2AN6A

Protein-peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
191
structure length
191
Chain Sequence
NSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin ligase SIAH1A
publication title Elucidation of the substrate binding site of Siah ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2an6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2an6A01
2E6SA 1VFYA 1WEUA 3GV4A 3HQMA 1LB6A 1ZMSA 3ZYQA 2AN6A 4W4UA 4UP5A 2FUUA 2KIZA 2LV9A 3ASLA 4Z8MA 1X4JA 3M99A 5J3XA 4GWNA 4BBQA 3T7LA 3N9MA 5H1UA 1BORA 2MA6A 4GNDA 2YU4A 2PNXA 5H9MA 2LQ6A 3HCTA 1X4IA 4TKPB 4GNFA 2L5UA 3IVVA 3ZVYA 1WESA 3QZVA 4P5OB 5EYAF 2CT2A 2LXPC 3SOXA 1LDKC 1Z2QA 2VPDA 4YBTA 4ZQLA 1FBVA 4WZ3B 3ZJBA 4XI1A 4O64A 2YQLA 2JMJA 3L11A 4ZUXU 1HYIA 5LKUA 4YATA 5LKZA 2MUMA 2MD8C 3HQHA 2K17A 2ECJA 1D00A 3SOUA 2M1RA 1D0AA 1WIMA 2F1ZA 2G6QA 5E1TA 3MHHA 2YREA 2MNYA 3FL2A 2VJEA 3IVQA 4C9ZA 4YAXA 4AYCB 4KG9A 1JM7A 2KYUA 5DINA 3O33A 3N9NA 3SHBA 3LQIA 5B8DA 2H0DA 4YBMA 2LGKA 2HDPA 1WEQA 4YC9A 4S3OB 2GKWA 4K8UA 4YSIA 1D0JA 2YURA 2YT5A 3N9QA 2QJ0A 4N3WA 3IHPA 5JG6A 2BAYA 1FLLA 1U6GB 4LK9A 2F42A 4FK5A 2VPEA 4X3GA 2K16A 4YBSA 1JOCA 2L43A 1VYXA 4FO9A 1ZBDB 3M63A 3HQLA 4WA6A 3ZPV1 3U5OA 3I2DA 4N4FA 3HCSA 4B7YC 2A25A 2C2LA 3N9PA 2CSZA 2ECNA 3RPGB 5LKTA 1RMDA 4GHUA 2PUYA 4LADB 2KREA 3HCUA 3HSVA 4A0CD 2YQMA 4GNEA 3U5MA 5AITA 4WZ2A 3ZTGA 1WEMA 2CSYA 1WEVA 1WE9A 3DQVR 2ECWA 1F62A 3MQRA 3RPGC 5G04B 4AYCA 2M3HA 4AVXA 1CA4A 1CHCA 1CA9A 5D1LB 1FP0A 4CA1A 1G25A 4F52B 5FB1A 2KFTA 2KGGA 5LCWB 3VK6A 2YHNA 5D1KB 3O35A 3ZPVE 4GNGA 2LGGA 4QF2A 4O1VA 2IDAA 3SOWA 3HQIA 2EGPA 4GWMA 4FIPA 3L1ZB 5TDRA 1L0AA 2ZETC 2LN0A 2UZGA 2HYED 5H1TA 2KU3A 1Z60A 3U5NA 2QIZA 2MIQA 1F3VB 5TABA 5C11A 1DVPA 2VNFA 5LKXA 2VJFB 5DKAA 4I7CA 4M4EA 5B75A 2F6JA 2YSJA 5FB0A 2E6RA 5TDWA 3LQHA 1LB4A 2F1YA 2CKLB 5TRBA 4JJQA 2LDRA 3KV6A 4IC3A 4CCGX 1HYJA 4I7DA 1XWHA 2KWNA 1YZEA 2LGVA 2XB1A 1KZZA 4LLBA 5KH9A 3ZNIA 2F1XA 2QICA 2XXNA 1N87A 2NAAA 1YY6A 4I7BA 2LRIC 1VD4A 2Y1NA 2MD7B 2FUIA 1WEEA 1RF3A 1MM2A 1CZZA 3T6RA 2FSAA 2L80A 2M6MA 4PPEA 3V43A 4R8PK 5B76A 2MNZA 2KR4A 3HU6A 5D1MB 5H1VA 4BHWA 2ECIA 4MSXA 2EODA 2Y43A 1IYMA 2YHOA 2L75A 2RSDA 5FEYA 2F1WA 1V87A 1X4UA 2FOPA 3PHDA 5G0FA 2CR2A 2G43A 2LGLA 2YW8A 3EB5A 2YYRA 3MQSC 3N9OA 3C5KA 2FOOA 4Q6FA 2JMIA 3EB6A 1CZYA 3N9LA 2K1JA 3O7AA 1WGMA 2I50A 4NN2A 4V3KC 1QSCA 2VJFA 2MA5A 1Z6UA 2EA6A 2YUCA 4UI9B 4FJCA 5B77A 5KH7A 2ECGA 2YSMA 3MHSA 5B78A 2CKLA 3O34A 2VPGA 4R2YA 4AP4A 2VP7A 1E4UA 1T1HA 3M62A 2XEUA 3KNVA 4ZDTA 1WEOA 4A4CA 4LKAA 3O36A 1WENA 3LRQA 2ECVA 3C6WA 1D01A 3KQIA 4B86C 2Y1MA 3NG2A 1WFKA 3U5PA 3O37A 2DX8A 4GB0A 4PTBA 2D8SA 2KWJA 3PUQA 4GJHA 1K2FA 2LXHC 2MT5A 2ECTA 2F6NA 4WZ0A 5KH3A 5B79A 2G45A 1LB5A 3RTRB 2VPBA 3HTKC 3O70A 5AIUA 2FOJA 2OXQC 1WEWA 4UP0A 4IC2A 4A49A 1WILA 2KWOA 2L0BA 2RI7A 3GL6A 1FLKA 3LQJA 3ZVZB 2JMDA 2M85A 5C13A 4MVTA 3DPLR 5TBNA 4V3LC 5FERA 3KV5A 3L1XA 4A4BA 1LDJB 2VJEB 4L58A 1JM7B 3PURA 4R7EA 4QF3A 2K4DA 2JRJA 4S3OC 1MM3A 4AUQB 2H0DB 1WEPA 2KE1A 5G05B 2C2VS 4L7XA 4YADA 5I3LA 2KWKA 3IVBA 4LJNA 4YABA 2KGIA
chains in the Genus database with same CATH superfamily
3JUEA 2E6SA 1VFYA 1WEUA 3GV4A 3HQMA 1LB6A 1ZMSA 3ZYQA 2AN6A 4W4UA 4UP5A 2KKYA 2FUUA 2KIZA 2LV9A 3ASLA 4Z8MA 1X4JA 3M99A 5J3XA 4GWNA 4BBQA 3T7LA 3LDYA 3N9MA 5H1UA 1BORA 2MA6A 4GNDA 2IQJA 2YU4A 2PNXA 5H9MA 2LQ6A 3HCTA 1X4IA 2EXUA 4TKPB 4GNFA 2L5UA 3IVVA 3ZVYA 1WESA 3QZVA 2YVRA 4P5OB 5EYAF 2CT2A 2LXPC 3SOXA 1LDKC 1Z2QA 2VPDA 4YBTA 4ZQLA 3LVRE 1FBVA 4WZ3B 3ZJBA 4XI1A 4O64A 2YQLA 2JMJA 3L11A 4ZUXU 1HYIA 3T9KA 5LKUA 2CONA 4YATA 5LKZA 2MUMA 2MD8C 3HQHA 2K17A 2ECJA 1D00A 3SOUA 2M1RA 1D0AA 1WIMA 5SVIB 2F1ZA 2G6QA 5E1TA 3MHHA 2YREA 2MNYA 3FL2A 2VJEA 3IVQA 4C9ZA 4YAXA 4AYCB 4KG9A 1JM7A 2KYUA 3FEHA 5DINA 3O33A 3Q1DA 3N9NA 3SHBA 3LQIA 5B8DA 2H0DA 4YBMA 2LGKA 2HDPA 3LVQE 1WEQA 4YC9A 4S3OB 4OGEA 2GKWA 3O47A 4K8UA 4YSIA 1D0JA 2YURA 2YT5A 3N9QA 2QJ0A 4N3WA 3IHPA 5JG6A 2BAYA 1FLLA 1U6GB 4LK9A 2F42A 3FM8C 5SVYA 4FK5A 2VPEA 4X3GA 2RR4A 2K16A 4YBSA 1JOCA 2L43A 1VYXA 4FO9A 1ZBDB 3M63A 3M7KA 3HQLA 4WA6A 3ZPV1 3U5OA 3I2DA 4N4FA 3HCSA 4B7YC 2A25A 2C2LA 3N9PA 2CSZA 2ECNA 3RPGB 5LKTA 1RMDA 4GHUA 2PUYA 4LADB 2KREA 3HCUA 3HSVA 4A0CD 2YQMA 4GNEA 3H7HA 5SVXA 3U5MA 3LJUX 5AITA 3FJUB 4WZ2A 3ZTGA 1WEMA 5SVIA 2CSYA 1WEVA 1WE9A 3DQVR 2ECWA 2XOZA 1F62A 3MQRA 3FAOA 4H9DA 3RPGC 5G04B 4AYCA 2M3HA 4AVXA 1CA4A 1CHCA 1CA9A 2P57A 5D1LB 1FP0A 4CA1A 4QQ4A 1G25A 4F52B 5FB1A 2KFTA 2XP0A 2KGGA 5LCWB 3VK6A 2L7PA 2YHNA 5D1KB 3O35A 1DCQA 3ZPVE 4GNGA 2LGGA 4QF2A 4O1VA 2IDAA 3SOWA 3HQIA 2EGPA 4GWMA 4FIPA 4O62A 3L1ZB 5TDRA 1L0AA 2ZETC 2LN0A 2UZGA 2HYED 5H1TA 2KU3A 1Z60A 3U5NA 3PLWA 2QIZA 2MIQA 1F3VB 5TABA 5C11A 1DVPA 2VNFA 5LKXA 2VJFB 5DKAA 4I7CA 4M4EA 5B75A 2F6JA 2YSJA 5FB0A 2E6RA 5TDWA 3LQHA 1LB4A 2F1YA 2CKLB 5TRBA 4JJQA 2DSMA 2LDRA 3KDEC 3KV6A 4IC3A 2FFWA 4CCGX 1HYJA 4I7DA 1XWHA 2KWNA 1YZEA 2LGVA 2XB1A 1KZZA 4LLBA 5KH9A 3ZNIA 2F1XA 2EGMA 2QICA 2D8UA 2XXNA 1N87A 2NAAA 1YY6A 4I7BA 2LRIC 1VD4A 2Y1NA 2MD7B 2FUIA 1WEEA 1RF3A 1MM2A 1CZZA 3T6RA 2FSAA 1MBMA 2L80A 2M6MA 2KKXA 4PPEA 3V43A 4R8PK 5B76A 2MNZA 2KR4A 3HU6A 5D1MB 3SUBA 5H1VA 4BHWA 2ECIA 4MSXA 2EODA 2Y43A 1IYMA 2YHOA 2L75A 2RSDA 5FEYA 2F1WA 1V87A 1X4UA 2FOPA 3PHDA 5G0FA 4F1PA 2CR2A 2G43A 2LGLA 2YW8A 3EB5A 2YYRA 3MQSC 3N9OA 3C5KA 2FOOA 4Q6FA 2JMIA 3EB6A 1CZYA 3N9LA 2K1JA 3O7AA 5K3QA 2LAUA 1WGMA 2I50A 4NN2A 2CSVA 3DWDA 4V3KC 1QSCA 2VJFA 2MA5A 4OGCA 1Z6UA 2EA6A 2YUCA 4UI9B 4FJCA 5B77A 5KH7A 2ECGA 2YSMA 3MHSA 5B78A 2CKLA 3O34A 2VPGA 4R2YA 4Z0OA 4AP4A 2VP7A 1E4UA 1T1HA 3M62A 2XEUA 3KNVA 2FD4A 3MDBC 4ZDTA 1WEOA 2JUNA 4A4CA 4LKAA 3O36A 1WENA 3LRQA 2M13A 2ECVA 3C6WA 1D01A 3KQIA 4B86C 2Y1MA 3NG2A 1WFKA 3U5PA 3O37A 2DX8A 4GB0A 4PTBA 2D8SA 3DDTA 2KWJA 3PUQA 4GJHA 1K2FA 2LXHC 2MT5A 2ECTA 2F6NA 4WZ0A 2CRRA 5KH3A 5B79A 2G45A 1LB5A 3RTRB 2VPBA 3HTKC 3O70A 2XOYA 5AIUA 2FOJA 2OXQC 1WEWA 4UP0A 4IC2A 4A49A 2OWAA 2MKEA 2E61A 1WILA 2KWOA 2L0BA 2RI7A 3GL6A 2B0OE 1FLKA 2JM3A 3LQJA 4Z0RA 3ZVZB 2JMDA 2M85A 5C13A 4MVTA 3DPLR 5TBNA 2DJAA 4V3LC 5FERA 3KV5A 2CRWA 3L1XA 4A4BA 1LDJB 3E2DA 2VJEB 3FANA 4L58A 1JM7B 3PURA 4R7EA 4QF3A 2K4DA 2JRJA 4S3OC 1MM3A 4AUQB 2H0DB 1WEPA 2KE1A 5G05B 2C2VS 4L7XA 4YADA 5I3LA 2KWKA 3IVBA 2XOCA 4LJNA 4YABA 2KGIA
chains in the Genus database with same CATH topology
2E6SA 1VFYA 1WEUA 3GV4A 3HQMA 1LB6A 1ZMSA 3ZYQA 2AN6A 4W4UA 4UP5A 2FUUA 2KIZA 2LV9A 3ASLA 4Z8MA 1X4JA 3M99A 5J3XA 4GWNA 4BBQA 3T7LA 3N9MA 5H1UA 1BORA 2MA6A 4GNDA 2YU4A 2PNXA 5H9MA 2LQ6A 3HCTA 1X4IA 4TKPB 4GNFA 2L5UA 3IVVA 3ZVYA 1WESA 3QZVA 4P5OB 5EYAF 2CT2A 2LXPC 3SOXA 1LDKC 1Z2QA 2VPDA 4YBTA 4ZQLA 1FBVA 4WZ3B 3ZJBA 4XI1A 4O64A 2YQLA 2JMJA 3L11A 4ZUXU 1HYIA 5LKUA 4YATA 5LKZA 2MUMA 2MD8C 3HQHA 2K17A 2ECJA 1D00A 3SOUA 2M1RA 1D0AA 1WIMA 2F1ZA 2G6QA 5E1TA 3MHHA 2YREA 2MNYA 3FL2A 2VJEA 3IVQA 4C9ZA 4YAXA 4AYCB 4KG9A 1JM7A 2KYUA 5DINA 3O33A 3N9NA 3SHBA 3LQIA 5B8DA 2H0DA 4YBMA 2LGKA 2HDPA 1WEQA 4YC9A 4S3OB 2GKWA 4K8UA 4YSIA 1D0JA 2YURA 2YT5A 3N9QA 2QJ0A 4N3WA 3IHPA 5JG6A 2BAYA 1FLLA 1U6GB 4LK9A 2F42A 4FK5A 2VPEA 4X3GA 2K16A 4YBSA 1JOCA 2L43A 1VYXA 4FO9A 1ZBDB 3M63A 3HQLA 4WA6A 3ZPV1 3U5OA 3I2DA 4N4FA 3HCSA 4B7YC 2A25A 2C2LA 3N9PA 2CSZA 2ECNA 3RPGB 5LKTA 1RMDA 4GHUA 2PUYA 4LADB 2KREA 3HCUA 3HSVA 4A0CD 2YQMA 4GNEA 3U5MA 5AITA 4WZ2A 3ZTGA 1WEMA 2CSYA 1WEVA 1WE9A 3DQVR 2ECWA 1F62A 3MQRA 3RPGC 5G04B 4AYCA 2M3HA 4AVXA 1CA4A 1CHCA 1CA9A 5D1LB 1FP0A 4CA1A 1G25A 4F52B 5FB1A 2KFTA 2KGGA 5LCWB 3VK6A 2YHNA 5D1KB 3O35A 3ZPVE 4GNGA 2LGGA 4QF2A 4O1VA 2IDAA 3SOWA 3HQIA 2EGPA 4GWMA 4FIPA 3L1ZB 5TDRA 1L0AA 2ZETC 2LN0A 2UZGA 2HYED 5H1TA 2KU3A 1Z60A 3U5NA 2QIZA 2MIQA 1F3VB 5TABA 5C11A 1DVPA 2VNFA 5LKXA 2VJFB 5DKAA 4I7CA 4M4EA 5B75A 2F6JA 2YSJA 5FB0A 2E6RA 5TDWA 3LQHA 1LB4A 2F1YA 2CKLB 5TRBA 4JJQA 2LDRA 3KV6A 4IC3A 4CCGX 1HYJA 4I7DA 1XWHA 2KWNA 1YZEA 2LGVA 2XB1A 1KZZA 4LLBA 5KH9A 3ZNIA 2F1XA 2QICA 2XXNA 1N87A 2NAAA 1YY6A 4I7BA 2LRIC 1VD4A 2Y1NA 2MD7B 2FUIA 1WEEA 1RF3A 1MM2A 1CZZA 3T6RA 2FSAA 2L80A 2M6MA 4PPEA 3V43A 4R8PK 5B76A 2MNZA 2KR4A 3HU6A 5D1MB 5H1VA 4BHWA 2ECIA 4MSXA 2EODA 2Y43A 1IYMA 2YHOA 2L75A 2RSDA 5FEYA 2F1WA 1V87A 1X4UA 2FOPA 3PHDA 5G0FA 2CR2A 2G43A 2LGLA 2YW8A 3EB5A 2YYRA 3MQSC 3N9OA 3C5KA 2FOOA 4Q6FA 2JMIA 3EB6A 1CZYA 3N9LA 2K1JA 3O7AA 1WGMA 2I50A 4NN2A 4V3KC 1QSCA 2VJFA 2MA5A 1Z6UA 2EA6A 2YUCA 4UI9B 4FJCA 5B77A 5KH7A 2ECGA 2YSMA 3MHSA 5B78A 2CKLA 3O34A 2VPGA 4R2YA 4AP4A 2VP7A 1E4UA 1T1HA 3M62A 2XEUA 3KNVA 4ZDTA 1WEOA 4A4CA 4LKAA 3O36A 1WENA 3LRQA 2ECVA 3C6WA 1D01A 3KQIA 4B86C 2Y1MA 3NG2A 1WFKA 3U5PA 3O37A 2DX8A 4GB0A 4PTBA 2D8SA 2KWJA 3PUQA 4GJHA 1K2FA 2LXHC 2MT5A 2ECTA 2F6NA 4WZ0A 5KH3A 5B79A 2G45A 1LB5A 3RTRB 2VPBA 3HTKC 3O70A 5AIUA 2FOJA 2OXQC 1WEWA 4UP0A 4IC2A 4A49A 1WILA 2KWOA 2L0BA 2RI7A 3GL6A 1FLKA 3LQJA 3ZVZB 2JMDA 2M85A 5C13A 4MVTA 3DPLR 5TBNA 4V3LC 5FERA 3KV5A 3L1XA 4A4BA 1LDJB 2VJEB 4L58A 1JM7B 3PURA 4R7EA 4QF3A 2K4DA 2JRJA 4S3OC 1MM3A 4AUQB 2H0DB 1WEPA 2KE1A 5G05B 2C2VS 4L7XA 4YADA 5I3LA 2KWKA 3IVBA 4LJNA 4YABA 2KGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6S A;  1VFY A;  1WEU A;  3GV4 A;  3HQM A;  1LB6 A;  1ZMS A;  3ZYQ A;  2AN6 A;  4W4U A;  4UP5 A;  2FUU A;  2KIZ A;  2LV9 A;  3ASL A;  4Z8M A;  1X4J A;  3M99 A;  5J3X A;  4GWN A;  4BBQ A;  3T7L A;  3N9M A;  5H1U A;  1BOR A;  2MA6 A;  4GND A;  2YU4 A;  2PNX A;  5H9M A;  2LQ6 A;  3HCT A;  1X4I A;  4TKP B;  4GNF A;  2L5U A;  3IVV A;  3ZVY A;  1WES A;  3QZV A;  4P5O B;  5EYA F;  2CT2 A;  2LXP C;  3SOX A;  1LDK C;  1Z2Q A;  2VPD A;  4YBT A;  4ZQL A;  1FBV A;  4WZ3 B;  3ZJB A;  4XI1 A;  4O64 A;  2YQL A;  2JMJ A;  3L11 A;  4ZUX U;  1HYI A;  5LKU A;  4YAT A;  5LKZ A;  2MUM A;  2MD8 C;  3HQH A;  2K17 A;  2ECJ A;  1D00 A;  3SOU A;  2M1R A;  1D0A A;  1WIM A;  2F1Z A;  2G6Q A;  5E1T A;  3MHH A;  2YRE A;  2MNY A;  3FL2 A;  2VJE A;  3IVQ A;  4C9Z A;  4YAX A;  4AYC B;  4KG9 A;  1JM7 A;  2KYU A;  5DIN A;  3O33 A;  3N9N A;  3SHB A;  3LQI A;  5B8D A;  2H0D A;  4YBM A;  2LGK A;  2HDP A;  1WEQ A;  4YC9 A;  4S3O B;  2GKW A;  4K8U A;  4YSI A;  1D0J A;  2YUR A;  2YT5 A;  3N9Q A;  2QJ0 A;  4N3W A;  3IHP A;  5JG6 A;  2BAY A;  1FLL A;  1U6G B;  4LK9 A;  2F42 A;  4FK5 A;  2VPE A;  4X3G A;  2K16 A;  4YBS A;  1JOC A;  2L43 A;  1VYX A;  4FO9 A;  1ZBD B;  3M63 A;  3HQL A;  4WA6 A;  3ZPV 1;  3U5O A;  3I2D A;  4N4F A;  3HCS A;  4B7Y C;  2A25 A;  2C2L A;  3N9P A;  2CSZ A;  2ECN A;  3RPG B;  5LKT A;  1RMD A;  4GHU A;  2PUY A;  4LAD B;  2KRE A;  3HCU A;  3HSV A;  4A0C D;  2YQM A;  4GNE A;  3U5M A;  5AIT A;  4WZ2 A;  3ZTG A;  1WEM A;  2CSY A;  1WEV A;  1WE9 A;  3DQV R;  2ECW A;  1F62 A;  3MQR A;  3RPG C;  5G04 B;  4AYC A;  2M3H A;  4AVX A;  1CA4 A;  1CHC A;  1CA9 A;  5D1L B;  1FP0 A;  4CA1 A;  1G25 A;  4F52 B;  5FB1 A;  2KFT A;  2KGG A;  5LCW B;  3VK6 A;  2YHN A;  5D1K B;  3O35 A;  3ZPV E;  4GNG A;  2LGG A;  4QF2 A;  4O1V A;  2IDA A;  3SOW A;  3HQI A;  2EGP A;  4GWM A;  4FIP A;  3L1Z B;  5TDR A;  1L0A A;  2ZET C;  2LN0 A;  2UZG A;  2HYE D;  5H1T A;  2KU3 A;  1Z60 A;  3U5N A;  2QIZ A;  2MIQ A;  1F3V B;  5TAB A;  5C11 A;  1DVP A;  2VNF A;  5LKX A;  2VJF B;  5DKA A;  4I7C A;  4M4E A;  5B75 A;  2F6J A;  2YSJ A;  5FB0 A;  2E6R A;  5TDW A;  3LQH A;  1LB4 A;  2F1Y A;  2CKL B;  5TRB A;  4JJQ A;  2LDR A;  3KV6 A;  4IC3 A;  4CCG X;  1HYJ A;  4I7D A;  1XWH A;  2KWN A;  1YZE A;  2LGV A;  2XB1 A;  1KZZ A;  4LLB A;  5KH9 A;  3ZNI A;  2F1X A;  2QIC A;  2XXN A;  1N87 A;  2NAA A;  1YY6 A;  4I7B A;  2LRI C;  1VD4 A;  2Y1N A;  2MD7 B;  2FUI A;  1WEE A;  1RF3 A;  1MM2 A;  1CZZ A;  3T6R A;  2FSA A;  2L80 A;  2M6M A;  4PPE A;  3V43 A;  4R8P K;  5B76 A;  2MNZ A;  2KR4 A;  3HU6 A;  5D1M B;  5H1V A;  4BHW A;  2ECI A;  4MSX A;  2EOD A;  2Y43 A;  1IYM A;  2YHO A;  2L75 A;  2RSD A;  5FEY A;  2F1W A;  1V87 A;  1X4U A;  2FOP A;  3PHD A;  5G0F A;  2CR2 A;  2G43 A;  2LGL A;  2YW8 A;  3EB5 A;  2YYR A;  3MQS C;  3N9O A;  3C5K A;  2FOO A;  4Q6F A;  2JMI A;  3EB6 A;  1CZY A;  3N9L A;  2K1J A;  3O7A A;  1WGM A;  2I50 A;  4NN2 A;  4V3K C;  1QSC A;  2VJF A;  2MA5 A;  1Z6U A;  2EA6 A;  2YUC A;  4UI9 B;  4FJC A;  5B77 A;  5KH7 A;  2ECG A;  2YSM A;  3MHS A;  5B78 A;  2CKL A;  3O34 A;  2VPG A;  4R2Y A;  4AP4 A;  2VP7 A;  1E4U A;  1T1H A;  3M62 A;  2XEU A;  3KNV A;  4ZDT A;  1WEO A;  4A4C A;  4LKA A;  3O36 A;  1WEN A;  3LRQ A;  2ECV A;  3C6W A;  1D01 A;  3KQI A;  4B86 C;  2Y1M A;  3NG2 A;  1WFK A;  3U5P A;  3O37 A;  2DX8 A;  4GB0 A;  4PTB A;  2D8S A;  2KWJ A;  3PUQ A;  4GJH A;  1K2F A;  2LXH C;  2MT5 A;  2ECT A;  2F6N A;  4WZ0 A;  5KH3 A;  5B79 A;  2G45 A;  1LB5 A;  3RTR B;  2VPB A;  3HTK C;  3O70 A;  5AIU A;  2FOJ A;  2OXQ C;  1WEW A;  4UP0 A;  4IC2 A;  4A49 A;  1WIL A;  2KWO A;  2L0B A;  2RI7 A;  3GL6 A;  1FLK A;  3LQJ A;  3ZVZ B;  2JMD A;  2M85 A;  5C13 A;  4MVT A;  3DPL R;  5TBN A;  4V3L C;  5FER A;  3KV5 A;  3L1X A;  4A4B A;  1LDJ B;  2VJE B;  4L58 A;  1JM7 B;  3PUR A;  4R7E A;  4QF3 A;  2K4D A;  2JRJ A;  4S3O C;  1MM3 A;  4AUQ B;  2H0D B;  1WEP A;  2KE1 A;  5G05 B;  2C2V S;  4L7X A;  4YAD A;  5I3L A;  2KWK A;  3IVB A;  4LJN A;  4YAB A;  2KGI A; 
#chains in the Genus database with same CATH topology
 3JUE A;  2E6S A;  1VFY A;  1WEU A;  3GV4 A;  3HQM A;  1LB6 A;  1ZMS A;  3ZYQ A;  2AN6 A;  4W4U A;  4UP5 A;  2KKY A;  2FUU A;  2KIZ A;  2LV9 A;  3ASL A;  4Z8M A;  1X4J A;  3M99 A;  5J3X A;  4GWN A;  4BBQ A;  3T7L A;  3LDY A;  3N9M A;  5H1U A;  1BOR A;  2MA6 A;  4GND A;  2IQJ A;  2YU4 A;  2PNX A;  5H9M A;  2LQ6 A;  3HCT A;  1X4I A;  2EXU A;  4TKP B;  4GNF A;  2L5U A;  3IVV A;  3ZVY A;  1WES A;  3QZV A;  2YVR A;  4P5O B;  5EYA F;  2CT2 A;  2LXP C;  3SOX A;  1LDK C;  1Z2Q A;  2VPD A;  4YBT A;  4ZQL A;  3LVR E;  1FBV A;  4WZ3 B;  3ZJB A;  4XI1 A;  4O64 A;  2YQL A;  2JMJ A;  3L11 A;  4ZUX U;  1HYI A;  3T9K A;  5LKU A;  2CON A;  4YAT A;  5LKZ A;  2MUM A;  2MD8 C;  3HQH A;  2K17 A;  2ECJ A;  1D00 A;  3SOU A;  2M1R A;  1D0A A;  1WIM A;  5SVI B;  2F1Z A;  2G6Q A;  5E1T A;  3MHH A;  2YRE A;  2MNY A;  3FL2 A;  2VJE A;  3IVQ A;  4C9Z A;  4YAX A;  4AYC B;  4KG9 A;  1JM7 A;  2KYU A;  3FEH A;  5DIN A;  3O33 A;  3Q1D A;  3N9N A;  3SHB A;  3LQI A;  5B8D A;  2H0D A;  4YBM A;  2LGK A;  2HDP A;  3LVQ E;  1WEQ A;  4YC9 A;  4S3O B;  4OGE A;  2GKW A;  3O47 A;  4K8U A;  4YSI A;  1D0J A;  2YUR A;  2YT5 A;  3N9Q A;  2QJ0 A;  4N3W A;  3IHP A;  5JG6 A;  2BAY A;  1FLL A;  1U6G B;  4LK9 A;  2F42 A;  3FM8 C;  5SVY A;  4FK5 A;  2VPE A;  4X3G A;  2RR4 A;  2K16 A;  4YBS A;  1JOC A;  2L43 A;  1VYX A;  4FO9 A;  1ZBD B;  3M63 A;  3M7K A;  3HQL A;  4WA6 A;  3ZPV 1;  3U5O A;  3I2D A;  4N4F A;  3HCS A;  4B7Y C;  2A25 A;  2C2L A;  3N9P A;  2CSZ A;  2ECN A;  3RPG B;  5LKT A;  1RMD A;  4GHU A;  2PUY A;  4LAD B;  2KRE A;  3HCU A;  3HSV A;  4A0C D;  2YQM A;  4GNE A;  3H7H A;  5SVX A;  3U5M A;  3LJU X;  5AIT A;  3FJU B;  4WZ2 A;  3ZTG A;  1WEM A;  5SVI A;  2CSY A;  1WEV A;  1WE9 A;  3DQV R;  2ECW A;  2XOZ A;  1F62 A;  3MQR A;  3FAO A;  4H9D A;  3RPG C;  5G04 B;  4AYC A;  2M3H A;  4AVX A;  1CA4 A;  1CHC A;  1CA9 A;  2P57 A;  5D1L B;  1FP0 A;  4CA1 A;  4QQ4 A;  1G25 A;  4F52 B;  5FB1 A;  2KFT A;  2XP0 A;  2KGG A;  5LCW B;  3VK6 A;  2L7P A;  2YHN A;  5D1K B;  3O35 A;  1DCQ A;  3ZPV E;  4GNG A;  2LGG A;  4QF2 A;  4O1V A;  2IDA A;  3SOW A;  3HQI A;  2EGP A;  4GWM A;  4FIP A;  4O62 A;  3L1Z B;  5TDR A;  1L0A A;  2ZET C;  2LN0 A;  2UZG A;  2HYE D;  5H1T A;  2KU3 A;  1Z60 A;  3U5N A;  3PLW A;  2QIZ A;  2MIQ A;  1F3V B;  5TAB A;  5C11 A;  1DVP A;  2VNF A;  5LKX A;  2VJF B;  5DKA A;  4I7C A;  4M4E A;  5B75 A;  2F6J A;  2YSJ A;  5FB0 A;  2E6R A;  5TDW A;  3LQH A;  1LB4 A;  2F1Y A;  2CKL B;  5TRB A;  4JJQ A;  2DSM A;  2LDR A;  3KDE C;  3KV6 A;  4IC3 A;  2FFW A;  4CCG X;  1HYJ A;  4I7D A;  1XWH A;  2KWN A;  1YZE A;  2LGV A;  2XB1 A;  1KZZ A;  4LLB A;  5KH9 A;  3ZNI A;  2F1X A;  2EGM A;  2QIC A;  2D8U A;  2XXN A;  1N87 A;  2NAA A;  1YY6 A;  4I7B A;  2LRI C;  1VD4 A;  2Y1N A;  2MD7 B;  2FUI A;  1WEE A;  1RF3 A;  1MM2 A;  1CZZ A;  3T6R A;  2FSA A;  1MBM A;  2L80 A;  2M6M A;  2KKX A;  4PPE A;  3V43 A;  4R8P K;  5B76 A;  2MNZ A;  2KR4 A;  3HU6 A;  5D1M B;  3SUB A;  5H1V A;  4BHW A;  2ECI A;  4MSX A;  2EOD A;  2Y43 A;  1IYM A;  2YHO A;  2L75 A;  2RSD A;  5FEY A;  2F1W A;  1V87 A;  1X4U A;  2FOP A;  3PHD A;  5G0F A;  4F1P A;  2CR2 A;  2G43 A;  2LGL A;  2YW8 A;  3EB5 A;  2YYR A;  3MQS C;  3N9O A;  3C5K A;  2FOO A;  4Q6F A;  2JMI A;  3EB6 A;  1CZY A;  3N9L A;  2K1J A;  3O7A A;  5K3Q A;  2LAU A;  1WGM A;  2I50 A;  4NN2 A;  2CSV A;  3DWD A;  4V3K C;  1QSC A;  2VJF A;  2MA5 A;  4OGC A;  1Z6U A;  2EA6 A;  2YUC A;  4UI9 B;  4FJC A;  5B77 A;  5KH7 A;  2ECG A;  2YSM A;  3MHS A;  5B78 A;  2CKL A;  3O34 A;  2VPG A;  4R2Y A;  4Z0O A;  4AP4 A;  2VP7 A;  1E4U A;  1T1H A;  3M62 A;  2XEU A;  3KNV A;  2FD4 A;  3MDB C;  4ZDT A;  1WEO A;  2JUN A;  4A4C A;  4LKA A;  3O36 A;  1WEN A;  3LRQ A;  2M13 A;  2ECV A;  3C6W A;  1D01 A;  3KQI A;  4B86 C;  2Y1M A;  3NG2 A;  1WFK A;  3U5P A;  3O37 A;  2DX8 A;  4GB0 A;  4PTB A;  2D8S A;  3DDT A;  2KWJ A;  3PUQ A;  4GJH A;  1K2F A;  2LXH C;  2MT5 A;  2ECT A;  2F6N A;  4WZ0 A;  2CRR A;  5KH3 A;  5B79 A;  2G45 A;  1LB5 A;  3RTR B;  2VPB A;  3HTK C;  3O70 A;  2XOY A;  5AIU A;  2FOJ A;  2OXQ C;  1WEW A;  4UP0 A;  4IC2 A;  4A49 A;  2OWA A;  2MKE A;  2E61 A;  1WIL A;  2KWO A;  2L0B A;  2RI7 A;  3GL6 A;  2B0O E;  1FLK A;  2JM3 A;  3LQJ A;  4Z0R A;  3ZVZ B;  2JMD A;  2M85 A;  5C13 A;  4MVT A;  3DPL R;  5TBN A;  2DJA A;  4V3L C;  5FER A;  3KV5 A;  2CRW A;  3L1X A;  4A4B A;  1LDJ B;  3E2D A;  2VJE B;  3FAN A;  4L58 A;  1JM7 B;  3PUR A;  4R7E A;  4QF3 A;  2K4D A;  2JRJ A;  4S3O C;  1MM3 A;  4AUQ B;  2H0D B;  1WEP A;  2KE1 A;  5G05 B;  2C2V S;  4L7X A;  4YAD A;  5I3L A;  2KWK A;  3IVB A;  2XOC A;  4LJN A;  4YAB A;  2KGI A; 
#chains in the Genus database with same CATH homology
 2E6S A;  1VFY A;  1WEU A;  3GV4 A;  3HQM A;  1LB6 A;  1ZMS A;  3ZYQ A;  2AN6 A;  4W4U A;  4UP5 A;  2FUU A;  2KIZ A;  2LV9 A;  3ASL A;  4Z8M A;  1X4J A;  3M99 A;  5J3X A;  4GWN A;  4BBQ A;  3T7L A;  3N9M A;  5H1U A;  1BOR A;  2MA6 A;  4GND A;  2YU4 A;  2PNX A;  5H9M A;  2LQ6 A;  3HCT A;  1X4I A;  4TKP B;  4GNF A;  2L5U A;  3IVV A;  3ZVY A;  1WES A;  3QZV A;  4P5O B;  5EYA F;  2CT2 A;  2LXP C;  3SOX A;  1LDK C;  1Z2Q A;  2VPD A;  4YBT A;  4ZQL A;  1FBV A;  4WZ3 B;  3ZJB A;  4XI1 A;  4O64 A;  2YQL A;  2JMJ A;  3L11 A;  4ZUX U;  1HYI A;  5LKU A;  4YAT A;  5LKZ A;  2MUM A;  2MD8 C;  3HQH A;  2K17 A;  2ECJ A;  1D00 A;  3SOU A;  2M1R A;  1D0A A;  1WIM A;  2F1Z A;  2G6Q A;  5E1T A;  3MHH A;  2YRE A;  2MNY A;  3FL2 A;  2VJE A;  3IVQ A;  4C9Z A;  4YAX A;  4AYC B;  4KG9 A;  1JM7 A;  2KYU A;  5DIN A;  3O33 A;  3N9N A;  3SHB A;  3LQI A;  5B8D A;  2H0D A;  4YBM A;  2LGK A;  2HDP A;  1WEQ A;  4YC9 A;  4S3O B;  2GKW A;  4K8U A;  4YSI A;  1D0J A;  2YUR A;  2YT5 A;  3N9Q A;  2QJ0 A;  4N3W A;  3IHP A;  5JG6 A;  2BAY A;  1FLL A;  1U6G B;  4LK9 A;  2F42 A;  4FK5 A;  2VPE A;  4X3G A;  2K16 A;  4YBS A;  1JOC A;  2L43 A;  1VYX A;  4FO9 A;  1ZBD B;  3M63 A;  3HQL A;  4WA6 A;  3ZPV 1;  3U5O A;  3I2D A;  4N4F A;  3HCS A;  4B7Y C;  2A25 A;  2C2L A;  3N9P A;  2CSZ A;  2ECN A;  3RPG B;  5LKT A;  1RMD A;  4GHU A;  2PUY A;  4LAD B;  2KRE A;  3HCU A;  3HSV A;  4A0C D;  2YQM A;  4GNE A;  3U5M A;  5AIT A;  4WZ2 A;  3ZTG A;  1WEM A;  2CSY A;  1WEV A;  1WE9 A;  3DQV R;  2ECW A;  1F62 A;  3MQR A;  3RPG C;  5G04 B;  4AYC A;  2M3H A;  4AVX A;  1CA4 A;  1CHC A;  1CA9 A;  5D1L B;  1FP0 A;  4CA1 A;  1G25 A;  4F52 B;  5FB1 A;  2KFT A;  2KGG A;  5LCW B;  3VK6 A;  2YHN A;  5D1K B;  3O35 A;  3ZPV E;  4GNG A;  2LGG A;  4QF2 A;  4O1V A;  2IDA A;  3SOW A;  3HQI A;  2EGP A;  4GWM A;  4FIP A;  3L1Z B;  5TDR A;  1L0A A;  2ZET C;  2LN0 A;  2UZG A;  2HYE D;  5H1T A;  2KU3 A;  1Z60 A;  3U5N A;  2QIZ A;  2MIQ A;  1F3V B;  5TAB A;  5C11 A;  1DVP A;  2VNF A;  5LKX A;  2VJF B;  5DKA A;  4I7C A;  4M4E A;  5B75 A;  2F6J A;  2YSJ A;  5FB0 A;  2E6R A;  5TDW A;  3LQH A;  1LB4 A;  2F1Y A;  2CKL B;  5TRB A;  4JJQ A;  2LDR A;  3KV6 A;  4IC3 A;  4CCG X;  1HYJ A;  4I7D A;  1XWH A;  2KWN A;  1YZE A;  2LGV A;  2XB1 A;  1KZZ A;  4LLB A;  5KH9 A;  3ZNI A;  2F1X A;  2QIC A;  2XXN A;  1N87 A;  2NAA A;  1YY6 A;  4I7B A;  2LRI C;  1VD4 A;  2Y1N A;  2MD7 B;  2FUI A;  1WEE A;  1RF3 A;  1MM2 A;  1CZZ A;  3T6R A;  2FSA A;  2L80 A;  2M6M A;  4PPE A;  3V43 A;  4R8P K;  5B76 A;  2MNZ A;  2KR4 A;  3HU6 A;  5D1M B;  5H1V A;  4BHW A;  2ECI A;  4MSX A;  2EOD A;  2Y43 A;  1IYM A;  2YHO A;  2L75 A;  2RSD A;  5FEY A;  2F1W A;  1V87 A;  1X4U A;  2FOP A;  3PHD A;  5G0F A;  2CR2 A;  2G43 A;  2LGL A;  2YW8 A;  3EB5 A;  2YYR A;  3MQS C;  3N9O A;  3C5K A;  2FOO A;  4Q6F A;  2JMI A;  3EB6 A;  1CZY A;  3N9L A;  2K1J A;  3O7A A;  1WGM A;  2I50 A;  4NN2 A;  4V3K C;  1QSC A;  2VJF A;  2MA5 A;  1Z6U A;  2EA6 A;  2YUC A;  4UI9 B;  4FJC A;  5B77 A;  5KH7 A;  2ECG A;  2YSM A;  3MHS A;  5B78 A;  2CKL A;  3O34 A;  2VPG A;  4R2Y A;  4AP4 A;  2VP7 A;  1E4U A;  1T1H A;  3M62 A;  2XEU A;  3KNV A;  4ZDT A;  1WEO A;  4A4C A;  4LKA A;  3O36 A;  1WEN A;  3LRQ A;  2ECV A;  3C6W A;  1D01 A;  3KQI A;  4B86 C;  2Y1M A;  3NG2 A;  1WFK A;  3U5P A;  3O37 A;  2DX8 A;  4GB0 A;  4PTB A;  2D8S A;  2KWJ A;  3PUQ A;  4GJH A;  1K2F A;  2LXH C;  2MT5 A;  2ECT A;  2F6N A;  4WZ0 A;  5KH3 A;  5B79 A;  2G45 A;  1LB5 A;  3RTR B;  2VPB A;  3HTK C;  3O70 A;  5AIU A;  2FOJ A;  2OXQ C;  1WEW A;  4UP0 A;  4IC2 A;  4A49 A;  1WIL A;  2KWO A;  2L0B A;  2RI7 A;  3GL6 A;  1FLK A;  3LQJ A;  3ZVZ B;  2JMD A;  2M85 A;  5C13 A;  4MVT A;  3DPL R;  5TBN A;  4V3L C;  5FER A;  3KV5 A;  3L1X A;  4A4B A;  1LDJ B;  2VJE B;  4L58 A;  1JM7 B;  3PUR A;  4R7E A;  4QF3 A;  2K4D A;  2JRJ A;  4S3O C;  1MM3 A;  4AUQ B;  2H0D B;  1WEP A;  2KE1 A;  5G05 B;  2C2V S;  4L7X A;  4YAD A;  5I3L A;  2KWK A;  3IVB A;  4LJN A;  4YAB A;  2KGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...