4I7CA

Siah1 mutant bound to synthetic peptide (ace)klrpv(23p)mvrpwvr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
188
Chain Sequence
b'ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSICTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 45
structure length 188
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7cA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7cA01
4JJQA 2KE1A 2C2VS 2KGGA 2H0DB 3GV4A 1CZYA 3DPLR 1Z2QA 3VK6A 2VPEA 4FO9A 5B76A 4Q6FA 2UZGA 2KR4A 4W4UA 4ZDTA 4S3OC 1D01A 1WGMA 1JM7A 1FLLA 3IHPA 4PTBA 2K4DA 3N9LA 5EYAF 3V43A 2XB1A 5TRBA 5KH3A 2FOOA 5TABA 3M99A 1D00A 2VJFA 3ZTGA 3HQHA 2QIZA 2YYRA 4A0CD 4A4CA 1WIMA 2MA6A 5H1VA 2VPBA 5D1KB 2F1WA 2YT5A 5B75A 4AVXA 4KG9A 2XXNA 2G45A 3C6WA 1FP0A 5B79A 1LDJB 3NG2A 1WEOA 5G0FA 1HYIA 3PHDA 4YSIA 5TDWA 4CA1A 2F1XA 4BBQA 3IVVA 2JMJA 2VP7A 4UP0A 1WILA 1HYJA 2DX8A 4GNGA 4AYCA 2YQLA 3L1ZB 3SOXA 3GL6A 2L43A 4A4BA 3U5PA 4S3OB 3HCUA 5E1TA 2LRIC 5LKZA 3U5NA 3HCSA 1BORA 3U5MA 3HQMA 3N9PA 2M1RA 2LDRA 2YUCA 2VNFA 2ECJA 2OXQC 1X4IA 3HSVA 2LV9A 2LN0A 3LQIA 5C11A 1WENA 2MUMA 4IC3A 1JOCA 2LGKA 2RSDA 4UI9B 2Y1MA 3ZVYA 2KWKA 1YY6A 2L75A 2KWNA 3O37A 3HTKC 1U6GB 2LGGA 4A49A 1WEVA 3RPGB 1G25A 2MT5A 2FOJA 3U5OA 2H0DA 1LB6A 5TBNA 1WE9A 2MA5A 4GJHA 2L5UA 4IC2A 2MD8C 1QSCA 4C9ZA 2VPGA 4LADB 2XEUA 1LB5A 5G05B 5AITA 1LDKC 1CZZA 3I2DA 2MD7B 5H1UA 4YADA 2FUUA 2CT2A 4K8UA 3IVQA 3MQSC 2E6SA 3HCTA 2F42A 2MIQA 2YQMA 4GB0A 4ZQLA 3MHHA 4L58A 3ZVZB 4FIPA 4O64A 2NAAA 2KIZA 3SOWA 4YATA 2ECGA 2QJ0A 3O70A 1WEMA 4FJCA 3HU6A 4P5OB 2CSYA 1MM3A 4TKPB 4LJNA 4AUQB 2YSMA 3SOUA 3O33A 5B77A 4V3KC 3LQJA 5J3XA 2MNZA 2M85A 2EODA 4GNFA 2KGIA 3KV6A 2CSZA 4WZ2A 1WEUA 4WZ3B 2LGLA 4I7BA 2YHNA 3N9NA 4WA6A 4LLBA 1E4UA 2LXHC 1D0AA 3LQHA 2KFTA 3O35A 5D1MB 2VJEA 4UP5A 1K2FA 5D1LB 2AN6A 1F3VB 5C13A 2K17A 2GKWA 4R7EA 3SHBA 4AP4A 4M4EA 2BAYA 5FEYA 1F62A 1MM2A 4GWNA 2Y43A 2JMDA 3HQLA 3MQRA 3ZPV1 2LGVA 2D8SA 2K1JA 2A25A 3O36A 2MNYA 2CKLA 3ZJBA 3ZNIA 4F52B 2EGPA 3FL2A 3EB6A 4B7YC 1VYXA 4X3GA 2KU3A 4V3LC 2KREA 2RI7A 2ECTA 2ECVA 1ZBDB 2KWOA 1ZMSA 1CHCA 1X4UA 5FERA 4NN2A 1YZEA 1CA9A 3DQVR 5AIUA 4GNDA 3C5KA 5B78A 5KH7A 4YAXA 2YW8A 1FLKA 2I50A 4R2YA 3T7LA 2FUIA 2G6QA 2ECWA 5KH9A 2KYUA 3RTRB 4LK9A 4GWMA 2PUYA 4YC9A 2C2LA 3O34A 2F6NA 4FK5A 2VPDA 3M62A 2E6RA 2YHOA 1WEPA 1XWHA 4YBMA 2YSJA 1IYMA 2IDAA 4XI1A 3QZVA 5H9MA 1T1HA 3PUQA 2F6JA 2JRJA 1CA4A 2ECNA 4O1VA 2G43A 2M3HA 4I7CA 5H1TA 1JM7B 2YURA 2EA6A 5FB1A 2L80A 3ZYQA 4ZUXU 3M63A 2F1ZA 3HQIA 3L11A 2FSAA 1V87A 3KQIA 3RPGC 2JMIA 2VJFB 1X4JA 4MVTA 4N4FA 3IVBA 4BHWA 5LKUA 5I3LA 4N3WA 2LXPC 3KV5A 2F1YA 5FB0A 3PURA 5G04B 1VD4A 2KWJA 2QICA 1Z60A 1VFYA 4CCGX 4YBTA 2FOPA 5TDRA 5LKTA 1WEEA 1WEQA 1Z6UA 5DKAA 2K16A 4QF2A 3KNVA 3N9OA 3N9QA 2CR2A 4WZ0A 2HDPA 3MHSA 4QF3A 2VJEB 4YABA 4AYCB 1N87A 2ZETC 3LRQA 4YBSA 2PNXA 1WESA 4I7DA 3O7AA 1RMDA 2HYED 5B8DA 2YU4A 4GHUA 5DINA 4B86C 5LCWB 2ECIA 2M6MA 1KZZA 3T6RA 1L0AA 4Z8MA 1WEWA 4R8PK 3ZPVE 5LKXA 2YREA 3ASLA 4L7XA 1D0JA 4PPEA 1DVPA 1RF3A 3N9MA 4LKAA 2CKLB 1LB4A 2L0BA 2LQ6A 1WFKA 4MSXA 4GNEA 3EB5A 1FBVA 2Y1NA 5JG6A 3L1XA
chains in the Genus database with same CATH superfamily
4JJQA 2KE1A 2C2VS 2KGGA 3FEHA 2H0DB 3GV4A 1CZYA 3DPLR 1Z2QA 3VK6A 2VPEA 4FO9A 5B76A 4Q6FA 2UZGA 3SUBA 2KR4A 4W4UA 4ZDTA 4S3OC 1D01A 1WGMA 1JM7A 2EGMA 1FLLA 3IHPA 4PTBA 2K4DA 3N9LA 5EYAF 3V43A 2XB1A 5TRBA 5KH3A 2B0OE 2FOOA 5TABA 3M99A 1D00A 2VJFA 3ZTGA 3HQHA 2QIZA 2YYRA 4A0CD 4A4CA 1WIMA 2MA6A 5H1VA 2CRRA 2VPBA 2D8UA 5D1KB 2F1WA 2YT5A 5B75A 4AVXA 4KG9A 2XXNA 2G45A 3C6WA 1FP0A 5B79A 1LDJB 3NG2A 1WEOA 5G0FA 1HYIA 3PHDA 4YSIA 5TDWA 4CA1A 2F1XA 4BBQA 3IVVA 2JMJA 2VP7A 4UP0A 1WILA 1HYJA 5SVIB 2DX8A 4GNGA 4AYCA 2YQLA 3L1ZB 3SOXA 3GL6A 2P57A 2L43A 4A4BA 3U5PA 4S3OB 3HCUA 5E1TA 2LRIC 5LKZA 3U5NA 3HCSA 1BORA 3U5MA 3HQMA 3N9PA 2M1RA 2LDRA 2YUCA 2VNFA 4OGEA 2ECJA 2OXQC 1X4IA 3HSVA 2RR4A 2LV9A 2LN0A 3LQIA 5C11A 1WENA 2MUMA 4IC3A 2DJAA 1JOCA 2LGKA 2RSDA 3LJUX 4UI9B 2Y1MA 3ZVYA 2KWKA 1YY6A 2L75A 2KWNA 3O37A 3HTKC 5K3QA 1U6GB 3LVRE 2LGGA 4A49A 1WEVA 3RPGB 1G25A 2KKYA 2MT5A 2FOJA 1DCQA 3U5OA 3LDYA 2H0DA 1LB6A 5TBNA 1WE9A 2MA5A 4GJHA 2L5UA 4IC2A 2MD8C 1QSCA 4C9ZA 2VPGA 4LADB 2XEUA 1LB5A 5G05B 5AITA 2M13A 1LDKC 1CZZA 3I2DA 2MD7B 5H1UA 3FM8C 4YADA 2FUUA 2CT2A 4K8UA 3IVQA 3MQSC 2E6SA 3HCTA 2F42A 2MIQA 2YQMA 4GB0A 4ZQLA 3MHHA 4L58A 3ZVZB 4FIPA 4O64A 2NAAA 2KIZA 3SOWA 4YATA 2ECGA 2QJ0A 3O70A 1WEMA 4FJCA 3HU6A 4P5OB 2CSYA 2LAUA 1MM3A 3Q1DA 4TKPB 4LJNA 4AUQB 2YSMA 3SOUA 3O33A 5B77A 4V3KC 3LQJA 5J3XA 2MNZA 2M85A 2EODA 4GNFA 2KGIA 3KV6A 2OWAA 2CSZA 4WZ2A 1WEUA 2KKXA 2LGLA 4I7BA 2EXUA 2YHNA 3N9NA 4WA6A 4WZ3B 4LLBA 1E4UA 2LXHC 1D0AA 3LQHA 2KFTA 3O35A 5D1MB 2VJEA 1MBMA 4UP5A 1K2FA 5D1LB 2AN6A 1F3VB 5C13A 2K17A 2GKWA 4R7EA 3FANA 3SHBA 2XOZA 4AP4A 4M4EA 2BAYA 5FEYA 1F62A 1MM2A 3T9KA 4GWNA 2Y43A 2JMDA 3HQLA 3MQRA 3ZPV1 2LGVA 2D8SA 3FJUB 2K1JA 3FAOA 2A25A 3O36A 2MNYA 2CKLA 3ZJBA 3ZNIA 4F52B 2EGPA 3FL2A 2FFWA 3EB6A 4B7YC 1VYXA 3PLWA 4X3GA 2KU3A 4V3LC 2KREA 2RI7A 2ECTA 2ECVA 1ZBDB 2KWOA 2YVRA 1ZMSA 1CHCA 1X4UA 5FERA 4NN2A 3DDTA 4Z0OA 1YZEA 1CA9A 3DQVR 5AIUA 4GNDA 3C5KA 5SVXA 5B78A 5KH7A 4YAXA 2YW8A 1FLKA 2I50A 4R2YA 3T7LA 2FUIA 2G6QA 2ECWA 5KH9A 2CSVA 3DWDA 2KYUA 3RTRB 4LK9A 4GWMA 2PUYA 4OGCA 4YC9A 2C2LA 3O34A 2F6NA 4FK5A 2VPDA 3M62A 2E6RA 2YHOA 1WEPA 1XWHA 4YBMA 2YSJA 1IYMA 2IDAA 4XI1A 3QZVA 5H9MA 2FD4A 3O47A 1T1HA 3PUQA 2F6JA 2JRJA 1CA4A 2ECNA 4O1VA 2G43A 2M3HA 4I7CA 4Z0RA 5H1TA 2E61A 1JM7B 2YURA 2EA6A 5FB1A 2L80A 3ZYQA 4ZUXU 3M63A 2F1ZA 5SVIA 3HQIA 2CRWA 3L11A 2FSAA 2IQJA 1V87A 3KQIA 3RPGC 2JMIA 2VJFB 1X4JA 4MVTA 3M7KA 3H7HA 4N4FA 3IVBA 4BHWA 5LKUA 5I3LA 4N3WA 2LXPC 3KV5A 2F1YA 5FB0A 5SVYA 3PURA 2XOYA 5G04B 1VD4A 2KWJA 2QICA 1Z60A 1VFYA 4CCGX 2XP0A 4YBTA 3E2DA 4QQ4A 2FOPA 5TDRA 3JUEA 5LKTA 1WEEA 1WEQA 1Z6UA 2L7PA 5DKAA 4F1PA 2XOCA 2K16A 4QF2A 3KNVA 3N9OA 3LVQE 3N9QA 2CR2A 4WZ0A 2HDPA 3MHSA 4QF3A 2CONA 2VJEB 4YABA 4AYCB 1N87A 2JUNA 2JM3A 2ZETC 3LRQA 2PNXA 3MDBC 4YBSA 1WESA 4I7DA 3O7AA 1RMDA 2HYED 5B8DA 2YU4A 4GHUA 5DINA 4B86C 5LCWB 2ECIA 2DSMA 2M6MA 1KZZA 3T6RA 1L0AA 4Z8MA 1WEWA 4R8PK 3ZPVE 5LKXA 2YREA 3ASLA 4L7XA 1D0JA 1DVPA 4O62A 4PPEA 2MKEA 1RF3A 3N9MA 4LKAA 3KDEC 2CKLB 1LB4A 4H9DA 2L0BA 2LQ6A 1WFKA 4MSXA 4GNEA 3EB5A 1FBVA 2Y1NA 5JG6A 3L1XA
chains in the Genus database with same CATH topology
4JJQA 2KE1A 2C2VS 2KGGA 2H0DB 3GV4A 1CZYA 3DPLR 1Z2QA 3VK6A 2VPEA 4FO9A 5B76A 4Q6FA 2UZGA 2KR4A 4W4UA 4ZDTA 4S3OC 1D01A 1WGMA 1JM7A 1FLLA 3IHPA 4PTBA 2K4DA 3N9LA 5EYAF 3V43A 2XB1A 5TRBA 5KH3A 2FOOA 5TABA 3M99A 1D00A 2VJFA 3ZTGA 3HQHA 2QIZA 2YYRA 4A0CD 4A4CA 1WIMA 2MA6A 5H1VA 2VPBA 5D1KB 2F1WA 2YT5A 5B75A 4AVXA 4KG9A 2XXNA 2G45A 3C6WA 1FP0A 5B79A 1LDJB 3NG2A 1WEOA 5G0FA 1HYIA 3PHDA 4YSIA 5TDWA 4CA1A 2F1XA 4BBQA 3IVVA 2JMJA 2VP7A 4UP0A 1WILA 1HYJA 2DX8A 4GNGA 4AYCA 2YQLA 3L1ZB 3SOXA 3GL6A 2L43A 4A4BA 3U5PA 4S3OB 3HCUA 5E1TA 2LRIC 5LKZA 3U5NA 3HCSA 1BORA 3U5MA 3HQMA 3N9PA 2M1RA 2LDRA 2YUCA 2VNFA 2ECJA 2OXQC 1X4IA 3HSVA 2LV9A 2LN0A 3LQIA 5C11A 1WENA 2MUMA 4IC3A 1JOCA 2LGKA 2RSDA 4UI9B 2Y1MA 3ZVYA 2KWKA 1YY6A 2L75A 2KWNA 3O37A 3HTKC 1U6GB 2LGGA 4A49A 1WEVA 3RPGB 1G25A 2MT5A 2FOJA 3U5OA 2H0DA 1LB6A 5TBNA 1WE9A 2MA5A 4GJHA 2L5UA 4IC2A 2MD8C 1QSCA 4C9ZA 2VPGA 4LADB 2XEUA 1LB5A 5G05B 5AITA 1LDKC 1CZZA 3I2DA 2MD7B 5H1UA 4YADA 2FUUA 2CT2A 4K8UA 3IVQA 3MQSC 2E6SA 3HCTA 2F42A 2MIQA 2YQMA 4GB0A 4ZQLA 3MHHA 4L58A 3ZVZB 4FIPA 4O64A 2NAAA 2KIZA 3SOWA 4YATA 2ECGA 2QJ0A 3O70A 1WEMA 4FJCA 3HU6A 4P5OB 2CSYA 1MM3A 4TKPB 4LJNA 4AUQB 2YSMA 3SOUA 3O33A 5B77A 4V3KC 3LQJA 5J3XA 2MNZA 2M85A 2EODA 4GNFA 2KGIA 3KV6A 2CSZA 4WZ2A 1WEUA 4WZ3B 2LGLA 4I7BA 2YHNA 3N9NA 4WA6A 4LLBA 1E4UA 2LXHC 1D0AA 3LQHA 2KFTA 3O35A 5D1MB 2VJEA 4UP5A 1K2FA 5D1LB 2AN6A 1F3VB 5C13A 2K17A 2GKWA 4R7EA 3SHBA 4AP4A 4M4EA 2BAYA 5FEYA 1F62A 1MM2A 4GWNA 2Y43A 2JMDA 3HQLA 3MQRA 3ZPV1 2LGVA 2D8SA 2K1JA 2A25A 3O36A 2MNYA 2CKLA 3ZJBA 3ZNIA 4F52B 2EGPA 3FL2A 3EB6A 4B7YC 1VYXA 4X3GA 2KU3A 4V3LC 2KREA 2RI7A 2ECTA 2ECVA 1ZBDB 2KWOA 1ZMSA 1CHCA 1X4UA 5FERA 4NN2A 1YZEA 1CA9A 3DQVR 5AIUA 4GNDA 3C5KA 5B78A 5KH7A 4YAXA 2YW8A 1FLKA 2I50A 4R2YA 3T7LA 2FUIA 2G6QA 2ECWA 5KH9A 2KYUA 3RTRB 4LK9A 4GWMA 2PUYA 4YC9A 2C2LA 3O34A 2F6NA 4FK5A 2VPDA 3M62A 2E6RA 2YHOA 1WEPA 1XWHA 4YBMA 2YSJA 1IYMA 2IDAA 4XI1A 3QZVA 5H9MA 1T1HA 3PUQA 2F6JA 2JRJA 1CA4A 2ECNA 4O1VA 2G43A 2M3HA 4I7CA 5H1TA 1JM7B 2YURA 2EA6A 5FB1A 2L80A 3ZYQA 4ZUXU 3M63A 2F1ZA 3HQIA 3L11A 2FSAA 1V87A 3KQIA 3RPGC 2JMIA 2VJFB 1X4JA 4MVTA 4N4FA 3IVBA 4BHWA 5LKUA 5I3LA 4N3WA 2LXPC 3KV5A 2F1YA 5FB0A 3PURA 5G04B 1VD4A 2KWJA 2QICA 1Z60A 1VFYA 4CCGX 4YBTA 2FOPA 5TDRA 5LKTA 1WEEA 1WEQA 1Z6UA 5DKAA 2K16A 4QF2A 3KNVA 3N9OA 3N9QA 2CR2A 4WZ0A 2HDPA 3MHSA 4QF3A 2VJEB 4YABA 4AYCB 1N87A 2ZETC 3LRQA 4YBSA 2PNXA 1WESA 4I7DA 3O7AA 1RMDA 2HYED 5B8DA 2YU4A 4GHUA 5DINA 4B86C 5LCWB 2ECIA 2M6MA 1KZZA 3T6RA 1L0AA 4Z8MA 1WEWA 4R8PK 3ZPVE 5LKXA 2YREA 3ASLA 4L7XA 1D0JA 4PPEA 1DVPA 1RF3A 3N9MA 4LKAA 2CKLB 1LB4A 2L0BA 2LQ6A 1WFKA 4MSXA 4GNEA 3EB5A 1FBVA 2Y1NA 5JG6A 3L1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJQ A;  2KE1 A;  2C2V S;  2KGG A;  2H0D B;  3GV4 A;  1CZY A;  3DPL R;  1Z2Q A;  3VK6 A;  2VPE A;  4FO9 A;  5B76 A;  4Q6F A;  2UZG A;  2KR4 A;  4W4U A;  4ZDT A;  4S3O C;  1D01 A;  1WGM A;  1JM7 A;  1FLL A;  3IHP A;  4PTB A;  2K4D A;  3N9L A;  5EYA F;  3V43 A;  2XB1 A;  5TRB A;  5KH3 A;  2FOO A;  5TAB A;  3M99 A;  1D00 A;  2VJF A;  3ZTG A;  3HQH A;  2QIZ A;  2YYR A;  4A0C D;  4A4C A;  1WIM A;  2MA6 A;  5H1V A;  2VPB A;  5D1K B;  2F1W A;  2YT5 A;  5B75 A;  4AVX A;  4KG9 A;  2XXN A;  2G45 A;  3C6W A;  1FP0 A;  5B79 A;  1LDJ B;  3NG2 A;  1WEO A;  5G0F A;  1HYI A;  3PHD A;  4YSI A;  5TDW A;  4CA1 A;  2F1X A;  4BBQ A;  3IVV A;  2JMJ A;  2VP7 A;  4UP0 A;  1WIL A;  1HYJ A;  2DX8 A;  4GNG A;  4AYC A;  2YQL A;  3L1Z B;  3SOX A;  3GL6 A;  2L43 A;  4A4B A;  3U5P A;  4S3O B;  3HCU A;  5E1T A;  2LRI C;  5LKZ A;  3U5N A;  3HCS A;  1BOR A;  3U5M A;  3HQM A;  3N9P A;  2M1R A;  2LDR A;  2YUC A;  2VNF A;  2ECJ A;  2OXQ C;  1X4I A;  3HSV A;  2LV9 A;  2LN0 A;  3LQI A;  5C11 A;  1WEN A;  2MUM A;  4IC3 A;  1JOC A;  2LGK A;  2RSD A;  4UI9 B;  2Y1M A;  3ZVY A;  2KWK A;  1YY6 A;  2L75 A;  2KWN A;  3O37 A;  3HTK C;  1U6G B;  2LGG A;  4A49 A;  1WEV A;  3RPG B;  1G25 A;  2MT5 A;  2FOJ A;  3U5O A;  2H0D A;  1LB6 A;  5TBN A;  1WE9 A;  2MA5 A;  4GJH A;  2L5U A;  4IC2 A;  2MD8 C;  1QSC A;  4C9Z A;  2VPG A;  4LAD B;  2XEU A;  1LB5 A;  5G05 B;  5AIT A;  1LDK C;  1CZZ A;  3I2D A;  2MD7 B;  5H1U A;  4YAD A;  2FUU A;  2CT2 A;  4K8U A;  3IVQ A;  3MQS C;  2E6S A;  3HCT A;  2F42 A;  2MIQ A;  2YQM A;  4GB0 A;  4ZQL A;  3MHH A;  4L58 A;  3ZVZ B;  4FIP A;  4O64 A;  2NAA A;  2KIZ A;  3SOW A;  4YAT A;  2ECG A;  2QJ0 A;  3O70 A;  1WEM A;  4FJC A;  3HU6 A;  4P5O B;  2CSY A;  1MM3 A;  4TKP B;  4LJN A;  4AUQ B;  2YSM A;  3SOU A;  3O33 A;  5B77 A;  4V3K C;  3LQJ A;  5J3X A;  2MNZ A;  2M85 A;  2EOD A;  4GNF A;  2KGI A;  3KV6 A;  2CSZ A;  4WZ2 A;  1WEU A;  4WZ3 B;  2LGL A;  4I7B A;  2YHN A;  3N9N A;  4WA6 A;  4LLB A;  1E4U A;  2LXH C;  1D0A A;  3LQH A;  2KFT A;  3O35 A;  5D1M B;  2VJE A;  4UP5 A;  1K2F A;  5D1L B;  2AN6 A;  1F3V B;  5C13 A;  2K17 A;  2GKW A;  4R7E A;  3SHB A;  4AP4 A;  4M4E A;  2BAY A;  5FEY A;  1F62 A;  1MM2 A;  4GWN A;  2Y43 A;  2JMD A;  3HQL A;  3MQR A;  3ZPV 1;  2LGV A;  2D8S A;  2K1J A;  2A25 A;  3O36 A;  2MNY A;  2CKL A;  3ZJB A;  3ZNI A;  4F52 B;  2EGP A;  3FL2 A;  3EB6 A;  4B7Y C;  1VYX A;  4X3G A;  2KU3 A;  4V3L C;  2KRE A;  2RI7 A;  2ECT A;  2ECV A;  1ZBD B;  2KWO A;  1ZMS A;  1CHC A;  1X4U A;  5FER A;  4NN2 A;  1YZE A;  1CA9 A;  3DQV R;  5AIU A;  4GND A;  3C5K A;  5B78 A;  5KH7 A;  4YAX A;  2YW8 A;  1FLK A;  2I50 A;  4R2Y A;  3T7L A;  2FUI A;  2G6Q A;  2ECW A;  5KH9 A;  2KYU A;  3RTR B;  4LK9 A;  4GWM A;  2PUY A;  4YC9 A;  2C2L A;  3O34 A;  2F6N A;  4FK5 A;  2VPD A;  3M62 A;  2E6R A;  2YHO A;  1WEP A;  1XWH A;  4YBM A;  2YSJ A;  1IYM A;  2IDA A;  4XI1 A;  3QZV A;  5H9M A;  1T1H A;  3PUQ A;  2F6J A;  2JRJ A;  1CA4 A;  2ECN A;  4O1V A;  2G43 A;  2M3H A;  4I7C A;  5H1T A;  1JM7 B;  2YUR A;  2EA6 A;  5FB1 A;  2L80 A;  3ZYQ A;  4ZUX U;  3M63 A;  2F1Z A;  3HQI A;  3L11 A;  2FSA A;  1V87 A;  3KQI A;  3RPG C;  2JMI A;  2VJF B;  1X4J A;  4MVT A;  4N4F A;  3IVB A;  4BHW A;  5LKU A;  5I3L A;  4N3W A;  2LXP C;  3KV5 A;  2F1Y A;  5FB0 A;  3PUR A;  5G04 B;  1VD4 A;  2KWJ A;  2QIC A;  1Z60 A;  1VFY A;  4CCG X;  4YBT A;  2FOP A;  5TDR A;  5LKT A;  1WEE A;  1WEQ A;  1Z6U A;  5DKA A;  2K16 A;  4QF2 A;  3KNV A;  3N9O A;  3N9Q A;  2CR2 A;  4WZ0 A;  2HDP A;  3MHS A;  4QF3 A;  2VJE B;  4YAB A;  4AYC B;  1N87 A;  2ZET C;  3LRQ A;  4YBS A;  2PNX A;  1WES A;  4I7D A;  3O7A A;  1RMD A;  2HYE D;  5B8D A;  2YU4 A;  4GHU A;  5DIN A;  4B86 C;  5LCW B;  2ECI A;  2M6M A;  1KZZ A;  3T6R A;  1L0A A;  4Z8M A;  1WEW A;  4R8P K;  3ZPV E;  5LKX A;  2YRE A;  3ASL A;  4L7X A;  1D0J A;  4PPE A;  1DVP A;  1RF3 A;  3N9M A;  4LKA A;  2CKL B;  1LB4 A;  2L0B A;  2LQ6 A;  1WFK A;  4MSX A;  4GNE A;  3EB5 A;  1FBV A;  2Y1N A;  5JG6 A;  3L1X A; 
#chains in the Genus database with same CATH topology
 4JJQ A;  2KE1 A;  2C2V S;  2KGG A;  3FEH A;  2H0D B;  3GV4 A;  1CZY A;  3DPL R;  1Z2Q A;  3VK6 A;  2VPE A;  4FO9 A;  5B76 A;  4Q6F A;  2UZG A;  3SUB A;  2KR4 A;  4W4U A;  4ZDT A;  4S3O C;  1D01 A;  1WGM A;  1JM7 A;  2EGM A;  1FLL A;  3IHP A;  4PTB A;  2K4D A;  3N9L A;  5EYA F;  3V43 A;  2XB1 A;  5TRB A;  5KH3 A;  2B0O E;  2FOO A;  5TAB A;  3M99 A;  1D00 A;  2VJF A;  3ZTG A;  3HQH A;  2QIZ A;  2YYR A;  4A0C D;  4A4C A;  1WIM A;  2MA6 A;  5H1V A;  2CRR A;  2VPB A;  2D8U A;  5D1K B;  2F1W A;  2YT5 A;  5B75 A;  4AVX A;  4KG9 A;  2XXN A;  2G45 A;  3C6W A;  1FP0 A;  5B79 A;  1LDJ B;  3NG2 A;  1WEO A;  5G0F A;  1HYI A;  3PHD A;  4YSI A;  5TDW A;  4CA1 A;  2F1X A;  4BBQ A;  3IVV A;  2JMJ A;  2VP7 A;  4UP0 A;  1WIL A;  1HYJ A;  5SVI B;  2DX8 A;  4GNG A;  4AYC A;  2YQL A;  3L1Z B;  3SOX A;  3GL6 A;  2P57 A;  2L43 A;  4A4B A;  3U5P A;  4S3O B;  3HCU A;  5E1T A;  2LRI C;  5LKZ A;  3U5N A;  3HCS A;  1BOR A;  3U5M A;  3HQM A;  3N9P A;  2M1R A;  2LDR A;  2YUC A;  2VNF A;  4OGE A;  2ECJ A;  2OXQ C;  1X4I A;  3HSV A;  2RR4 A;  2LV9 A;  2LN0 A;  3LQI A;  5C11 A;  1WEN A;  2MUM A;  4IC3 A;  2DJA A;  1JOC A;  2LGK A;  2RSD A;  3LJU X;  4UI9 B;  2Y1M A;  3ZVY A;  2KWK A;  1YY6 A;  2L75 A;  2KWN A;  3O37 A;  3HTK C;  5K3Q A;  1U6G B;  3LVR E;  2LGG A;  4A49 A;  1WEV A;  3RPG B;  1G25 A;  2KKY A;  2MT5 A;  2FOJ A;  1DCQ A;  3U5O A;  3LDY A;  2H0D A;  1LB6 A;  5TBN A;  1WE9 A;  2MA5 A;  4GJH A;  2L5U A;  4IC2 A;  2MD8 C;  1QSC A;  4C9Z A;  2VPG A;  4LAD B;  2XEU A;  1LB5 A;  5G05 B;  5AIT A;  2M13 A;  1LDK C;  1CZZ A;  3I2D A;  2MD7 B;  5H1U A;  3FM8 C;  4YAD A;  2FUU A;  2CT2 A;  4K8U A;  3IVQ A;  3MQS C;  2E6S A;  3HCT A;  2F42 A;  2MIQ A;  2YQM A;  4GB0 A;  4ZQL A;  3MHH A;  4L58 A;  3ZVZ B;  4FIP A;  4O64 A;  2NAA A;  2KIZ A;  3SOW A;  4YAT A;  2ECG A;  2QJ0 A;  3O70 A;  1WEM A;  4FJC A;  3HU6 A;  4P5O B;  2CSY A;  2LAU A;  1MM3 A;  3Q1D A;  4TKP B;  4LJN A;  4AUQ B;  2YSM A;  3SOU A;  3O33 A;  5B77 A;  4V3K C;  3LQJ A;  5J3X A;  2MNZ A;  2M85 A;  2EOD A;  4GNF A;  2KGI A;  3KV6 A;  2OWA A;  2CSZ A;  4WZ2 A;  1WEU A;  2KKX A;  2LGL A;  4I7B A;  2EXU A;  2YHN A;  3N9N A;  4WA6 A;  4WZ3 B;  4LLB A;  1E4U A;  2LXH C;  1D0A A;  3LQH A;  2KFT A;  3O35 A;  5D1M B;  2VJE A;  1MBM A;  4UP5 A;  1K2F A;  5D1L B;  2AN6 A;  1F3V B;  5C13 A;  2K17 A;  2GKW A;  4R7E A;  3FAN A;  3SHB A;  2XOZ A;  4AP4 A;  4M4E A;  2BAY A;  5FEY A;  1F62 A;  1MM2 A;  3T9K A;  4GWN A;  2Y43 A;  2JMD A;  3HQL A;  3MQR A;  3ZPV 1;  2LGV A;  2D8S A;  3FJU B;  2K1J A;  3FAO A;  2A25 A;  3O36 A;  2MNY A;  2CKL A;  3ZJB A;  3ZNI A;  4F52 B;  2EGP A;  3FL2 A;  2FFW A;  3EB6 A;  4B7Y C;  1VYX A;  3PLW A;  4X3G A;  2KU3 A;  4V3L C;  2KRE A;  2RI7 A;  2ECT A;  2ECV A;  1ZBD B;  2KWO A;  2YVR A;  1ZMS A;  1CHC A;  1X4U A;  5FER A;  4NN2 A;  3DDT A;  4Z0O A;  1YZE A;  1CA9 A;  3DQV R;  5AIU A;  4GND A;  3C5K A;  5SVX A;  5B78 A;  5KH7 A;  4YAX A;  2YW8 A;  1FLK A;  2I50 A;  4R2Y A;  3T7L A;  2FUI A;  2G6Q A;  2ECW A;  5KH9 A;  2CSV A;  3DWD A;  2KYU A;  3RTR B;  4LK9 A;  4GWM A;  2PUY A;  4OGC A;  4YC9 A;  2C2L A;  3O34 A;  2F6N A;  4FK5 A;  2VPD A;  3M62 A;  2E6R A;  2YHO A;  1WEP A;  1XWH A;  4YBM A;  2YSJ A;  1IYM A;  2IDA A;  4XI1 A;  3QZV A;  5H9M A;  2FD4 A;  3O47 A;  1T1H A;  3PUQ A;  2F6J A;  2JRJ A;  1CA4 A;  2ECN A;  4O1V A;  2G43 A;  2M3H A;  4I7C A;  4Z0R A;  5H1T A;  2E61 A;  1JM7 B;  2YUR A;  2EA6 A;  5FB1 A;  2L80 A;  3ZYQ A;  4ZUX U;  3M63 A;  2F1Z A;  5SVI A;  3HQI A;  2CRW A;  3L11 A;  2FSA A;  2IQJ A;  1V87 A;  3KQI A;  3RPG C;  2JMI A;  2VJF B;  1X4J A;  4MVT A;  3M7K A;  3H7H A;  4N4F A;  3IVB A;  4BHW A;  5LKU A;  5I3L A;  4N3W A;  2LXP C;  3KV5 A;  2F1Y A;  5FB0 A;  5SVY A;  3PUR A;  2XOY A;  5G04 B;  1VD4 A;  2KWJ A;  2QIC A;  1Z60 A;  1VFY A;  4CCG X;  2XP0 A;  4YBT A;  3E2D A;  4QQ4 A;  2FOP A;  5TDR A;  3JUE A;  5LKT A;  1WEE A;  1WEQ A;  1Z6U A;  2L7P A;  5DKA A;  4F1P A;  2XOC A;  2K16 A;  4QF2 A;  3KNV A;  3N9O A;  3LVQ E;  3N9Q A;  2CR2 A;  4WZ0 A;  2HDP A;  3MHS A;  4QF3 A;  2CON A;  2VJE B;  4YAB A;  4AYC B;  1N87 A;  2JUN A;  2JM3 A;  2ZET C;  3LRQ A;  2PNX A;  3MDB C;  4YBS A;  1WES A;  4I7D A;  3O7A A;  1RMD A;  2HYE D;  5B8D A;  2YU4 A;  4GHU A;  5DIN A;  4B86 C;  5LCW B;  2ECI A;  2DSM A;  2M6M A;  1KZZ A;  3T6R A;  1L0A A;  4Z8M A;  1WEW A;  4R8P K;  3ZPV E;  5LKX A;  2YRE A;  3ASL A;  4L7X A;  1D0J A;  1DVP A;  4O62 A;  4PPE A;  2MKE A;  1RF3 A;  3N9M A;  4LKA A;  3KDE C;  2CKL B;  1LB4 A;  4H9D A;  2L0B A;  2LQ6 A;  1WFK A;  4MSX A;  4GNE A;  3EB5 A;  1FBV A;  2Y1N A;  5JG6 A;  3L1X A; 
#chains in the Genus database with same CATH homology
 4JJQ A;  2KE1 A;  2C2V S;  2KGG A;  2H0D B;  3GV4 A;  1CZY A;  3DPL R;  1Z2Q A;  3VK6 A;  2VPE A;  4FO9 A;  5B76 A;  4Q6F A;  2UZG A;  2KR4 A;  4W4U A;  4ZDT A;  4S3O C;  1D01 A;  1WGM A;  1JM7 A;  1FLL A;  3IHP A;  4PTB A;  2K4D A;  3N9L A;  5EYA F;  3V43 A;  2XB1 A;  5TRB A;  5KH3 A;  2FOO A;  5TAB A;  3M99 A;  1D00 A;  2VJF A;  3ZTG A;  3HQH A;  2QIZ A;  2YYR A;  4A0C D;  4A4C A;  1WIM A;  2MA6 A;  5H1V A;  2VPB A;  5D1K B;  2F1W A;  2YT5 A;  5B75 A;  4AVX A;  4KG9 A;  2XXN A;  2G45 A;  3C6W A;  1FP0 A;  5B79 A;  1LDJ B;  3NG2 A;  1WEO A;  5G0F A;  1HYI A;  3PHD A;  4YSI A;  5TDW A;  4CA1 A;  2F1X A;  4BBQ A;  3IVV A;  2JMJ A;  2VP7 A;  4UP0 A;  1WIL A;  1HYJ A;  2DX8 A;  4GNG A;  4AYC A;  2YQL A;  3L1Z B;  3SOX A;  3GL6 A;  2L43 A;  4A4B A;  3U5P A;  4S3O B;  3HCU A;  5E1T A;  2LRI C;  5LKZ A;  3U5N A;  3HCS A;  1BOR A;  3U5M A;  3HQM A;  3N9P A;  2M1R A;  2LDR A;  2YUC A;  2VNF A;  2ECJ A;  2OXQ C;  1X4I A;  3HSV A;  2LV9 A;  2LN0 A;  3LQI A;  5C11 A;  1WEN A;  2MUM A;  4IC3 A;  1JOC A;  2LGK A;  2RSD A;  4UI9 B;  2Y1M A;  3ZVY A;  2KWK A;  1YY6 A;  2L75 A;  2KWN A;  3O37 A;  3HTK C;  1U6G B;  2LGG A;  4A49 A;  1WEV A;  3RPG B;  1G25 A;  2MT5 A;  2FOJ A;  3U5O A;  2H0D A;  1LB6 A;  5TBN A;  1WE9 A;  2MA5 A;  4GJH A;  2L5U A;  4IC2 A;  2MD8 C;  1QSC A;  4C9Z A;  2VPG A;  4LAD B;  2XEU A;  1LB5 A;  5G05 B;  5AIT A;  1LDK C;  1CZZ A;  3I2D A;  2MD7 B;  5H1U A;  4YAD A;  2FUU A;  2CT2 A;  4K8U A;  3IVQ A;  3MQS C;  2E6S A;  3HCT A;  2F42 A;  2MIQ A;  2YQM A;  4GB0 A;  4ZQL A;  3MHH A;  4L58 A;  3ZVZ B;  4FIP A;  4O64 A;  2NAA A;  2KIZ A;  3SOW A;  4YAT A;  2ECG A;  2QJ0 A;  3O70 A;  1WEM A;  4FJC A;  3HU6 A;  4P5O B;  2CSY A;  1MM3 A;  4TKP B;  4LJN A;  4AUQ B;  2YSM A;  3SOU A;  3O33 A;  5B77 A;  4V3K C;  3LQJ A;  5J3X A;  2MNZ A;  2M85 A;  2EOD A;  4GNF A;  2KGI A;  3KV6 A;  2CSZ A;  4WZ2 A;  1WEU A;  4WZ3 B;  2LGL A;  4I7B A;  2YHN A;  3N9N A;  4WA6 A;  4LLB A;  1E4U A;  2LXH C;  1D0A A;  3LQH A;  2KFT A;  3O35 A;  5D1M B;  2VJE A;  4UP5 A;  1K2F A;  5D1L B;  2AN6 A;  1F3V B;  5C13 A;  2K17 A;  2GKW A;  4R7E A;  3SHB A;  4AP4 A;  4M4E A;  2BAY A;  5FEY A;  1F62 A;  1MM2 A;  4GWN A;  2Y43 A;  2JMD A;  3HQL A;  3MQR A;  3ZPV 1;  2LGV A;  2D8S A;  2K1J A;  2A25 A;  3O36 A;  2MNY A;  2CKL A;  3ZJB A;  3ZNI A;  4F52 B;  2EGP A;  3FL2 A;  3EB6 A;  4B7Y C;  1VYX A;  4X3G A;  2KU3 A;  4V3L C;  2KRE A;  2RI7 A;  2ECT A;  2ECV A;  1ZBD B;  2KWO A;  1ZMS A;  1CHC A;  1X4U A;  5FER A;  4NN2 A;  1YZE A;  1CA9 A;  3DQV R;  5AIU A;  4GND A;  3C5K A;  5B78 A;  5KH7 A;  4YAX A;  2YW8 A;  1FLK A;  2I50 A;  4R2Y A;  3T7L A;  2FUI A;  2G6Q A;  2ECW A;  5KH9 A;  2KYU A;  3RTR B;  4LK9 A;  4GWM A;  2PUY A;  4YC9 A;  2C2L A;  3O34 A;  2F6N A;  4FK5 A;  2VPD A;  3M62 A;  2E6R A;  2YHO A;  1WEP A;  1XWH A;  4YBM A;  2YSJ A;  1IYM A;  2IDA A;  4XI1 A;  3QZV A;  5H9M A;  1T1H A;  3PUQ A;  2F6J A;  2JRJ A;  1CA4 A;  2ECN A;  4O1V A;  2G43 A;  2M3H A;  4I7C A;  5H1T A;  1JM7 B;  2YUR A;  2EA6 A;  5FB1 A;  2L80 A;  3ZYQ A;  4ZUX U;  3M63 A;  2F1Z A;  3HQI A;  3L11 A;  2FSA A;  1V87 A;  3KQI A;  3RPG C;  2JMI A;  2VJF B;  1X4J A;  4MVT A;  4N4F A;  3IVB A;  4BHW A;  5LKU A;  5I3L A;  4N3W A;  2LXP C;  3KV5 A;  2F1Y A;  5FB0 A;  3PUR A;  5G04 B;  1VD4 A;  2KWJ A;  2QIC A;  1Z60 A;  1VFY A;  4CCG X;  4YBT A;  2FOP A;  5TDR A;  5LKT A;  1WEE A;  1WEQ A;  1Z6U A;  5DKA A;  2K16 A;  4QF2 A;  3KNV A;  3N9O A;  3N9Q A;  2CR2 A;  4WZ0 A;  2HDP A;  3MHS A;  4QF3 A;  2VJE B;  4YAB A;  4AYC B;  1N87 A;  2ZET C;  3LRQ A;  4YBS A;  2PNX A;  1WES A;  4I7D A;  3O7A A;  1RMD A;  2HYE D;  5B8D A;  2YU4 A;  4GHU A;  5DIN A;  4B86 C;  5LCW B;  2ECI A;  2M6M A;  1KZZ A;  3T6R A;  1L0A A;  4Z8M A;  1WEW A;  4R8P K;  3ZPV E;  5LKX A;  2YRE A;  3ASL A;  4L7X A;  1D0J A;  4PPE A;  1DVP A;  1RF3 A;  3N9M A;  4LKA A;  2CKL B;  1LB4 A;  2L0B A;  2LQ6 A;  1WFK A;  4MSX A;  4GNE A;  3EB5 A;  1FBV A;  2Y1N A;  5JG6 A;  3L1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...