2AN6A

Protein-peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
191
structure length
191
Chain Sequence
NSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin ligase SIAH1A
publication title Elucidation of the substrate binding site of Siah ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 36
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2an6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2an6A01
2YHOA 2KFTA 2YURA 2CSYA 2XB1A 3HQHA 2MNZA 5JG6A 3HU6A 2ECTA 4GWMA 2KIZA 2H0DB 2Y1MA 3LQHA 1HYIA 4UI9B 4FO9A 1WIMA 2ECGA 5EYAF 1FBVA 2XXNA 1YY6A 3L1XA 3L1ZB 4A49A 1U6GB 2MA5A 2K17A 2D8SA 5H9MA 2EA6A 2BAYA 1G25A 4K8UA 2KGIA 4PPEA 4GNEA 2QICA 3IVVA 2YQLA 3ZNIA 3O36A 1JM7B 2NAAA 3N9MA 3ZVZB 2MIQA 2CKLA 2Y43A 3DPLR 1D00A 1WEMA 1ZBDB 4YBTA 3EB5A 2LQ6A 4F52B 3HQMA 5G05B 4B86C 3RTRB 5LKUA 2A25A 2MT5A 2VJFB 1Z6UA 4LK9A 4S3OC 2K1JA 2JRJA 2ECIA 4GNFA 2VPBA 1K2FA 2JMIA 1LB5A 1X4IA 2KU3A 2JMJA 5TRBA 2FUUA 3ZVYA 2LN0A 5FB1A 4I7DA 2E6RA 5B79A 2ECWA 1ZMSA 3LQJA 5LKZA 3N9QA 1LDKC 3U5PA 4QF3A 4ZDTA 2RSDA 3HCTA 3T6RA 3IVQA 3M99A 2LDRA 3MQRA 3N9LA 1WEQA 4FK5A 3O34A 1CZZA 5C13A 2L75A 1JOCA 2YUCA 4MSXA 5KH7A 4WZ0A 2ECJA 2YU4A 4N4FA 2K16A 2LGVA 2YSJA 5D1LB 4JJQA 4QF2A 3MHSA 1D0AA 4FIPA 4MVTA 3I2DA 5D1KB 1WEWA 3MHHA 4GB0A 4V3KC 3O70A 4CA1A 1CA4A 1X4JA 2M3HA 3NG2A 3DQVR 3GV4A 2ECVA 1N87A 5B76A 2GKWA 2LV9A 1F62A 5KH9A 2MD7B 4Q6FA 2MNYA 1T1HA 3KNVA 3L11A 3T7LA 4R7EA 4YBMA 1CZYA 4I7CA 4I7BA 4R8PK 5DINA 2KREA 3QZVA 1RF3A 3MQSC 2LXPC 1LB4A 2VJEA 2KGGA 3PHDA 4AYCA 2MUMA 2KWNA 2YW8A 5FEYA 3O33A 2C2LA 3M62A 3ZYQA 1XWHA 1F3VB 2F1WA 5B77A 4WZ2A 4S3OB 4PTBA 3U5OA 1VYXA 1E4UA 4C9ZA 3SHBA 2M1RA 5FB0A 1KZZA 5E1TA 2FOOA 3U5MA 1FLLA 5H1UA 4WZ3B 5G04B 1WEEA 2VPEA 2H0DA 4R2YA 5AIUA 3C6WA 3EB6A 1D01A 3V43A 2F42A 1X4UA 2L43A 3KQIA 1CA9A 2VNFA 5H1VA 4AUQB 1WGMA 2KYUA 1CHCA 3PURA 2YQMA 2CR2A 2F6JA 5H1TA 2KE1A 4V3LC 4IC3A 1JM7A 2LGKA 2F6NA 4YBSA 2M6MA 2YHNA 2PUYA 4WA6A 3HQIA 2I50A 4YSIA 5LCWB 2VPGA 4YAXA 3HSVA 2QIZA 3ASLA 4YADA 4NN2A 5FERA 2VP7A 4A4BA 2F1YA 1WENA 3N9OA 4GNDA 2YREA 2KWJA 2LGLA 2VJFA 4L7XA 3SOUA 5DKAA 1QSCA 1RMDA 2HYED 3LRQA 2DX8A 4W4UA 4IC2A 4YATA 4LKAA 5G0FA 4LADB 2YT5A 2CSZA 4GJHA 4M4EA 2Y1NA 2QJ0A 3HCSA 3ZPVE 2AN6A 2CKLB 2EODA 4P5OB 1WESA 2L80A 4ZUXU 4A4CA 2FUIA 4LJNA 1WFKA 2L5UA 1BORA 2IDAA 3RPGC 3LQIA 2XEUA 4B7YC 5TDRA 2K4DA 4Z8MA 1WILA 2E6SA 4L58A 1WE9A 2EGPA 3C5KA 5LKXA 1FP0A 4YABA 2KWOA 3ZJBA 2MA6A 4LLBA 4O64A 1MM3A 1D0JA 3M63A 5TBNA 1VD4A 3N9NA 2G6QA 5B8DA 3N9PA 4A0CD 3KV5A 3O7AA 5LKTA 4GHUA 2KR4A 2YYRA 3VK6A 1WEVA 3O35A 2KWKA 2JMDA 5I3LA 2UZGA 3KV6A 1YZEA 4X3GA 2OXQC 1Z60A 2LXHC 5D1MB 4BBQA 2LRIC 4N3WA 1MM2A 4GNGA 4FJCA 4UP0A 3SOWA 3PUQA 2PNXA 4KG9A 5B75A 1FLKA 3U5NA 1L0AA 1WEPA 4TKPB 1V87A 2HDPA 2L0BA 4XI1A 4CCGX 4UP5A 1LDJB 5KH3A 3GL6A 2ZETC 2FOJA 5TDWA 1Z2QA 2M85A 1VFYA 2G45A 2FSAA 5TABA 4O1VA 1LB6A 2CT2A 3HTKC 3SOXA 5C11A 5AITA 3IHPA 2C2VS 2LGGA 4ZQLA 1DVPA 2VJEB 2FOPA 3ZPV1 5B78A 3HQLA 1WEOA 1WEUA 3RPGB 3IVBA 3O37A 3ZTGA 4AYCB 3HCUA 4YC9A 4AVXA 2F1ZA 2YSMA 2MD8C 3FL2A 4BHWA 4AP4A 4GWNA 2ECNA 5J3XA 1HYJA 2G43A 2RI7A 2F1XA 2VPDA 1IYMA
chains in the Genus database with same CATH superfamily
2YHOA 5SVIA 2KFTA 2YURA 2CSYA 2XB1A 3HQHA 2MNZA 5JG6A 3HU6A 2ECTA 4GWMA 2KIZA 2H0DB 2Y1MA 3LQHA 1HYIA 4UI9B 4FO9A 1WIMA 2IQJA 2ECGA 5EYAF 1FBVA 2XXNA 1YY6A 3L1XA 3L1ZB 4A49A 1U6GB 3O47A 2XOYA 2MA5A 3FJUB 2K17A 2D8SA 5H9MA 2EA6A 2BAYA 1G25A 4K8UA 2KGIA 4PPEA 4OGCA 4GNEA 2QICA 3IVVA 4F1PA 2YQLA 1MBMA 3ZNIA 3O36A 1JM7B 2NAAA 3N9MA 3ZVZB 2MIQA 2CKLA 2Y43A 3DPLR 3M7KA 2EXUA 1D00A 1WEMA 3LVQE 1ZBDB 4YBTA 5SVXA 2EGMA 3EB5A 2LQ6A 4F52B 3DWDA 3HQMA 5G05B 4B86C 3RTRB 5LKUA 2MKEA 2A25A 2MT5A 2VJFB 2XOCA 1Z6UA 4LK9A 4S3OC 3LJUX 2K1JA 2JRJA 2ECIA 4GNFA 2VPBA 1K2FA 2JMIA 1LB5A 1X4IA 2KU3A 2JMJA 5TRBA 2FUUA 3ZVYA 2LN0A 3JUEA 5FB1A 4I7DA 2E6RA 5B79A 2ECWA 1ZMSA 3LQJA 5LKZA 2L7PA 3N9QA 1LDKC 3U5PA 4QF3A 4ZDTA 2RSDA 3HCTA 4O62A 3T6RA 3IVQA 3M99A 2LDRA 3MQRA 3N9LA 4Z0OA 1WEQA 4FK5A 3O34A 1CZZA 5C13A 2L75A 1JOCA 2YUCA 4MSXA 5KH7A 4WZ0A 2ECJA 2YU4A 4N4FA 2K16A 2LGVA 2YSJA 5D1LB 4JJQA 3FM8C 4QF2A 3MHSA 1D0AA 2E61A 4FIPA 4MVTA 2FD4A 3I2DA 5D1KB 1WEWA 3MHHA 4GB0A 4V3KC 4Z0RA 3O70A 4CA1A 1CA4A 1X4JA 2M3HA 3NG2A 3DQVR 3GV4A 3H7HA 2ECVA 1N87A 5B76A 2GKWA 2LV9A 1F62A 5KH9A 2MD7B 4Q6FA 2MNYA 1T1HA 3KNVA 3L11A 3T7LA 4R7EA 4YBMA 1CZYA 4I7CA 4I7BA 4R8PK 5DINA 2KREA 3QZVA 1RF3A 3MQSC 2LXPC 1LB4A 2VJEA 2JM3A 2KGGA 3PHDA 4AYCA 2MUMA 2KWNA 2YW8A 5FEYA 3O33A 2C2LA 4QQ4A 3M62A 3Q1DA 3ZYQA 1XWHA 1F3VB 2F1WA 5B77A 4WZ2A 4S3OB 2VPDA 4PTBA 3U5OA 1VYXA 1E4UA 4C9ZA 3SHBA 2M1RA 5FB0A 1KZZA 5E1TA 2FOOA 3U5MA 1FLLA 5H1UA 4WZ3B 4H9DA 5G04B 3FANA 2B0OE 3MDBC 3E2DA 1WEEA 2VPEA 2H0DA 4R2YA 5AIUA 3C6WA 3EB6A 1D01A 3LVRE 3V43A 2F42A 1X4UA 4OGEA 2L43A 3KQIA 1CA9A 2VNFA 5H1VA 4AUQB 1WGMA 2KYUA 1CHCA 3LDYA 3PURA 2YQMA 2CR2A 2F6JA 5H1TA 2KE1A 2CRWA 4V3LC 2KKXA 4IC3A 1JM7A 2LGKA 2F6NA 4YBSA 2FFWA 2M6MA 5SVIB 2YHNA 2PUYA 3KDEC 4WA6A 3HQIA 2I50A 4YSIA 5LCWB 2VPGA 4YAXA 3HSVA 2QIZA 3ASLA 4YADA 4NN2A 5FERA 2VP7A 4A4BA 2F1YA 1WENA 3N9OA 4GNDA 2YREA 3PLWA 2KWJA 2LGLA 2VJFA 4L7XA 3SOUA 5DKAA 1QSCA 1RMDA 2HYED 2KKYA 3LRQA 2DX8A 4W4UA 4IC2A 4YATA 4LKAA 5G0FA 2RR4A 4LADB 2YT5A 2CSZA 1DCQA 4GJHA 4M4EA 2Y1NA 2QJ0A 3HCSA 3ZPVE 2AN6A 2CKLB 2EODA 4P5OB 1WESA 2L80A 4ZUXU 4A4CA 2FUIA 2M13A 4LJNA 1WFKA 2L5UA 1BORA 2IDAA 3RPGC 3LQIA 2XEUA 4B7YC 5TDRA 2K4DA 4Z8MA 1WILA 2E6SA 3FAOA 4L58A 1WE9A 2EGPA 3C5KA 5LKXA 1FP0A 4YABA 2KWOA 3ZJBA 2MA6A 4LLBA 4O64A 1MM3A 2CSVA 1D0JA 2XP0A 3M63A 5TBNA 3DDTA 1VD4A 2CONA 3N9NA 2G6QA 5B8DA 3N9PA 4A0CD 3KV5A 3O7AA 5LKTA 2CRRA 4GHUA 3T9KA 2KR4A 2YYRA 2OWAA 3VK6A 1WEVA 3O35A 2KWKA 2JMDA 5I3LA 2UZGA 3KV6A 1YZEA 4X3GA 2OXQC 1Z60A 2D8UA 2DSMA 2LXHC 5D1MB 5SVYA 2LRIC 4BBQA 4N3WA 1MM2A 4GNGA 4FJCA 2LAUA 4UP0A 3SOWA 3FEHA 3PUQA 2P57A 2PNXA 4KG9A 5B75A 2DJAA 1FLKA 3U5NA 1L0AA 1WEPA 4TKPB 1V87A 2HDPA 2L0BA 4XI1A 4CCGX 5K3QA 4UP5A 1LDJB 5KH3A 3GL6A 2ZETC 2FOJA 5TDWA 1Z2QA 2M85A 1VFYA 2G45A 2FSAA 5TABA 4O1VA 1LB6A 2CT2A 3HTKC 3SOXA 3SUBA 5C11A 5AITA 3IHPA 2C2VS 2LGGA 4ZQLA 1DVPA 2VJEB 2FOPA 3ZPV1 5B78A 3HQLA 1WEOA 1WEUA 3RPGB 3IVBA 3O37A 3ZTGA 4AYCB 3HCUA 4YC9A 4AVXA 2F1ZA 2YSMA 2MD8C 3FL2A 4BHWA 4AP4A 4GWNA 2ECNA 5J3XA 2JUNA 1HYJA 2G43A 2RI7A 2F1XA 2YVRA 2XOZA 1IYMA
chains in the Genus database with same CATH topology
2YHOA 2KFTA 2YURA 2CSYA 2XB1A 3HQHA 2MNZA 5JG6A 3HU6A 2ECTA 4GWMA 2KIZA 2H0DB 2Y1MA 3LQHA 1HYIA 4UI9B 4FO9A 1WIMA 2ECGA 5EYAF 1FBVA 2XXNA 1YY6A 3L1XA 3L1ZB 4A49A 1U6GB 2MA5A 2K17A 2D8SA 5H9MA 2EA6A 2BAYA 1G25A 4K8UA 2KGIA 4PPEA 4GNEA 2QICA 3IVVA 2YQLA 3ZNIA 3O36A 1JM7B 2NAAA 3N9MA 3ZVZB 2MIQA 2CKLA 2Y43A 3DPLR 1D00A 1WEMA 1ZBDB 4YBTA 3EB5A 2LQ6A 4F52B 3HQMA 5G05B 4B86C 3RTRB 5LKUA 2A25A 2MT5A 2VJFB 1Z6UA 4LK9A 4S3OC 2K1JA 2JRJA 2ECIA 4GNFA 2VPBA 1K2FA 2JMIA 1LB5A 1X4IA 2KU3A 2JMJA 5TRBA 2FUUA 3ZVYA 2LN0A 5FB1A 4I7DA 2E6RA 5B79A 2ECWA 1ZMSA 3LQJA 5LKZA 3N9QA 1LDKC 3U5PA 4QF3A 4ZDTA 2RSDA 3HCTA 3T6RA 3IVQA 3M99A 2LDRA 3MQRA 3N9LA 1WEQA 4FK5A 3O34A 1CZZA 5C13A 2L75A 1JOCA 2YUCA 4MSXA 5KH7A 4WZ0A 2ECJA 2YU4A 4N4FA 2K16A 2LGVA 2YSJA 5D1LB 4JJQA 4QF2A 3MHSA 1D0AA 4FIPA 4MVTA 3I2DA 5D1KB 1WEWA 3MHHA 4GB0A 4V3KC 3O70A 4CA1A 1CA4A 1X4JA 2M3HA 3NG2A 3DQVR 3GV4A 2ECVA 1N87A 5B76A 2GKWA 2LV9A 1F62A 5KH9A 2MD7B 4Q6FA 2MNYA 1T1HA 3KNVA 3L11A 3T7LA 4R7EA 4YBMA 1CZYA 4I7CA 4I7BA 4R8PK 5DINA 2KREA 3QZVA 1RF3A 3MQSC 2LXPC 1LB4A 2VJEA 2KGGA 3PHDA 4AYCA 2MUMA 2KWNA 2YW8A 5FEYA 3O33A 2C2LA 3M62A 3ZYQA 1XWHA 1F3VB 2F1WA 5B77A 4WZ2A 4S3OB 4PTBA 3U5OA 1VYXA 1E4UA 4C9ZA 3SHBA 2M1RA 5FB0A 1KZZA 5E1TA 2FOOA 3U5MA 1FLLA 5H1UA 4WZ3B 5G04B 1WEEA 2VPEA 2H0DA 4R2YA 5AIUA 3C6WA 3EB6A 1D01A 3V43A 2F42A 1X4UA 2L43A 3KQIA 1CA9A 2VNFA 5H1VA 4AUQB 1WGMA 2KYUA 1CHCA 3PURA 2YQMA 2CR2A 2F6JA 5H1TA 2KE1A 4V3LC 4IC3A 1JM7A 2LGKA 2F6NA 4YBSA 2M6MA 2YHNA 2PUYA 4WA6A 3HQIA 2I50A 4YSIA 5LCWB 2VPGA 4YAXA 3HSVA 2QIZA 3ASLA 4YADA 4NN2A 5FERA 2VP7A 4A4BA 2F1YA 1WENA 3N9OA 4GNDA 2YREA 2KWJA 2LGLA 2VJFA 4L7XA 3SOUA 5DKAA 1QSCA 1RMDA 2HYED 3LRQA 2DX8A 4W4UA 4IC2A 4YATA 4LKAA 5G0FA 4LADB 2YT5A 2CSZA 4GJHA 4M4EA 2Y1NA 2QJ0A 3HCSA 3ZPVE 2AN6A 2CKLB 2EODA 4P5OB 1WESA 2L80A 4ZUXU 4A4CA 2FUIA 4LJNA 1WFKA 2L5UA 1BORA 2IDAA 3RPGC 3LQIA 2XEUA 4B7YC 5TDRA 2K4DA 4Z8MA 1WILA 2E6SA 4L58A 1WE9A 2EGPA 3C5KA 5LKXA 1FP0A 4YABA 2KWOA 3ZJBA 2MA6A 4LLBA 4O64A 1MM3A 1D0JA 3M63A 5TBNA 1VD4A 3N9NA 2G6QA 5B8DA 3N9PA 4A0CD 3KV5A 3O7AA 5LKTA 4GHUA 2KR4A 2YYRA 3VK6A 1WEVA 3O35A 2KWKA 2JMDA 5I3LA 2UZGA 3KV6A 1YZEA 4X3GA 2OXQC 1Z60A 2LXHC 5D1MB 4BBQA 2LRIC 4N3WA 1MM2A 4GNGA 4FJCA 4UP0A 3SOWA 3PUQA 2PNXA 4KG9A 5B75A 1FLKA 3U5NA 1L0AA 1WEPA 4TKPB 1V87A 2HDPA 2L0BA 4XI1A 4CCGX 4UP5A 1LDJB 5KH3A 3GL6A 2ZETC 2FOJA 5TDWA 1Z2QA 2M85A 1VFYA 2G45A 2FSAA 5TABA 4O1VA 1LB6A 2CT2A 3HTKC 3SOXA 5C11A 5AITA 3IHPA 2C2VS 2LGGA 4ZQLA 1DVPA 2VJEB 2FOPA 3ZPV1 5B78A 3HQLA 1WEOA 1WEUA 3RPGB 3IVBA 3O37A 3ZTGA 4AYCB 3HCUA 4YC9A 4AVXA 2F1ZA 2YSMA 2MD8C 3FL2A 4BHWA 4AP4A 4GWNA 2ECNA 5J3XA 1HYJA 2G43A 2RI7A 2F1XA 2VPDA 1IYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHO A;  2KFT A;  2YUR A;  2CSY A;  2XB1 A;  3HQH A;  2MNZ A;  5JG6 A;  3HU6 A;  2ECT A;  4GWM A;  2KIZ A;  2H0D B;  2Y1M A;  3LQH A;  1HYI A;  4UI9 B;  4FO9 A;  1WIM A;  2ECG A;  5EYA F;  1FBV A;  2XXN A;  1YY6 A;  3L1X A;  3L1Z B;  4A49 A;  1U6G B;  2MA5 A;  2K17 A;  2D8S A;  5H9M A;  2EA6 A;  2BAY A;  1G25 A;  4K8U A;  2KGI A;  4PPE A;  4GNE A;  2QIC A;  3IVV A;  2YQL A;  3ZNI A;  3O36 A;  1JM7 B;  2NAA A;  3N9M A;  3ZVZ B;  2MIQ A;  2CKL A;  2Y43 A;  3DPL R;  1D00 A;  1WEM A;  1ZBD B;  4YBT A;  3EB5 A;  2LQ6 A;  4F52 B;  3HQM A;  5G05 B;  4B86 C;  3RTR B;  5LKU A;  2A25 A;  2MT5 A;  2VJF B;  1Z6U A;  4LK9 A;  4S3O C;  2K1J A;  2JRJ A;  2ECI A;  4GNF A;  2VPB A;  1K2F A;  2JMI A;  1LB5 A;  1X4I A;  2KU3 A;  2JMJ A;  5TRB A;  2FUU A;  3ZVY A;  2LN0 A;  5FB1 A;  4I7D A;  2E6R A;  5B79 A;  2ECW A;  1ZMS A;  3LQJ A;  5LKZ A;  3N9Q A;  1LDK C;  3U5P A;  4QF3 A;  4ZDT A;  2RSD A;  3HCT A;  3T6R A;  3IVQ A;  3M99 A;  2LDR A;  3MQR A;  3N9L A;  1WEQ A;  4FK5 A;  3O34 A;  1CZZ A;  5C13 A;  2L75 A;  1JOC A;  2YUC A;  4MSX A;  5KH7 A;  4WZ0 A;  2ECJ A;  2YU4 A;  4N4F A;  2K16 A;  2LGV A;  2YSJ A;  5D1L B;  4JJQ A;  4QF2 A;  3MHS A;  1D0A A;  4FIP A;  4MVT A;  3I2D A;  5D1K B;  1WEW A;  3MHH A;  4GB0 A;  4V3K C;  3O70 A;  4CA1 A;  1CA4 A;  1X4J A;  2M3H A;  3NG2 A;  3DQV R;  3GV4 A;  2ECV A;  1N87 A;  5B76 A;  2GKW A;  2LV9 A;  1F62 A;  5KH9 A;  2MD7 B;  4Q6F A;  2MNY A;  1T1H A;  3KNV A;  3L11 A;  3T7L A;  4R7E A;  4YBM A;  1CZY A;  4I7C A;  4I7B A;  4R8P K;  5DIN A;  2KRE A;  3QZV A;  1RF3 A;  3MQS C;  2LXP C;  1LB4 A;  2VJE A;  2KGG A;  3PHD A;  4AYC A;  2MUM A;  2KWN A;  2YW8 A;  5FEY A;  3O33 A;  2C2L A;  3M62 A;  3ZYQ A;  1XWH A;  1F3V B;  2F1W A;  5B77 A;  4WZ2 A;  4S3O B;  4PTB A;  3U5O A;  1VYX A;  1E4U A;  4C9Z A;  3SHB A;  2M1R A;  5FB0 A;  1KZZ A;  5E1T A;  2FOO A;  3U5M A;  1FLL A;  5H1U A;  4WZ3 B;  5G04 B;  1WEE A;  2VPE A;  2H0D A;  4R2Y A;  5AIU A;  3C6W A;  3EB6 A;  1D01 A;  3V43 A;  2F42 A;  1X4U A;  2L43 A;  3KQI A;  1CA9 A;  2VNF A;  5H1V A;  4AUQ B;  1WGM A;  2KYU A;  1CHC A;  3PUR A;  2YQM A;  2CR2 A;  2F6J A;  5H1T A;  2KE1 A;  4V3L C;  4IC3 A;  1JM7 A;  2LGK A;  2F6N A;  4YBS A;  2M6M A;  2YHN A;  2PUY A;  4WA6 A;  3HQI A;  2I50 A;  4YSI A;  5LCW B;  2VPG A;  4YAX A;  3HSV A;  2QIZ A;  3ASL A;  4YAD A;  4NN2 A;  5FER A;  2VP7 A;  4A4B A;  2F1Y A;  1WEN A;  3N9O A;  4GND A;  2YRE A;  2KWJ A;  2LGL A;  2VJF A;  4L7X A;  3SOU A;  5DKA A;  1QSC A;  1RMD A;  2HYE D;  3LRQ A;  2DX8 A;  4W4U A;  4IC2 A;  4YAT A;  4LKA A;  5G0F A;  4LAD B;  2YT5 A;  2CSZ A;  4GJH A;  4M4E A;  2Y1N A;  2QJ0 A;  3HCS A;  3ZPV E;  2AN6 A;  2CKL B;  2EOD A;  4P5O B;  1WES A;  2L80 A;  4ZUX U;  4A4C A;  2FUI A;  4LJN A;  1WFK A;  2L5U A;  1BOR A;  2IDA A;  3RPG C;  3LQI A;  2XEU A;  4B7Y C;  5TDR A;  2K4D A;  4Z8M A;  1WIL A;  2E6S A;  4L58 A;  1WE9 A;  2EGP A;  3C5K A;  5LKX A;  1FP0 A;  4YAB A;  2KWO A;  3ZJB A;  2MA6 A;  4LLB A;  4O64 A;  1MM3 A;  1D0J A;  3M63 A;  5TBN A;  1VD4 A;  3N9N A;  2G6Q A;  5B8D A;  3N9P A;  4A0C D;  3KV5 A;  3O7A A;  5LKT A;  4GHU A;  2KR4 A;  2YYR A;  3VK6 A;  1WEV A;  3O35 A;  2KWK A;  2JMD A;  5I3L A;  2UZG A;  3KV6 A;  1YZE A;  4X3G A;  2OXQ C;  1Z60 A;  2LXH C;  5D1M B;  4BBQ A;  2LRI C;  4N3W A;  1MM2 A;  4GNG A;  4FJC A;  4UP0 A;  3SOW A;  3PUQ A;  2PNX A;  4KG9 A;  5B75 A;  1FLK A;  3U5N A;  1L0A A;  1WEP A;  4TKP B;  1V87 A;  2HDP A;  2L0B A;  4XI1 A;  4CCG X;  4UP5 A;  1LDJ B;  5KH3 A;  3GL6 A;  2ZET C;  2FOJ A;  5TDW A;  1Z2Q A;  2M85 A;  1VFY A;  2G45 A;  2FSA A;  5TAB A;  4O1V A;  1LB6 A;  2CT2 A;  3HTK C;  3SOX A;  5C11 A;  5AIT A;  3IHP A;  2C2V S;  2LGG A;  4ZQL A;  1DVP A;  2VJE B;  2FOP A;  3ZPV 1;  5B78 A;  3HQL A;  1WEO A;  1WEU A;  3RPG B;  3IVB A;  3O37 A;  3ZTG A;  4AYC B;  3HCU A;  4YC9 A;  4AVX A;  2F1Z A;  2YSM A;  2MD8 C;  3FL2 A;  4BHW A;  4AP4 A;  4GWN A;  2ECN A;  5J3X A;  1HYJ A;  2G43 A;  2RI7 A;  2F1X A;  2VPD A;  1IYM A; 
#chains in the Genus database with same CATH topology
 2YHO A;  5SVI A;  2KFT A;  2YUR A;  2CSY A;  2XB1 A;  3HQH A;  2MNZ A;  5JG6 A;  3HU6 A;  2ECT A;  4GWM A;  2KIZ A;  2H0D B;  2Y1M A;  3LQH A;  1HYI A;  4UI9 B;  4FO9 A;  1WIM A;  2IQJ A;  2ECG A;  5EYA F;  1FBV A;  2XXN A;  1YY6 A;  3L1X A;  3L1Z B;  4A49 A;  1U6G B;  3O47 A;  2XOY A;  2MA5 A;  3FJU B;  2K17 A;  2D8S A;  5H9M A;  2EA6 A;  2BAY A;  1G25 A;  4K8U A;  2KGI A;  4PPE A;  4OGC A;  4GNE A;  2QIC A;  3IVV A;  4F1P A;  2YQL A;  1MBM A;  3ZNI A;  3O36 A;  1JM7 B;  2NAA A;  3N9M A;  3ZVZ B;  2MIQ A;  2CKL A;  2Y43 A;  3DPL R;  3M7K A;  2EXU A;  1D00 A;  1WEM A;  3LVQ E;  1ZBD B;  4YBT A;  5SVX A;  2EGM A;  3EB5 A;  2LQ6 A;  4F52 B;  3DWD A;  3HQM A;  5G05 B;  4B86 C;  3RTR B;  5LKU A;  2MKE A;  2A25 A;  2MT5 A;  2VJF B;  2XOC A;  1Z6U A;  4LK9 A;  4S3O C;  3LJU X;  2K1J A;  2JRJ A;  2ECI A;  4GNF A;  2VPB A;  1K2F A;  2JMI A;  1LB5 A;  1X4I A;  2KU3 A;  2JMJ A;  5TRB A;  2FUU A;  3ZVY A;  2LN0 A;  3JUE A;  5FB1 A;  4I7D A;  2E6R A;  5B79 A;  2ECW A;  1ZMS A;  3LQJ A;  5LKZ A;  2L7P A;  3N9Q A;  1LDK C;  3U5P A;  4QF3 A;  4ZDT A;  2RSD A;  3HCT A;  4O62 A;  3T6R A;  3IVQ A;  3M99 A;  2LDR A;  3MQR A;  3N9L A;  4Z0O A;  1WEQ A;  4FK5 A;  3O34 A;  1CZZ A;  5C13 A;  2L75 A;  1JOC A;  2YUC A;  4MSX A;  5KH7 A;  4WZ0 A;  2ECJ A;  2YU4 A;  4N4F A;  2K16 A;  2LGV A;  2YSJ A;  5D1L B;  4JJQ A;  3FM8 C;  4QF2 A;  3MHS A;  1D0A A;  2E61 A;  4FIP A;  4MVT A;  2FD4 A;  3I2D A;  5D1K B;  1WEW A;  3MHH A;  4GB0 A;  4V3K C;  4Z0R A;  3O70 A;  4CA1 A;  1CA4 A;  1X4J A;  2M3H A;  3NG2 A;  3DQV R;  3GV4 A;  3H7H A;  2ECV A;  1N87 A;  5B76 A;  2GKW A;  2LV9 A;  1F62 A;  5KH9 A;  2MD7 B;  4Q6F A;  2MNY A;  1T1H A;  3KNV A;  3L11 A;  3T7L A;  4R7E A;  4YBM A;  1CZY A;  4I7C A;  4I7B A;  4R8P K;  5DIN A;  2KRE A;  3QZV A;  1RF3 A;  3MQS C;  2LXP C;  1LB4 A;  2VJE A;  2JM3 A;  2KGG A;  3PHD A;  4AYC A;  2MUM A;  2KWN A;  2YW8 A;  5FEY A;  3O33 A;  2C2L A;  4QQ4 A;  3M62 A;  3Q1D A;  3ZYQ A;  1XWH A;  1F3V B;  2F1W A;  5B77 A;  4WZ2 A;  4S3O B;  2VPD A;  4PTB A;  3U5O A;  1VYX A;  1E4U A;  4C9Z A;  3SHB A;  2M1R A;  5FB0 A;  1KZZ A;  5E1T A;  2FOO A;  3U5M A;  1FLL A;  5H1U A;  4WZ3 B;  4H9D A;  5G04 B;  3FAN A;  2B0O E;  3MDB C;  3E2D A;  1WEE A;  2VPE A;  2H0D A;  4R2Y A;  5AIU A;  3C6W A;  3EB6 A;  1D01 A;  3LVR E;  3V43 A;  2F42 A;  1X4U A;  4OGE A;  2L43 A;  3KQI A;  1CA9 A;  2VNF A;  5H1V A;  4AUQ B;  1WGM A;  2KYU A;  1CHC A;  3LDY A;  3PUR A;  2YQM A;  2CR2 A;  2F6J A;  5H1T A;  2KE1 A;  2CRW A;  4V3L C;  2KKX A;  4IC3 A;  1JM7 A;  2LGK A;  2F6N A;  4YBS A;  2FFW A;  2M6M A;  5SVI B;  2YHN A;  2PUY A;  3KDE C;  4WA6 A;  3HQI A;  2I50 A;  4YSI A;  5LCW B;  2VPG A;  4YAX A;  3HSV A;  2QIZ A;  3ASL A;  4YAD A;  4NN2 A;  5FER A;  2VP7 A;  4A4B A;  2F1Y A;  1WEN A;  3N9O A;  4GND A;  2YRE A;  3PLW A;  2KWJ A;  2LGL A;  2VJF A;  4L7X A;  3SOU A;  5DKA A;  1QSC A;  1RMD A;  2HYE D;  2KKY A;  3LRQ A;  2DX8 A;  4W4U A;  4IC2 A;  4YAT A;  4LKA A;  5G0F A;  2RR4 A;  4LAD B;  2YT5 A;  2CSZ A;  1DCQ A;  4GJH A;  4M4E A;  2Y1N A;  2QJ0 A;  3HCS A;  3ZPV E;  2AN6 A;  2CKL B;  2EOD A;  4P5O B;  1WES A;  2L80 A;  4ZUX U;  4A4C A;  2FUI A;  2M13 A;  4LJN A;  1WFK A;  2L5U A;  1BOR A;  2IDA A;  3RPG C;  3LQI A;  2XEU A;  4B7Y C;  5TDR A;  2K4D A;  4Z8M A;  1WIL A;  2E6S A;  3FAO A;  4L58 A;  1WE9 A;  2EGP A;  3C5K A;  5LKX A;  1FP0 A;  4YAB A;  2KWO A;  3ZJB A;  2MA6 A;  4LLB A;  4O64 A;  1MM3 A;  2CSV A;  1D0J A;  2XP0 A;  3M63 A;  5TBN A;  3DDT A;  1VD4 A;  2CON A;  3N9N A;  2G6Q A;  5B8D A;  3N9P A;  4A0C D;  3KV5 A;  3O7A A;  5LKT A;  2CRR A;  4GHU A;  3T9K A;  2KR4 A;  2YYR A;  2OWA A;  3VK6 A;  1WEV A;  3O35 A;  2KWK A;  2JMD A;  5I3L A;  2UZG A;  3KV6 A;  1YZE A;  4X3G A;  2OXQ C;  1Z60 A;  2D8U A;  2DSM A;  2LXH C;  5D1M B;  5SVY A;  2LRI C;  4BBQ A;  4N3W A;  1MM2 A;  4GNG A;  4FJC A;  2LAU A;  4UP0 A;  3SOW A;  3FEH A;  3PUQ A;  2P57 A;  2PNX A;  4KG9 A;  5B75 A;  2DJA A;  1FLK A;  3U5N A;  1L0A A;  1WEP A;  4TKP B;  1V87 A;  2HDP A;  2L0B A;  4XI1 A;  4CCG X;  5K3Q A;  4UP5 A;  1LDJ B;  5KH3 A;  3GL6 A;  2ZET C;  2FOJ A;  5TDW A;  1Z2Q A;  2M85 A;  1VFY A;  2G45 A;  2FSA A;  5TAB A;  4O1V A;  1LB6 A;  2CT2 A;  3HTK C;  3SOX A;  3SUB A;  5C11 A;  5AIT A;  3IHP A;  2C2V S;  2LGG A;  4ZQL A;  1DVP A;  2VJE B;  2FOP A;  3ZPV 1;  5B78 A;  3HQL A;  1WEO A;  1WEU A;  3RPG B;  3IVB A;  3O37 A;  3ZTG A;  4AYC B;  3HCU A;  4YC9 A;  4AVX A;  2F1Z A;  2YSM A;  2MD8 C;  3FL2 A;  4BHW A;  4AP4 A;  4GWN A;  2ECN A;  5J3X A;  2JUN A;  1HYJ A;  2G43 A;  2RI7 A;  2F1X A;  2YVR A;  2XOZ A;  1IYM A; 
#chains in the Genus database with same CATH homology
 2YHO A;  2KFT A;  2YUR A;  2CSY A;  2XB1 A;  3HQH A;  2MNZ A;  5JG6 A;  3HU6 A;  2ECT A;  4GWM A;  2KIZ A;  2H0D B;  2Y1M A;  3LQH A;  1HYI A;  4UI9 B;  4FO9 A;  1WIM A;  2ECG A;  5EYA F;  1FBV A;  2XXN A;  1YY6 A;  3L1X A;  3L1Z B;  4A49 A;  1U6G B;  2MA5 A;  2K17 A;  2D8S A;  5H9M A;  2EA6 A;  2BAY A;  1G25 A;  4K8U A;  2KGI A;  4PPE A;  4GNE A;  2QIC A;  3IVV A;  2YQL A;  3ZNI A;  3O36 A;  1JM7 B;  2NAA A;  3N9M A;  3ZVZ B;  2MIQ A;  2CKL A;  2Y43 A;  3DPL R;  1D00 A;  1WEM A;  1ZBD B;  4YBT A;  3EB5 A;  2LQ6 A;  4F52 B;  3HQM A;  5G05 B;  4B86 C;  3RTR B;  5LKU A;  2A25 A;  2MT5 A;  2VJF B;  1Z6U A;  4LK9 A;  4S3O C;  2K1J A;  2JRJ A;  2ECI A;  4GNF A;  2VPB A;  1K2F A;  2JMI A;  1LB5 A;  1X4I A;  2KU3 A;  2JMJ A;  5TRB A;  2FUU A;  3ZVY A;  2LN0 A;  5FB1 A;  4I7D A;  2E6R A;  5B79 A;  2ECW A;  1ZMS A;  3LQJ A;  5LKZ A;  3N9Q A;  1LDK C;  3U5P A;  4QF3 A;  4ZDT A;  2RSD A;  3HCT A;  3T6R A;  3IVQ A;  3M99 A;  2LDR A;  3MQR A;  3N9L A;  1WEQ A;  4FK5 A;  3O34 A;  1CZZ A;  5C13 A;  2L75 A;  1JOC A;  2YUC A;  4MSX A;  5KH7 A;  4WZ0 A;  2ECJ A;  2YU4 A;  4N4F A;  2K16 A;  2LGV A;  2YSJ A;  5D1L B;  4JJQ A;  4QF2 A;  3MHS A;  1D0A A;  4FIP A;  4MVT A;  3I2D A;  5D1K B;  1WEW A;  3MHH A;  4GB0 A;  4V3K C;  3O70 A;  4CA1 A;  1CA4 A;  1X4J A;  2M3H A;  3NG2 A;  3DQV R;  3GV4 A;  2ECV A;  1N87 A;  5B76 A;  2GKW A;  2LV9 A;  1F62 A;  5KH9 A;  2MD7 B;  4Q6F A;  2MNY A;  1T1H A;  3KNV A;  3L11 A;  3T7L A;  4R7E A;  4YBM A;  1CZY A;  4I7C A;  4I7B A;  4R8P K;  5DIN A;  2KRE A;  3QZV A;  1RF3 A;  3MQS C;  2LXP C;  1LB4 A;  2VJE A;  2KGG A;  3PHD A;  4AYC A;  2MUM A;  2KWN A;  2YW8 A;  5FEY A;  3O33 A;  2C2L A;  3M62 A;  3ZYQ A;  1XWH A;  1F3V B;  2F1W A;  5B77 A;  4WZ2 A;  4S3O B;  4PTB A;  3U5O A;  1VYX A;  1E4U A;  4C9Z A;  3SHB A;  2M1R A;  5FB0 A;  1KZZ A;  5E1T A;  2FOO A;  3U5M A;  1FLL A;  5H1U A;  4WZ3 B;  5G04 B;  1WEE A;  2VPE A;  2H0D A;  4R2Y A;  5AIU A;  3C6W A;  3EB6 A;  1D01 A;  3V43 A;  2F42 A;  1X4U A;  2L43 A;  3KQI A;  1CA9 A;  2VNF A;  5H1V A;  4AUQ B;  1WGM A;  2KYU A;  1CHC A;  3PUR A;  2YQM A;  2CR2 A;  2F6J A;  5H1T A;  2KE1 A;  4V3L C;  4IC3 A;  1JM7 A;  2LGK A;  2F6N A;  4YBS A;  2M6M A;  2YHN A;  2PUY A;  4WA6 A;  3HQI A;  2I50 A;  4YSI A;  5LCW B;  2VPG A;  4YAX A;  3HSV A;  2QIZ A;  3ASL A;  4YAD A;  4NN2 A;  5FER A;  2VP7 A;  4A4B A;  2F1Y A;  1WEN A;  3N9O A;  4GND A;  2YRE A;  2KWJ A;  2LGL A;  2VJF A;  4L7X A;  3SOU A;  5DKA A;  1QSC A;  1RMD A;  2HYE D;  3LRQ A;  2DX8 A;  4W4U A;  4IC2 A;  4YAT A;  4LKA A;  5G0F A;  4LAD B;  2YT5 A;  2CSZ A;  4GJH A;  4M4E A;  2Y1N A;  2QJ0 A;  3HCS A;  3ZPV E;  2AN6 A;  2CKL B;  2EOD A;  4P5O B;  1WES A;  2L80 A;  4ZUX U;  4A4C A;  2FUI A;  4LJN A;  1WFK A;  2L5U A;  1BOR A;  2IDA A;  3RPG C;  3LQI A;  2XEU A;  4B7Y C;  5TDR A;  2K4D A;  4Z8M A;  1WIL A;  2E6S A;  4L58 A;  1WE9 A;  2EGP A;  3C5K A;  5LKX A;  1FP0 A;  4YAB A;  2KWO A;  3ZJB A;  2MA6 A;  4LLB A;  4O64 A;  1MM3 A;  1D0J A;  3M63 A;  5TBN A;  1VD4 A;  3N9N A;  2G6Q A;  5B8D A;  3N9P A;  4A0C D;  3KV5 A;  3O7A A;  5LKT A;  4GHU A;  2KR4 A;  2YYR A;  3VK6 A;  1WEV A;  3O35 A;  2KWK A;  2JMD A;  5I3L A;  2UZG A;  3KV6 A;  1YZE A;  4X3G A;  2OXQ C;  1Z60 A;  2LXH C;  5D1M B;  4BBQ A;  2LRI C;  4N3W A;  1MM2 A;  4GNG A;  4FJC A;  4UP0 A;  3SOW A;  3PUQ A;  2PNX A;  4KG9 A;  5B75 A;  1FLK A;  3U5N A;  1L0A A;  1WEP A;  4TKP B;  1V87 A;  2HDP A;  2L0B A;  4XI1 A;  4CCG X;  4UP5 A;  1LDJ B;  5KH3 A;  3GL6 A;  2ZET C;  2FOJ A;  5TDW A;  1Z2Q A;  2M85 A;  1VFY A;  2G45 A;  2FSA A;  5TAB A;  4O1V A;  1LB6 A;  2CT2 A;  3HTK C;  3SOX A;  5C11 A;  5AIT A;  3IHP A;  2C2V S;  2LGG A;  4ZQL A;  1DVP A;  2VJE B;  2FOP A;  3ZPV 1;  5B78 A;  3HQL A;  1WEO A;  1WEU A;  3RPG B;  3IVB A;  3O37 A;  3ZTG A;  4AYC B;  3HCU A;  4YC9 A;  4AVX A;  2F1Z A;  2YSM A;  2MD8 C;  3FL2 A;  4BHW A;  4AP4 A;  4GWN A;  2ECN A;  5J3X A;  1HYJ A;  2G43 A;  2RI7 A;  2F1X A;  2VPD A;  1IYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...