2AN6A

Protein-peptide complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
191
structure length
191
Chain Sequence
b'NSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin ligase SIAH1A
publication title Elucidation of the substrate binding site of Siah ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 36
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2an6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2an6A01
2ECNA 2L75A 2ECGA 2NAAA 5H1VA 4UI9B 5DINA 5C11A 3M63A 2RSDA 3N9LA 4UP5A 3GV4A 3HSVA 2K1JA 2VNFA 4GJHA 2VPBA 2ECJA 2LDRA 5FERA 1YZEA 3ZNIA 5LKTA 2L0BA 4WZ3B 4V3KC 1XWHA 4L58A 5AIUA 2YQMA 2MD7B 4PTBA 2ECIA 2LGKA 1LDKC 5KH3A 1LB5A 1JM7A 3FL2A 2HYED 1Z6UA 3ZVZB 5B76A 2MA6A 4B7YC 2F42A 5J3XA 2JMIA 2LRIC 1VD4A 2YUCA 5G04B 3KNVA 1JOCA 4AUQB 1FP0A 3O7AA 3IHPA 4TKPB 1CZYA 1D00A 1WIMA 2YURA 2KWKA 2YT5A 3RPGC 1MM2A 2K16A 4N3WA 4V3LC 2UZGA 1CHCA 2FUIA 2YHNA 1WENA 1JM7B 3ZVYA 2IDAA 2LGVA 3HTKC 2OXQC 1T1HA 3N9PA 4WA6A 5FB1A 4YBMA 3L1XA 2KGGA 3O70A 2LV9A 2KU3A 1HYIA 2EA6A 4A0CD 3U5MA 3C5KA 2F1ZA 4W4UA 1KZZA 2CKLA 1WESA 5E1TA 1D01A 1WEUA 3IVVA 3VK6A 4WZ2A 3LRQA 4X3GA 4CCGX 3N9QA 1BORA 3SOUA 2ECTA 5H1UA 2MIQA 4LKAA 4YC9A 4GWMA 3MHSA 3HCTA 1FLLA 2JMJA 1FLKA 1YY6A 2C2LA 3IVBA 2FUUA 5LKXA 4GWNA 4YSIA 2CKLB 5D1MB 5B78A 3LQHA 2Y1NA 4GB0A 2KYUA 2XXNA 2XB1A 3GL6A 3C6WA 3SOWA 2VJFA 2Y43A 1DVPA 1F62A 4YADA 2F6JA 1IYMA 2MT5A 4QF2A 3LQIA 5B79A 2BAYA 3SOXA 2VPEA 3RPGB 5C13A 3T6RA 2M6MA 5D1KB 2E6SA 2KE1A 1X4UA 4R7EA 4NN2A 3KQIA 3HQLA 4XI1A 5G05B 1VFYA 1Z60A 2MNYA 2YSMA 2K4DA 1QSCA 1D0AA 4GNDA 3ZYQA 1RMDA 2CSZA 3M62A 2VJFB 4LADB 2L43A 5TDRA 3PUQA 4GNGA 5B75A 3ZPVE 5H1TA 2YSJA 4Q6FA 2FOOA 3U5OA 4O1VA 2JRJA 3EB6A 5B77A 2FOJA 1X4IA 4R2YA 2LXHC 5H9MA 4M4EA 4FIPA 4YAXA 3U5PA 1WEMA 3DQVR 2VJEA 1LB6A 2MD8C 4B86C 2QJ0A 5I3LA 4ZDTA 2H0DA 2M1RA 5G0FA 4A49A 5LCWB 5TDWA 4FJCA 2ECWA 1WFKA 1MM3A 5TBNA 2DX8A 4LK9A 3T7LA 3HQHA 2G43A 4IC3A 3M99A 4F52B 2FOPA 2KREA 1V87A 4LLBA 2XEUA 2LN0A 4QF3A 5KH7A 2LQ6A 1WEVA 2D8SA 2VJEB 4I7DA 3V43A 3EB5A 4P5OB 2H0DB 2VPGA 2YREA 4N4FA 5D1LB 3LQJA 1WEOA 2MA5A 2E6RA 3O33A 3U5NA 3ZTGA 2KIZA 2M3HA 1ZMSA 5LKUA 3HU6A 3QZVA 3IVQA 2VP7A 1CA4A 3DPLR 2K17A 2L80A 1LDJB 4S3OC 1FBVA 3PHDA 4FK5A 4I7CA 4MVTA 5DKAA 2A25A 1X4JA 3N9OA 3MQRA 3O37A 2JMDA 2CSYA 4O64A 4AP4A 2YU4A 2F6NA 3O34A 1WEPA 5B8DA 1Z2QA 4JJQA 2EGPA 2YQLA 3HCUA 4L7XA 4BHWA 2HDPA 1LB4A 5FB0A 5AITA 2Y1MA 1N87A 2YYRA 2GKWA 2L5UA 2KR4A 4A4BA 4GNEA 1RF3A 1WEEA 4FO9A 1CA9A 1VYXA 4GHUA 2ZETC 3SHBA 2F1WA 4ZQLA 5FEYA 4CA1A 2RI7A 2QICA 4PPEA 2KWJA 2FSAA 2PUYA 2F1YA 3ASLA 4AYCA 4YABA 5LKZA 5EYAF 4KG9A 4UP0A 1HYJA 3HCSA 1WGMA 4YATA 2MUMA 3ZPV1 3O36A 3RTRB 4AVXA 4C9ZA 2ECVA 4Z8MA 3MQSC 2KFTA 4YBTA 2CT2A 3HQIA 1E4UA 3N9NA 3I2DA 3N9MA 2VPDA 3L1ZB 1F3VB 3PURA 1G25A 3NG2A 2M85A 1U6GB 4IC2A 4I7BA 4LJNA 3KV6A 2LGLA 2I50A 4AYCB 2YHOA 1K2FA 2KWOA 2LXPC 2KWNA 3MHHA 1L0AA 4K8UA 4S3OB 1D0JA 2EODA 1WEWA 1CZZA 5TRBA 3HQMA 4WZ0A 2F1XA 2QIZA 4GNFA 5JG6A 2PNXA 4BBQA 3KV5A 2LGGA 4MSXA 2CR2A 2G6QA 2MNZA 3O35A 4A4CA 2C2VS 2G45A 1WEQA 1WILA 4R8PK 2AN6A 3L11A 1ZBDB 3ZJBA 5KH9A 2KGIA 5TABA 4YBSA 4ZUXU 2YW8A 1WE9A
chains in the Genus database with same CATH superfamily
2ECNA 2L75A 2RR4A 2ECGA 2NAAA 5H1VA 4UI9B 5DINA 5C11A 3M63A 2RSDA 3N9LA 4UP5A 3GV4A 3HSVA 2K1JA 2VNFA 4GJHA 2VPBA 2ECJA 2LDRA 5FERA 2FD4A 1YZEA 3ZNIA 5LKTA 2L0BA 4WZ3B 4V3KC 1XWHA 4L58A 5AIUA 2YQMA 2MD7B 4PTBA 2ECIA 4QQ4A 2LGKA 1LDKC 5KH3A 1LB5A 5SVXA 1JM7A 3FL2A 2HYED 1Z6UA 3ZVZB 5B76A 2MA6A 4B7YC 2F42A 5J3XA 2JMIA 2LRIC 1VD4A 2YUCA 5G04B 3KNVA 1JOCA 4AUQB 2D8UA 1FP0A 3O7AA 3IHPA 4TKPB 1CZYA 1D00A 1WIMA 2YURA 2KWKA 3H7HA 2YT5A 3RPGC 3M7KA 1MM2A 2K16A 3Q1DA 2XOCA 4N3WA 3JUEA 4H9DA 4V3LC 2UZGA 1CHCA 3SUBA 2FUIA 2YHNA 1WENA 4O62A 1JM7B 3ZVYA 2IDAA 2LGVA 3HTKC 2OXQC 1T1HA 3N9PA 4WA6A 2JM3A 5FB1A 4YBMA 3L1XA 2KGGA 3O70A 2LV9A 2KU3A 1HYIA 2EA6A 3MDBC 4A0CD 5SVIA 3U5MA 3C5KA 2F1ZA 3PLWA 4W4UA 1KZZA 2CKLA 1WESA 5E1TA 1D01A 1WEUA 3LVRE 3IVVA 3VK6A 4WZ2A 3LRQA 2B0OE 4X3GA 4CCGX 3N9QA 1BORA 3SOUA 2ECTA 5H1UA 2CRRA 2MIQA 4LKAA 4YC9A 4GWMA 3FAOA 3MHSA 3HCTA 3O47A 1FLLA 2JMJA 5SVIB 1FLKA 1YY6A 2C2LA 3FJUB 3E2DA 3IVBA 2FUUA 5LKXA 4GWNA 4YSIA 2CKLB 2IQJA 5D1MB 3T9KA 5B78A 3LQHA 2Y1NA 4GB0A 2KYUA 4Z0RA 2XXNA 2XB1A 3GL6A 3C6WA 3SOWA 2VJFA 2Y43A 2JUNA 2P57A 1DVPA 1F62A 4YADA 2F6JA 5SVYA 1IYMA 2EGMA 3DDTA 2MT5A 4QF2A 3LQIA 5B79A 2BAYA 2M13A 3LDYA 3SOXA 2VPEA 3RPGB 5C13A 3T6RA 2M6MA 5D1KB 2E6SA 2KE1A 2MKEA 1X4UA 4R7EA 4NN2A 3KQIA 3HQLA 4XI1A 5G05B 1VFYA 2DSMA 1Z60A 2CONA 2MNYA 2YSMA 2KKXA 2K4DA 1QSCA 1D0AA 4GNDA 3ZYQA 1RMDA 2CSZA 3LVQE 3M62A 2VJFB 4LADB 5K3QA 2L43A 5TDRA 3PUQA 4GNGA 5B75A 3ZPVE 5H1TA 2YSJA 4Q6FA 2FOOA 3U5OA 4O1VA 2JRJA 3DWDA 3EB6A 5B77A 2FOJA 1X4IA 4R2YA 2LXHC 5H9MA 4M4EA 4FIPA 2FFWA 4YAXA 3U5PA 1WEMA 3DQVR 2VJEA 1LB6A 2MD8C 4B86C 2QJ0A 5I3LA 4ZDTA 2H0DA 2M1RA 2CSVA 5G0FA 4A49A 5LCWB 5TDWA 4FJCA 2ECWA 1WFKA 1MM3A 5TBNA 2DX8A 4LK9A 3T7LA 3HQHA 2G43A 4IC3A 3M99A 4F52B 2FOPA 2KREA 1V87A 4LLBA 2XEUA 2LN0A 4QF3A 5KH7A 2LQ6A 1WEVA 2D8SA 2E61A 2VJEB 4F1PA 4I7DA 3V43A 3EB5A 4P5OB 3FM8C 2H0DB 2VPGA 2YREA 4N4FA 5D1LB 4OGCA 3LQJA 1WEOA 4OGEA 2MA5A 2E6RA 3O33A 3U5NA 3ZTGA 2KIZA 2XOZA 2M3HA 1ZMSA 3KDEC 5LKUA 3HU6A 2EXUA 3QZVA 3IVQA 2VP7A 1CA4A 3DPLR 2K17A 2L80A 1LDJB 4S3OC 1FBVA 3PHDA 4FK5A 4I7CA 4MVTA 5DKAA 2A25A 1X4JA 3N9OA 3MQRA 3O37A 3FANA 2JMDA 2CSYA 4O64A 4AP4A 2YU4A 2F6NA 3O34A 1WEPA 5B8DA 1Z2QA 4JJQA 2EGPA 2YQLA 3HCUA 4L7XA 4BHWA 2HDPA 1LB4A 5FB0A 5AITA 2Y1MA 1N87A 2YYRA 2GKWA 2DJAA 2L5UA 2KR4A 4A4BA 4GNEA 1RF3A 1WEEA 4FO9A 1CA9A 1VYXA 4GHUA 2ZETC 3SHBA 2F1WA 1DCQA 4ZQLA 5FEYA 1MBMA 4CA1A 2RI7A 2QICA 2KKYA 2KWJA 4PPEA 2FSAA 2PUYA 2F1YA 3ASLA 2CRWA 4AYCA 4YABA 5LKZA 5EYAF 4KG9A 4UP0A 1HYJA 3HCSA 1WGMA 4YATA 2MUMA 3ZPV1 3O36A 3RTRB 4AVXA 4C9ZA 2ECVA 4Z0OA 4Z8MA 3MQSC 2KFTA 4YBTA 2CT2A 3HQIA 1E4UA 3N9NA 2OWAA 3I2DA 3N9MA 2VPDA 3L1ZB 1F3VB 3PURA 1G25A 3NG2A 2M85A 1U6GB 4IC2A 4I7BA 4LJNA 3KV6A 2LGLA 2I50A 4AYCB 2YHOA 1K2FA 3LJUX 2KWOA 2LXPC 2KWNA 2XP0A 3MHHA 1L0AA 2LAUA 4K8UA 4S3OB 1D0JA 2EODA 1WEWA 1CZZA 5TRBA 2YVRA 3HQMA 4WZ0A 2F1XA 2QIZA 4GNFA 5JG6A 2PNXA 4BBQA 3KV5A 2LGGA 4MSXA 2L7PA 2CR2A 2G6QA 2MNZA 3O35A 4A4CA 2C2VS 2G45A 1WEQA 1WILA 2XOYA 4R8PK 2AN6A 3L11A 1ZBDB 3FEHA 3ZJBA 5KH9A 2KGIA 5TABA 4YBSA 4ZUXU 2YW8A 1WE9A
chains in the Genus database with same CATH topology
2ECNA 2L75A 2ECGA 2NAAA 5H1VA 4UI9B 5DINA 5C11A 3M63A 2RSDA 3N9LA 4UP5A 3GV4A 3HSVA 2K1JA 2VNFA 4GJHA 2VPBA 2ECJA 2LDRA 5FERA 1YZEA 3ZNIA 5LKTA 2L0BA 4WZ3B 4V3KC 1XWHA 4L58A 5AIUA 2YQMA 2MD7B 4PTBA 2ECIA 2LGKA 1LDKC 5KH3A 1LB5A 1JM7A 3FL2A 2HYED 1Z6UA 3ZVZB 5B76A 2MA6A 4B7YC 2F42A 5J3XA 2JMIA 2LRIC 1VD4A 2YUCA 5G04B 3KNVA 1JOCA 4AUQB 1FP0A 3O7AA 3IHPA 4TKPB 1CZYA 1D00A 1WIMA 2YURA 2KWKA 2YT5A 3RPGC 1MM2A 2K16A 4N3WA 4V3LC 2UZGA 1CHCA 2FUIA 2YHNA 1WENA 1JM7B 3ZVYA 2IDAA 2LGVA 3HTKC 2OXQC 1T1HA 3N9PA 4WA6A 5FB1A 4YBMA 3L1XA 2KGGA 3O70A 2LV9A 2KU3A 1HYIA 2EA6A 4A0CD 3U5MA 3C5KA 2F1ZA 4W4UA 1KZZA 2CKLA 1WESA 5E1TA 1D01A 1WEUA 3IVVA 3VK6A 4WZ2A 3LRQA 4X3GA 4CCGX 3N9QA 1BORA 3SOUA 2ECTA 5H1UA 2MIQA 4LKAA 4YC9A 4GWMA 3MHSA 3HCTA 1FLLA 2JMJA 1FLKA 1YY6A 2C2LA 3IVBA 2FUUA 5LKXA 4GWNA 4YSIA 2CKLB 5D1MB 5B78A 3LQHA 2Y1NA 4GB0A 2KYUA 2XXNA 2XB1A 3GL6A 3C6WA 3SOWA 2VJFA 2Y43A 1DVPA 1F62A 4YADA 2F6JA 1IYMA 2MT5A 4QF2A 3LQIA 5B79A 2BAYA 3SOXA 2VPEA 3RPGB 5C13A 3T6RA 2M6MA 5D1KB 2E6SA 2KE1A 1X4UA 4R7EA 4NN2A 3KQIA 3HQLA 4XI1A 5G05B 1VFYA 1Z60A 2MNYA 2YSMA 2K4DA 1QSCA 1D0AA 4GNDA 3ZYQA 1RMDA 2CSZA 3M62A 2VJFB 4LADB 2L43A 5TDRA 3PUQA 4GNGA 5B75A 3ZPVE 5H1TA 2YSJA 4Q6FA 2FOOA 3U5OA 4O1VA 2JRJA 3EB6A 5B77A 2FOJA 1X4IA 4R2YA 2LXHC 5H9MA 4M4EA 4FIPA 4YAXA 3U5PA 1WEMA 3DQVR 2VJEA 1LB6A 2MD8C 4B86C 2QJ0A 5I3LA 4ZDTA 2H0DA 2M1RA 5G0FA 4A49A 5LCWB 5TDWA 4FJCA 2ECWA 1WFKA 1MM3A 5TBNA 2DX8A 4LK9A 3T7LA 3HQHA 2G43A 4IC3A 3M99A 4F52B 2FOPA 2KREA 1V87A 4LLBA 2XEUA 2LN0A 4QF3A 5KH7A 2LQ6A 1WEVA 2D8SA 2VJEB 4I7DA 3V43A 3EB5A 4P5OB 2H0DB 2VPGA 2YREA 4N4FA 5D1LB 3LQJA 1WEOA 2MA5A 2E6RA 3O33A 3U5NA 3ZTGA 2KIZA 2M3HA 1ZMSA 5LKUA 3HU6A 3QZVA 3IVQA 2VP7A 1CA4A 3DPLR 2K17A 2L80A 1LDJB 4S3OC 1FBVA 3PHDA 4FK5A 4I7CA 4MVTA 5DKAA 2A25A 1X4JA 3N9OA 3MQRA 3O37A 2JMDA 2CSYA 4O64A 4AP4A 2YU4A 2F6NA 3O34A 1WEPA 5B8DA 1Z2QA 4JJQA 2EGPA 2YQLA 3HCUA 4L7XA 4BHWA 2HDPA 1LB4A 5FB0A 5AITA 2Y1MA 1N87A 2YYRA 2GKWA 2L5UA 2KR4A 4A4BA 4GNEA 1RF3A 1WEEA 4FO9A 1CA9A 1VYXA 4GHUA 2ZETC 3SHBA 2F1WA 4ZQLA 5FEYA 4CA1A 2RI7A 2QICA 4PPEA 2KWJA 2FSAA 2PUYA 2F1YA 3ASLA 4AYCA 4YABA 5LKZA 5EYAF 4KG9A 4UP0A 1HYJA 3HCSA 1WGMA 4YATA 2MUMA 3ZPV1 3O36A 3RTRB 4AVXA 4C9ZA 2ECVA 4Z8MA 3MQSC 2KFTA 4YBTA 2CT2A 3HQIA 1E4UA 3N9NA 3I2DA 3N9MA 2VPDA 3L1ZB 1F3VB 3PURA 1G25A 3NG2A 2M85A 1U6GB 4IC2A 4I7BA 4LJNA 3KV6A 2LGLA 2I50A 4AYCB 2YHOA 1K2FA 2KWOA 2LXPC 2KWNA 3MHHA 1L0AA 4K8UA 4S3OB 1D0JA 2EODA 1WEWA 1CZZA 5TRBA 3HQMA 4WZ0A 2F1XA 2QIZA 4GNFA 5JG6A 2PNXA 4BBQA 3KV5A 2LGGA 4MSXA 2CR2A 2G6QA 2MNZA 3O35A 4A4CA 2C2VS 2G45A 1WEQA 1WILA 4R8PK 2AN6A 3L11A 1ZBDB 3ZJBA 5KH9A 2KGIA 5TABA 4YBSA 4ZUXU 2YW8A 1WE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECN A;  2L75 A;  2ECG A;  2NAA A;  5H1V A;  4UI9 B;  5DIN A;  5C11 A;  3M63 A;  2RSD A;  3N9L A;  4UP5 A;  3GV4 A;  3HSV A;  2K1J A;  2VNF A;  4GJH A;  2VPB A;  2ECJ A;  2LDR A;  5FER A;  1YZE A;  3ZNI A;  5LKT A;  2L0B A;  4WZ3 B;  4V3K C;  1XWH A;  4L58 A;  5AIU A;  2YQM A;  2MD7 B;  4PTB A;  2ECI A;  2LGK A;  1LDK C;  5KH3 A;  1LB5 A;  1JM7 A;  3FL2 A;  2HYE D;  1Z6U A;  3ZVZ B;  5B76 A;  2MA6 A;  4B7Y C;  2F42 A;  5J3X A;  2JMI A;  2LRI C;  1VD4 A;  2YUC A;  5G04 B;  3KNV A;  1JOC A;  4AUQ B;  1FP0 A;  3O7A A;  3IHP A;  4TKP B;  1CZY A;  1D00 A;  1WIM A;  2YUR A;  2KWK A;  2YT5 A;  3RPG C;  1MM2 A;  2K16 A;  4N3W A;  4V3L C;  2UZG A;  1CHC A;  2FUI A;  2YHN A;  1WEN A;  1JM7 B;  3ZVY A;  2IDA A;  2LGV A;  3HTK C;  2OXQ C;  1T1H A;  3N9P A;  4WA6 A;  5FB1 A;  4YBM A;  3L1X A;  2KGG A;  3O70 A;  2LV9 A;  2KU3 A;  1HYI A;  2EA6 A;  4A0C D;  3U5M A;  3C5K A;  2F1Z A;  4W4U A;  1KZZ A;  2CKL A;  1WES A;  5E1T A;  1D01 A;  1WEU A;  3IVV A;  3VK6 A;  4WZ2 A;  3LRQ A;  4X3G A;  4CCG X;  3N9Q A;  1BOR A;  3SOU A;  2ECT A;  5H1U A;  2MIQ A;  4LKA A;  4YC9 A;  4GWM A;  3MHS A;  3HCT A;  1FLL A;  2JMJ A;  1FLK A;  1YY6 A;  2C2L A;  3IVB A;  2FUU A;  5LKX A;  4GWN A;  4YSI A;  2CKL B;  5D1M B;  5B78 A;  3LQH A;  2Y1N A;  4GB0 A;  2KYU A;  2XXN A;  2XB1 A;  3GL6 A;  3C6W A;  3SOW A;  2VJF A;  2Y43 A;  1DVP A;  1F62 A;  4YAD A;  2F6J A;  1IYM A;  2MT5 A;  4QF2 A;  3LQI A;  5B79 A;  2BAY A;  3SOX A;  2VPE A;  3RPG B;  5C13 A;  3T6R A;  2M6M A;  5D1K B;  2E6S A;  2KE1 A;  1X4U A;  4R7E A;  4NN2 A;  3KQI A;  3HQL A;  4XI1 A;  5G05 B;  1VFY A;  1Z60 A;  2MNY A;  2YSM A;  2K4D A;  1QSC A;  1D0A A;  4GND A;  3ZYQ A;  1RMD A;  2CSZ A;  3M62 A;  2VJF B;  4LAD B;  2L43 A;  5TDR A;  3PUQ A;  4GNG A;  5B75 A;  3ZPV E;  5H1T A;  2YSJ A;  4Q6F A;  2FOO A;  3U5O A;  4O1V A;  2JRJ A;  3EB6 A;  5B77 A;  2FOJ A;  1X4I A;  4R2Y A;  2LXH C;  5H9M A;  4M4E A;  4FIP A;  4YAX A;  3U5P A;  1WEM A;  3DQV R;  2VJE A;  1LB6 A;  2MD8 C;  4B86 C;  2QJ0 A;  5I3L A;  4ZDT A;  2H0D A;  2M1R A;  5G0F A;  4A49 A;  5LCW B;  5TDW A;  4FJC A;  2ECW A;  1WFK A;  1MM3 A;  5TBN A;  2DX8 A;  4LK9 A;  3T7L A;  3HQH A;  2G43 A;  4IC3 A;  3M99 A;  4F52 B;  2FOP A;  2KRE A;  1V87 A;  4LLB A;  2XEU A;  2LN0 A;  4QF3 A;  5KH7 A;  2LQ6 A;  1WEV A;  2D8S A;  2VJE B;  4I7D A;  3V43 A;  3EB5 A;  4P5O B;  2H0D B;  2VPG A;  2YRE A;  4N4F A;  5D1L B;  3LQJ A;  1WEO A;  2MA5 A;  2E6R A;  3O33 A;  3U5N A;  3ZTG A;  2KIZ A;  2M3H A;  1ZMS A;  5LKU A;  3HU6 A;  3QZV A;  3IVQ A;  2VP7 A;  1CA4 A;  3DPL R;  2K17 A;  2L80 A;  1LDJ B;  4S3O C;  1FBV A;  3PHD A;  4FK5 A;  4I7C A;  4MVT A;  5DKA A;  2A25 A;  1X4J A;  3N9O A;  3MQR A;  3O37 A;  2JMD A;  2CSY A;  4O64 A;  4AP4 A;  2YU4 A;  2F6N A;  3O34 A;  1WEP A;  5B8D A;  1Z2Q A;  4JJQ A;  2EGP A;  2YQL A;  3HCU A;  4L7X A;  4BHW A;  2HDP A;  1LB4 A;  5FB0 A;  5AIT A;  2Y1M A;  1N87 A;  2YYR A;  2GKW A;  2L5U A;  2KR4 A;  4A4B A;  4GNE A;  1RF3 A;  1WEE A;  4FO9 A;  1CA9 A;  1VYX A;  4GHU A;  2ZET C;  3SHB A;  2F1W A;  4ZQL A;  5FEY A;  4CA1 A;  2RI7 A;  2QIC A;  4PPE A;  2KWJ A;  2FSA A;  2PUY A;  2F1Y A;  3ASL A;  4AYC A;  4YAB A;  5LKZ A;  5EYA F;  4KG9 A;  4UP0 A;  1HYJ A;  3HCS A;  1WGM A;  4YAT A;  2MUM A;  3ZPV 1;  3O36 A;  3RTR B;  4AVX A;  4C9Z A;  2ECV A;  4Z8M A;  3MQS C;  2KFT A;  4YBT A;  2CT2 A;  3HQI A;  1E4U A;  3N9N A;  3I2D A;  3N9M A;  2VPD A;  3L1Z B;  1F3V B;  3PUR A;  1G25 A;  3NG2 A;  2M85 A;  1U6G B;  4IC2 A;  4I7B A;  4LJN A;  3KV6 A;  2LGL A;  2I50 A;  4AYC B;  2YHO A;  1K2F A;  2KWO A;  2LXP C;  2KWN A;  3MHH A;  1L0A A;  4K8U A;  4S3O B;  1D0J A;  2EOD A;  1WEW A;  1CZZ A;  5TRB A;  3HQM A;  4WZ0 A;  2F1X A;  2QIZ A;  4GNF A;  5JG6 A;  2PNX A;  4BBQ A;  3KV5 A;  2LGG A;  4MSX A;  2CR2 A;  2G6Q A;  2MNZ A;  3O35 A;  4A4C A;  2C2V S;  2G45 A;  1WEQ A;  1WIL A;  4R8P K;  2AN6 A;  3L11 A;  1ZBD B;  3ZJB A;  5KH9 A;  2KGI A;  5TAB A;  4YBS A;  4ZUX U;  2YW8 A;  1WE9 A; 
#chains in the Genus database with same CATH topology
 2ECN A;  2L75 A;  2RR4 A;  2ECG A;  2NAA A;  5H1V A;  4UI9 B;  5DIN A;  5C11 A;  3M63 A;  2RSD A;  3N9L A;  4UP5 A;  3GV4 A;  3HSV A;  2K1J A;  2VNF A;  4GJH A;  2VPB A;  2ECJ A;  2LDR A;  5FER A;  2FD4 A;  1YZE A;  3ZNI A;  5LKT A;  2L0B A;  4WZ3 B;  4V3K C;  1XWH A;  4L58 A;  5AIU A;  2YQM A;  2MD7 B;  4PTB A;  2ECI A;  4QQ4 A;  2LGK A;  1LDK C;  5KH3 A;  1LB5 A;  5SVX A;  1JM7 A;  3FL2 A;  2HYE D;  1Z6U A;  3ZVZ B;  5B76 A;  2MA6 A;  4B7Y C;  2F42 A;  5J3X A;  2JMI A;  2LRI C;  1VD4 A;  2YUC A;  5G04 B;  3KNV A;  1JOC A;  4AUQ B;  2D8U A;  1FP0 A;  3O7A A;  3IHP A;  4TKP B;  1CZY A;  1D00 A;  1WIM A;  2YUR A;  2KWK A;  3H7H A;  2YT5 A;  3RPG C;  3M7K A;  1MM2 A;  2K16 A;  3Q1D A;  2XOC A;  4N3W A;  3JUE A;  4H9D A;  4V3L C;  2UZG A;  1CHC A;  3SUB A;  2FUI A;  2YHN A;  1WEN A;  4O62 A;  1JM7 B;  3ZVY A;  2IDA A;  2LGV A;  3HTK C;  2OXQ C;  1T1H A;  3N9P A;  4WA6 A;  2JM3 A;  5FB1 A;  4YBM A;  3L1X A;  2KGG A;  3O70 A;  2LV9 A;  2KU3 A;  1HYI A;  2EA6 A;  3MDB C;  4A0C D;  5SVI A;  3U5M A;  3C5K A;  2F1Z A;  3PLW A;  4W4U A;  1KZZ A;  2CKL A;  1WES A;  5E1T A;  1D01 A;  1WEU A;  3LVR E;  3IVV A;  3VK6 A;  4WZ2 A;  3LRQ A;  2B0O E;  4X3G A;  4CCG X;  3N9Q A;  1BOR A;  3SOU A;  2ECT A;  5H1U A;  2CRR A;  2MIQ A;  4LKA A;  4YC9 A;  4GWM A;  3FAO A;  3MHS A;  3HCT A;  3O47 A;  1FLL A;  2JMJ A;  5SVI B;  1FLK A;  1YY6 A;  2C2L A;  3FJU B;  3E2D A;  3IVB A;  2FUU A;  5LKX A;  4GWN A;  4YSI A;  2CKL B;  2IQJ A;  5D1M B;  3T9K A;  5B78 A;  3LQH A;  2Y1N A;  4GB0 A;  2KYU A;  4Z0R A;  2XXN A;  2XB1 A;  3GL6 A;  3C6W A;  3SOW A;  2VJF A;  2Y43 A;  2JUN A;  2P57 A;  1DVP A;  1F62 A;  4YAD A;  2F6J A;  5SVY A;  1IYM A;  2EGM A;  3DDT A;  2MT5 A;  4QF2 A;  3LQI A;  5B79 A;  2BAY A;  2M13 A;  3LDY A;  3SOX A;  2VPE A;  3RPG B;  5C13 A;  3T6R A;  2M6M A;  5D1K B;  2E6S A;  2KE1 A;  2MKE A;  1X4U A;  4R7E A;  4NN2 A;  3KQI A;  3HQL A;  4XI1 A;  5G05 B;  1VFY A;  2DSM A;  1Z60 A;  2CON A;  2MNY A;  2YSM A;  2KKX A;  2K4D A;  1QSC A;  1D0A A;  4GND A;  3ZYQ A;  1RMD A;  2CSZ A;  3LVQ E;  3M62 A;  2VJF B;  4LAD B;  5K3Q A;  2L43 A;  5TDR A;  3PUQ A;  4GNG A;  5B75 A;  3ZPV E;  5H1T A;  2YSJ A;  4Q6F A;  2FOO A;  3U5O A;  4O1V A;  2JRJ A;  3DWD A;  3EB6 A;  5B77 A;  2FOJ A;  1X4I A;  4R2Y A;  2LXH C;  5H9M A;  4M4E A;  4FIP A;  2FFW A;  4YAX A;  3U5P A;  1WEM A;  3DQV R;  2VJE A;  1LB6 A;  2MD8 C;  4B86 C;  2QJ0 A;  5I3L A;  4ZDT A;  2H0D A;  2M1R A;  2CSV A;  5G0F A;  4A49 A;  5LCW B;  5TDW A;  4FJC A;  2ECW A;  1WFK A;  1MM3 A;  5TBN A;  2DX8 A;  4LK9 A;  3T7L A;  3HQH A;  2G43 A;  4IC3 A;  3M99 A;  4F52 B;  2FOP A;  2KRE A;  1V87 A;  4LLB A;  2XEU A;  2LN0 A;  4QF3 A;  5KH7 A;  2LQ6 A;  1WEV A;  2D8S A;  2E61 A;  2VJE B;  4F1P A;  4I7D A;  3V43 A;  3EB5 A;  4P5O B;  3FM8 C;  2H0D B;  2VPG A;  2YRE A;  4N4F A;  5D1L B;  4OGC A;  3LQJ A;  1WEO A;  4OGE A;  2MA5 A;  2E6R A;  3O33 A;  3U5N A;  3ZTG A;  2KIZ A;  2XOZ A;  2M3H A;  1ZMS A;  3KDE C;  5LKU A;  3HU6 A;  2EXU A;  3QZV A;  3IVQ A;  2VP7 A;  1CA4 A;  3DPL R;  2K17 A;  2L80 A;  1LDJ B;  4S3O C;  1FBV A;  3PHD A;  4FK5 A;  4I7C A;  4MVT A;  5DKA A;  2A25 A;  1X4J A;  3N9O A;  3MQR A;  3O37 A;  3FAN A;  2JMD A;  2CSY A;  4O64 A;  4AP4 A;  2YU4 A;  2F6N A;  3O34 A;  1WEP A;  5B8D A;  1Z2Q A;  4JJQ A;  2EGP A;  2YQL A;  3HCU A;  4L7X A;  4BHW A;  2HDP A;  1LB4 A;  5FB0 A;  5AIT A;  2Y1M A;  1N87 A;  2YYR A;  2GKW A;  2DJA A;  2L5U A;  2KR4 A;  4A4B A;  4GNE A;  1RF3 A;  1WEE A;  4FO9 A;  1CA9 A;  1VYX A;  4GHU A;  2ZET C;  3SHB A;  2F1W A;  1DCQ A;  4ZQL A;  5FEY A;  1MBM A;  4CA1 A;  2RI7 A;  2QIC A;  2KKY A;  2KWJ A;  4PPE A;  2FSA A;  2PUY A;  2F1Y A;  3ASL A;  2CRW A;  4AYC A;  4YAB A;  5LKZ A;  5EYA F;  4KG9 A;  4UP0 A;  1HYJ A;  3HCS A;  1WGM A;  4YAT A;  2MUM A;  3ZPV 1;  3O36 A;  3RTR B;  4AVX A;  4C9Z A;  2ECV A;  4Z0O A;  4Z8M A;  3MQS C;  2KFT A;  4YBT A;  2CT2 A;  3HQI A;  1E4U A;  3N9N A;  2OWA A;  3I2D A;  3N9M A;  2VPD A;  3L1Z B;  1F3V B;  3PUR A;  1G25 A;  3NG2 A;  2M85 A;  1U6G B;  4IC2 A;  4I7B A;  4LJN A;  3KV6 A;  2LGL A;  2I50 A;  4AYC B;  2YHO A;  1K2F A;  3LJU X;  2KWO A;  2LXP C;  2KWN A;  2XP0 A;  3MHH A;  1L0A A;  2LAU A;  4K8U A;  4S3O B;  1D0J A;  2EOD A;  1WEW A;  1CZZ A;  5TRB A;  2YVR A;  3HQM A;  4WZ0 A;  2F1X A;  2QIZ A;  4GNF A;  5JG6 A;  2PNX A;  4BBQ A;  3KV5 A;  2LGG A;  4MSX A;  2L7P A;  2CR2 A;  2G6Q A;  2MNZ A;  3O35 A;  4A4C A;  2C2V S;  2G45 A;  1WEQ A;  1WIL A;  2XOY A;  4R8P K;  2AN6 A;  3L11 A;  1ZBD B;  3FEH A;  3ZJB A;  5KH9 A;  2KGI A;  5TAB A;  4YBS A;  4ZUX U;  2YW8 A;  1WE9 A; 
#chains in the Genus database with same CATH homology
 2ECN A;  2L75 A;  2ECG A;  2NAA A;  5H1V A;  4UI9 B;  5DIN A;  5C11 A;  3M63 A;  2RSD A;  3N9L A;  4UP5 A;  3GV4 A;  3HSV A;  2K1J A;  2VNF A;  4GJH A;  2VPB A;  2ECJ A;  2LDR A;  5FER A;  1YZE A;  3ZNI A;  5LKT A;  2L0B A;  4WZ3 B;  4V3K C;  1XWH A;  4L58 A;  5AIU A;  2YQM A;  2MD7 B;  4PTB A;  2ECI A;  2LGK A;  1LDK C;  5KH3 A;  1LB5 A;  1JM7 A;  3FL2 A;  2HYE D;  1Z6U A;  3ZVZ B;  5B76 A;  2MA6 A;  4B7Y C;  2F42 A;  5J3X A;  2JMI A;  2LRI C;  1VD4 A;  2YUC A;  5G04 B;  3KNV A;  1JOC A;  4AUQ B;  1FP0 A;  3O7A A;  3IHP A;  4TKP B;  1CZY A;  1D00 A;  1WIM A;  2YUR A;  2KWK A;  2YT5 A;  3RPG C;  1MM2 A;  2K16 A;  4N3W A;  4V3L C;  2UZG A;  1CHC A;  2FUI A;  2YHN A;  1WEN A;  1JM7 B;  3ZVY A;  2IDA A;  2LGV A;  3HTK C;  2OXQ C;  1T1H A;  3N9P A;  4WA6 A;  5FB1 A;  4YBM A;  3L1X A;  2KGG A;  3O70 A;  2LV9 A;  2KU3 A;  1HYI A;  2EA6 A;  4A0C D;  3U5M A;  3C5K A;  2F1Z A;  4W4U A;  1KZZ A;  2CKL A;  1WES A;  5E1T A;  1D01 A;  1WEU A;  3IVV A;  3VK6 A;  4WZ2 A;  3LRQ A;  4X3G A;  4CCG X;  3N9Q A;  1BOR A;  3SOU A;  2ECT A;  5H1U A;  2MIQ A;  4LKA A;  4YC9 A;  4GWM A;  3MHS A;  3HCT A;  1FLL A;  2JMJ A;  1FLK A;  1YY6 A;  2C2L A;  3IVB A;  2FUU A;  5LKX A;  4GWN A;  4YSI A;  2CKL B;  5D1M B;  5B78 A;  3LQH A;  2Y1N A;  4GB0 A;  2KYU A;  2XXN A;  2XB1 A;  3GL6 A;  3C6W A;  3SOW A;  2VJF A;  2Y43 A;  1DVP A;  1F62 A;  4YAD A;  2F6J A;  1IYM A;  2MT5 A;  4QF2 A;  3LQI A;  5B79 A;  2BAY A;  3SOX A;  2VPE A;  3RPG B;  5C13 A;  3T6R A;  2M6M A;  5D1K B;  2E6S A;  2KE1 A;  1X4U A;  4R7E A;  4NN2 A;  3KQI A;  3HQL A;  4XI1 A;  5G05 B;  1VFY A;  1Z60 A;  2MNY A;  2YSM A;  2K4D A;  1QSC A;  1D0A A;  4GND A;  3ZYQ A;  1RMD A;  2CSZ A;  3M62 A;  2VJF B;  4LAD B;  2L43 A;  5TDR A;  3PUQ A;  4GNG A;  5B75 A;  3ZPV E;  5H1T A;  2YSJ A;  4Q6F A;  2FOO A;  3U5O A;  4O1V A;  2JRJ A;  3EB6 A;  5B77 A;  2FOJ A;  1X4I A;  4R2Y A;  2LXH C;  5H9M A;  4M4E A;  4FIP A;  4YAX A;  3U5P A;  1WEM A;  3DQV R;  2VJE A;  1LB6 A;  2MD8 C;  4B86 C;  2QJ0 A;  5I3L A;  4ZDT A;  2H0D A;  2M1R A;  5G0F A;  4A49 A;  5LCW B;  5TDW A;  4FJC A;  2ECW A;  1WFK A;  1MM3 A;  5TBN A;  2DX8 A;  4LK9 A;  3T7L A;  3HQH A;  2G43 A;  4IC3 A;  3M99 A;  4F52 B;  2FOP A;  2KRE A;  1V87 A;  4LLB A;  2XEU A;  2LN0 A;  4QF3 A;  5KH7 A;  2LQ6 A;  1WEV A;  2D8S A;  2VJE B;  4I7D A;  3V43 A;  3EB5 A;  4P5O B;  2H0D B;  2VPG A;  2YRE A;  4N4F A;  5D1L B;  3LQJ A;  1WEO A;  2MA5 A;  2E6R A;  3O33 A;  3U5N A;  3ZTG A;  2KIZ A;  2M3H A;  1ZMS A;  5LKU A;  3HU6 A;  3QZV A;  3IVQ A;  2VP7 A;  1CA4 A;  3DPL R;  2K17 A;  2L80 A;  1LDJ B;  4S3O C;  1FBV A;  3PHD A;  4FK5 A;  4I7C A;  4MVT A;  5DKA A;  2A25 A;  1X4J A;  3N9O A;  3MQR A;  3O37 A;  2JMD A;  2CSY A;  4O64 A;  4AP4 A;  2YU4 A;  2F6N A;  3O34 A;  1WEP A;  5B8D A;  1Z2Q A;  4JJQ A;  2EGP A;  2YQL A;  3HCU A;  4L7X A;  4BHW A;  2HDP A;  1LB4 A;  5FB0 A;  5AIT A;  2Y1M A;  1N87 A;  2YYR A;  2GKW A;  2L5U A;  2KR4 A;  4A4B A;  4GNE A;  1RF3 A;  1WEE A;  4FO9 A;  1CA9 A;  1VYX A;  4GHU A;  2ZET C;  3SHB A;  2F1W A;  4ZQL A;  5FEY A;  4CA1 A;  2RI7 A;  2QIC A;  4PPE A;  2KWJ A;  2FSA A;  2PUY A;  2F1Y A;  3ASL A;  4AYC A;  4YAB A;  5LKZ A;  5EYA F;  4KG9 A;  4UP0 A;  1HYJ A;  3HCS A;  1WGM A;  4YAT A;  2MUM A;  3ZPV 1;  3O36 A;  3RTR B;  4AVX A;  4C9Z A;  2ECV A;  4Z8M A;  3MQS C;  2KFT A;  4YBT A;  2CT2 A;  3HQI A;  1E4U A;  3N9N A;  3I2D A;  3N9M A;  2VPD A;  3L1Z B;  1F3V B;  3PUR A;  1G25 A;  3NG2 A;  2M85 A;  1U6G B;  4IC2 A;  4I7B A;  4LJN A;  3KV6 A;  2LGL A;  2I50 A;  4AYC B;  2YHO A;  1K2F A;  2KWO A;  2LXP C;  2KWN A;  3MHH A;  1L0A A;  4K8U A;  4S3O B;  1D0J A;  2EOD A;  1WEW A;  1CZZ A;  5TRB A;  3HQM A;  4WZ0 A;  2F1X A;  2QIZ A;  4GNF A;  5JG6 A;  2PNX A;  4BBQ A;  3KV5 A;  2LGG A;  4MSX A;  2CR2 A;  2G6Q A;  2MNZ A;  3O35 A;  4A4C A;  2C2V S;  2G45 A;  1WEQ A;  1WIL A;  4R8P K;  2AN6 A;  3L11 A;  1ZBD B;  3ZJB A;  5KH9 A;  2KGI A;  5TAB A;  4YBS A;  4ZUX U;  2YW8 A;  1WE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...