  3FL2 A;  2L7P A;  3C6W A;  4B86 C;  3GV4 A;  4P5O B;  2JRJ A;  2QIZ A;  4UI9 B;  3EB5 A;  2ECT A;  4YAB A;  1FBV A;  1YZE A;  2F42 A;  4IC3 A;  4R7E A;  4WZ2 A;  4C9Z A;  2L75 A;  3HSV A;  2FUI A;  3O36 A;  2F6J A;  4CCG X;  1IYM A;  4YC9 A;  3T9K A;  3ZJB A;  2XOC A;  3ZVY A;  2CON A;  1Z6U A;  2XEU A;  4CA1 A;  4A4C A;  4QF2 A;  2EOD A;  1JM7 A;  4V3L C;  3O7A A;  1DCQ A;  1FP0 A;  2G6Q A;  5B8D A;  1WES A;  2MA6 A;  2G45 A;  5AIU A;  5DIN A;  2C2L A;  2MKE A;  2JMD A;  4GHU A;  4K8U A;  5B75 A;  4L7X A;  5EYA F;  3KNV A;  2CRR A;  2LGG A;  5G0F A;  3V43 A;  4YAD A;  3H7H A;  2YUR A;  2M6M A;  2E6S A;  4AYC A;  3JUE A;  1Z60 A;  3ZYQ A;  2Y43 A;  3O34 A;  3L1X A;  2MIQ A;  3PLW A;  4GJH A;  2KGI A;  2CRW A;  2E6R A;  1N87 A;  5H1U A;  1WEW A;  5G05 B;  3N9N A;  2UZG A;  2LDR A;  3DDT A;  4Z0O A;  5SVY A;  1HYI A;  4N4F A;  2M13 A;  2CT2 A;  2LQ6 A;  3U5N A;  4O62 A;  3SOX A;  3HQI A;  1Z2Q A;  2DSM A;  2YW8 A;  2EGM A;  2YHN A;  4X3G A;  3IVB A;  1WEE A;  1WIL A;  3DWD A;  1V87 A;  2VJF B;  3U5M A;  3MHS A;  1CZZ A;  3KV6 A;  5LKT A;  1K2F A;  1RF3 A;  2KWN A;  2QIC A;  5DKA A;  1LDJ B;  4WZ3 B;  4S3O B;  1E4U A;  3N9M A;  2KU3 A;  4UP5 A;  2G43 A;  2YU4 A;  4A49 A;  2IDA A;  1ZBD B;  2CSZ A;  4Z0R A;  4R8P K;  3VK6 A;  3LQH A;  2F1W A;  2MT5 A;  2CSV A;  2NAA A;  2KKX A;  3MDB C;  2IQJ A;  4FJC A;  4YBS A;  1WEV A;  3IVQ A;  4YBT A;  2PUY A;  5KH3 A;  4AYC B;  3MHH A;  2FOJ A;  3ZTG A;  3FJU B;  4B7Y C;  4I7B A;  4ZUX U;  2YSJ A;  2XXN A;  2VNF A;  1LB6 A;  1X4J A;  4WA6 A;  4GND A;  4M4E A;  3RPG C;  3MQS C;  3M63 A;  2ECV A;  1WEU A;  4L58 A;  3DQV R;  4A4B A;  2VJE B;  3O33 A;  3SOW A;  5FER A;  2YUC A;  3SOU A;  3M7K A;  3PHD A;  1FLK A;  3HCU A;  2Y1M A;  1DVP A;  4QF3 A;  2LN0 A;  1VYX A;  2K4D A;  2VJE A;  4FK5 A;  3O37 A;  5TRB A;  4AP4 A;  2EGP A;  1WEO A;  2GKW A;  3FEH A;  3ASL A;  2MNY A;  4YBM A;  5B78 A;  2XB1 A;  4N3W A;  1WEQ A;  2L43 A;  2L80 A;  1F3V B;  2XP0 A;  3HCT A;  4MVT A;  5I3L A;  2YHO A;  2QJ0 A;  5TDW A;  5JG6 A;  1G25 A;  2HDP A;  1X4U A;  3IHP A;  4LLB A;  2F1Z A;  3RTR B;  4OGE A;  5H9M A;  3HQL A;  2RSD A;  4GNG A;  2DX8 A;  2ECJ A;  4BBQ A;  5E1T A;  5H1T A;  1JOC A;  5B79 A;  2H0D B;  2MNZ A;  2KR4 A;  5D1L B;  1WEP A;  1VFY A;  2KYU A;  3LQJ A;  4UP0 A;  2YQL A;  1WEN A;  3HCS A;  1VD4 A;  2A25 A;  1WIM A;  1D01 A;  2XOZ A;  3LVR E;  4JJQ A;  2K17 A;  2MUM A;  1CZY A;  2KWO A;  2MD7 B;  2FOO A;  1YY6 A;  2YSM A;  4O1V A;  2FFW A;  2HYE D;  3HQM A;  1QSC A;  4YAX A;  3M62 A;  2YYR A;  3N9Q A;  2F1X A;  2OXQ C;  3FM8 C;  1MM2 A;  2C2V S;  3L11 A;  2VJF A;  2RI7 A;  2MA5 A;  1BOR A;  5AIT A;  3LJU X;  3FAO A;  1F62 A;  2L0B A;  2D8U A;  2YVR A;  3SHB A;  3ZNI A;  3N9P A;  5TDR A;  1MM3 A;  3HTK C;  3U5P A;  3M99 A;  3HQH A;  1WFK A;  2VPE A;  4LK9 A;  5LCW B;  1D0J A;  4AUQ B;  2DJA A;  3LQI A;  2VPG A;  3ZPV E;  3FAN A;  3HU6 A;  2KKY A;  1LB4 A;  2LXP C;  4I7C A;  4R2Y A;  2KIZ A;  5D1M B;  1X4I A;  4GNF A;  3EB6 A;  5C13 A;  4IC2 A;  3N9O A;  2BAY A;  2ECI A;  1KZZ A;  4WZ0 A;  1LDK C;  3O70 A;  3T7L A;  2E61 A;  2K16 A;  4GNE A;  4F52 B;  4OGC A;  4TKP B;  5FB0 A;  3O35 A;  4FIP A;  2PNX A;  4I7D A;  3GL6 A;  3KQI A;  2M1R A;  4YSI A;  5H1V A;  5KH7 A;  5B77 A;  2M3H A;  2KFT A;  2LAU A;  1HYJ A;  2K1J A;  4H9D A;  5LKZ A;  3LVQ E;  4GWM A;  4S3O C;  2ZET C;  3ZPV 1;  2LGL A;  2LXH C;  4O64 A;  4V3K C;  1T1H A;  5J3X A;  4AVX A;  4NN2 A;  4LAD B;  1ZMS A;  3QZV A;  2CKL A; 
#chains in the Genus database with same CATH homology
 5B76 A;  2F1Y A;  5KH9 A;  4PTB A;  2ECN A;  1CA4 A;  3PUR A;  3T6R A;  2ECW A;  4LKA A;  4Z8M A;  3C5K A;  3NG2 A;  2KWK A;  5G04 B;  2CKL B;  2JMI A;  5FB1 A;  4PPE A;  3I2D A;  1D0A A;  3LRQ A;  2KE1 A;  2H0D A;  3N9L A;  2CSY A;  1D00 A;  2EA6 A;  1LB5 A;  1JM7 B;  2YQM A;  4XI1 A;  2VPD A;  1CA9 A;  3MQR A;  1WGM A;  2I50 A;  4YAT A;  4MSX A;  2FUU A;  4GWN A;  3KV5 A;  4FO9 A;  1XWH A;  2VPB A;  1RMD A;  1U6G B;  2YRE A;  2JMJ A;  1CHC A;  2M85 A;  2D8S A;  1L0A A;  4ZQL A;  2KGG A;  1FLL A;  2L5U A;  5LKU A;  4W4U A;  2CR2 A;  2VP7 A;  5TBN A;  1WEM A;  2LGV A;  3IVV A;  3DPL R;  4LJN A;  2MD8 C;  2FOP A;  4GB0 A;  5D1K B;  2FSA A;  5TAB A;  5LKX A;  2LV9 A;  5FEY A;  5C11 A;  2LRI C;  4KG9 A;  3L1Z B;  3RPG B;  2KRE A;  4ZDT A;  3U5O A;  4A0C D;  3ZVZ B;  3PUQ A;  2AN6 A;  2YT5 A;  4Q6F A;  1WE9 A;  2LGK A;  2ECG A;  4BHW A;  2F6N A;  2KWJ A;  2Y1N A;  3FL2 A;  3C6W A;  4B86 C;  3GV4 A;  4P5O B;  2JRJ A;  2QIZ A;  4UI9 B;  3EB5 A;  2ECT A;  4YAB A;  1FBV A;  1YZE A;  2F42 A;  4IC3 A;  4R7E A;  4WZ2 A;  4C9Z A;  2L75 A;  3HSV A;  2FUI A;  3O36 A;  2F6J A;  4CCG X;  1IYM A;  4YC9 A;  3ZJB A;  3ZVY A;  1Z6U A;  2XEU A;  4CA1 A;  4A4C A;  4QF2 A;  2EOD A;  1JM7 A;  4V3L C;  3O7A A;  1FP0 A;  2G6Q A;  5B8D A;  1WES A;  2MA6 A;  2G45 A;  5AIU A;  5DIN A;  2C2L A;  2JMD A;  4GHU A;  4K8U A;  5B75 A;  4L7X A;  5EYA F;  3KNV A;  2LGG A;  5G0F A;  3V43 A;  4YAD A;  2YUR A;  2M6M A;  2E6S A;  4AYC A;  1Z60 A;  3ZYQ A;  2Y43 A;  3O34 A;  3L1X A;  2MIQ A;  4GJH A;  2KGI A;  2E6R A;  1N87 A;  5H1U A;  1WEW A;  5G05 B;  3N9N A;  2UZG A;  2LDR A;  1HYI A;  4N4F A;  2CT2 A;  2LQ6 A;  3U5N A;  3SOX A;  3HQI A;  1Z2Q A;  2YW8 A;  2YHN A;  4X3G A;  3IVB A;  1WEE A;  1WIL A;  1V87 A;  2VJF B;  3U5M A;  3MHS A;  1CZZ A;  3KV6 A;  5LKT A;  1K2F A;  1RF3 A;  2KWN A;  2QIC A;  5DKA A;  1LDJ B;  4WZ3 B;  4S3O B;  1E4U A;  3N9M A;  2KU3 A;  4UP5 A;  2G43 A;  2YU4 A;  4A49 A;  2IDA A;  1ZBD B;  2CSZ A;  4R8P K;  3VK6 A;  3LQH A;  2F1W A;  2MT5 A;  2NAA A;  4FJC A;  4YBS A;  1WEV A;  3IVQ A;  4YBT A;  2PUY A;  5KH3 A;  4AYC B;  3MHH A;  2FOJ A;  3ZTG A;  4B7Y C;  4I7B A;  4ZUX U;  2YSJ A;  2XXN A;  2VNF A;  1LB6 A;  1X4J A;  4WA6 A;  4GND A;  4M4E A;  3RPG C;  3MQS C;  3M63 A;  2ECV A;  1WEU A;  4L58 A;  3DQV R;  4A4B A;  2VJE B;  3O33 A;  3SOW A;  5FER A;  2YUC A;  3SOU A;  3PHD A;  1FLK A;  3HCU A;  2Y1M A;  1DVP A;  4QF3 A;  2LN0 A;  1VYX A;  2K4D A;  2VJE A;  4FK5 A;  3O37 A;  5TRB A;  4AP4 A;  2EGP A;  1WEO A;  2GKW A;  3ASL A;  2MNY A;  4YBM A;  5B78 A;  2XB1 A;  4N3W A;  1WEQ A;  2L43 A;  2L80 A;  1F3V B;  3HCT A;  4MVT A;  5I3L A;  2YHO A;  2QJ0 A;  5TDW A;  5JG6 A;  1G25 A;  2HDP A;  1X4U A;  3IHP A;  4LLB A;  2F1Z A;  3RTR B;  5H9M A;  3HQL A;  2RSD A;  4GNG A;  2DX8 A;  2ECJ A;  4BBQ A;  5E1T A;  5H1T A;  1JOC A;  5B79 A;  2H0D B;  2MNZ A;  2KR4 A;  5D1L B;  1WEP A;  1VFY A;  2KYU A;  3LQJ A;  4UP0 A;  2YQL A;  1WEN A;  3HCS A;  1VD4 A;  2A25 A;  1WIM A;  1D01 A;  4JJQ A;  2K17 A;  2MUM A;  1CZY A;  2KWO A;  2MD7 B;  2FOO A;  1YY6 A;  2YSM A;  4O1V A;  2HYE D;  3HQM A;  1QSC A;  4YAX A;  3M62 A;  2YYR A;  3N9Q A;  2F1X A;  2OXQ C;  1MM2 A;  2C2V S;  3L11 A;  2VJF A;  2RI7 A;  2MA5 A;  1BOR A;  5AIT A;  1F62 A;  2L0B A;  3SHB A;  3ZNI A;  3N9P A;  5TDR A;  1MM3 A;  3HTK C;  3U5P A;  3M99 A;  3HQH A;  1WFK A;  2VPE A;  4LK9 A;  5LCW B;  1D0J A;  4AUQ B;  3LQI A;  2VPG A;  3ZPV E;  3HU6 A;  2LXP C;  1LB4 A;  4I7C A;  4R2Y A;  2KIZ A;  5D1M B;  1X4I A;  4GNF A;  3EB6 A;  5C13 A;  4IC2 A;  3N9O A;  2BAY A;  2ECI A;  1KZZ A;  4WZ0 A;  1LDK C;  3O70 A;  3T7L A;  2K16 A;  4GNE A;  4F52 B;  4TKP B;  5FB0 A;  3O35 A;  4FIP A;  2PNX A;  4I7D A;  3GL6 A;  3KQI A;  2M1R A;  4YSI A;  5H1V A;  5KH7 A;  5B77 A;  2M3H A;  2KFT A;  1HYJ A;  2K1J A;  5LKZ A;  4GWM A;  4S3O C;  2ZET C;  3ZPV 1;  2LGL A;  2LXH C;  4O64 A;  4V3K C;  1T1H A;  5J3X A;  4AVX A;  4NN2 A;  4LAD B;  1ZMS A;  3QZV A;  2CKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...