4I7CA

Siah1 mutant bound to synthetic peptide (ace)klrpv(23p)mvrpwvr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
188
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSICTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 45
structure length 188
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7cA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7cA01
3L11A 2KFTA 2UZGA 3HCSA 4UP0A 4AVXA 2ZETC 4AYCB 2YT5A 1WILA 2FOOA 3N9PA 4R7EA 3ZNIA 2VPDA 1JM7B 4R2YA 4WZ0A 3I2DA 2H0DB 5G04B 1WESA 3PURA 5FB0A 1D0JA 1X4UA 2L0BA 5FERA 3SOWA 2EGPA 2LXPC 1CA9A 1L0AA 4YADA 4S3OC 5J3XA 4JJQA 5B78A 3HCTA 2YQLA 4GNFA 3RPGC 2YURA 5KH3A 4IC2A 2YW8A 5AIUA 1F62A 4I7CA 1CZZA 3IVQA 5LKTA 2NAAA 1XWHA 4WA6A 4F52B 5I3LA 2C2VS 2M85A 3M99A 1MM2A 2MA6A 2XEUA 4S3OB 2MIQA 4L7XA 5TDWA 1D0AA 1MM3A 3ZJBA 5DKAA 5D1MB 2MT5A 4LADB 3RPGB 1N87A 4N4FA 2L43A 3NG2A 4MVTA 2KIZA 3L1ZB 5B76A 4I7DA 4AP4A 3O35A 3KV5A 2RI7A 2JMIA 5B79A 4YBTA 2VPGA 2Y1MA 4Z8MA 4AUQB 4ZDTA 5TABA 1YZEA 5G05B 3C5KA 5H1TA 1Z2QA 4GWMA 1DVPA 4GNEA 2K1JA 4CA1A 5D1KB 2F42A 5KH9A 3LRQA 3MQSC 2KWNA 2CR2A 3HQLA 1FP0A 4GWNA 2MUMA 2VJFA 5D1LB 3LQIA 3IHPA 5LKUA 2Y1NA 3EB6A 5B77A 3DQVR 4XI1A 4O1VA 1HYJA 1VD4A 3O36A 4V3LC 4X3GA 2K17A 2OXQC 2K4DA 2ECWA 3O34A 3T7LA 3U5NA 5H1VA 1E4UA 2ECJA 1RF3A 2CSZA 3KQIA 1KZZA 4WZ2A 2MNZA 5C13A 2E6RA 3IVVA 3ASLA 1CZYA 3N9OA 4FK5A 2LN0A 2YREA 1HYIA 3VK6A 4YBSA 3O70A 4TKPB 1F3VB 4ZQLA 3V43A 5B75A 1WEUA 1CHCA 1ZBDB 3SOUA 4LLBA 4UI9B 2ECNA 4GHUA 2FOJA 4PTBA 4W4UA 3FL2A 3HTKC 4BHWA 2RSDA 5G0FA 4A4CA 2JRJA 4N3WA 4CCGX 2LXHC 2AN6A 2CT2A 3KV6A 2CKLA 4M4EA 5AITA 2HYED 4C9ZA 1QSCA 3O37A 3HQHA 2LV9A 4QF3A 1WFKA 1LDJB 2CSYA 4GNDA 2F1ZA 3ZPVE 4NN2A 2KWKA 4P5OB 5LKZA 2XXNA 2JMJA 1IYMA 2M3HA 3LQJA 4PPEA 2KYUA 3L1XA 4A0CD 2MD7B 2PNXA 1LB4A 4YAXA 4LKAA 1FBVA 2VJFB 5H9MA 1WEOA 3KNVA 2KE1A 5KH7A 3N9QA 2ECGA 3O33A 4Q6FA 1JOCA 5TRBA 3EB5A 3U5OA 1BORA 3HSVA 2KGGA 2F1YA 3PUQA 4BBQA 3N9MA 2QICA 2L5UA 2HDPA 3LQHA 2KWJA 5LCWB 3ZVYA 2LGLA 3PHDA 1ZMSA 1RMDA 2LGKA 2QJ0A 1YY6A 3ZYQA 2YSJA 2L80A 4GNGA 1WEWA 2YU4A 3M63A 4B7YC 2VJEA 4GJHA 3GL6A 2F1WA 3N9NA 3IVBA 2JMDA 2LQ6A 3U5MA 5C11A 1LB6A 4A49A 3GV4A 5EYAF 1WENA 1FLLA 2LRIC 2K16A 3MHHA 3U5PA 2CKLB 1U6GB 4L58A 2ECIA 4FO9A 1LDKC 1FLKA 1G25A 2ECTA 4O64A 2G43A 1D00A 1WGMA 2FUUA 3MQRA 4KG9A 3HCUA 2L75A 5FEYA 2MNYA 3DPLR 2VP7A 4AYCA 2VPBA 3SOXA 2ECVA 1X4IA 3O7AA 3SHBA 5B8DA 2A25A 2EA6A 2MD8C 1T1HA 1WEQA 3ZVZB 4K8UA 1JM7A 2XB1A 2G6QA 2H0DA 4GB0A 1Z60A 5FB1A 5E1TA 2KWOA 5TDRA 2D8SA 3ZPV1 1K2FA 3M62A 4YSIA 2F6JA 1WEPA 2IDAA 2M6MA 2LDRA 2M1RA 3HQMA 3QZVA 1WEMA 2YUCA 2YHOA 5LKXA 3N9LA 5TBNA 2C2LA 2KGIA 2LGGA 2PUYA 3C6WA 4B86C 2VPEA 2BAYA 1WIMA 5H1UA 2FSAA 4I7BA 2YQMA 2MA5A 3RTRB 2YSMA 2FUIA 2YYRA 4FIPA 1WE9A 2F6NA 1CA4A 2VJEB 2E6SA 4YATA 4YBMA 4V3KC 4YC9A 2DX8A 4WZ3B 4R8PK 3HQIA 4A4BA 4UP5A 4LK9A 3HU6A 1WEEA 1D01A 2F1XA 2KR4A 4MSXA 2YHNA 2KU3A 1V87A 1LB5A 3ZTGA 2FOPA 4ZUXU 2KREA 4LJNA 1X4JA 2EODA 2Y43A 2G45A 4YABA 1VYXA 5DINA 2I50A 2VNFA 5JG6A 4FJCA 1WEVA 4IC3A 1VFYA 2GKWA 2QIZA 1Z6UA 3T6RA 3MHSA 4QF2A 2LGVA
chains in the Genus database with same CATH superfamily
3L11A 2KFTA 3LDYA 2UZGA 3HCSA 3PLWA 4UP0A 4AVXA 2ZETC 4AYCB 2YT5A 1WILA 2FOOA 3N9PA 4R7EA 3ZNIA 2VPDA 2M13A 3KDEC 2B0OE 4R2YA 4WZ0A 1JM7B 3I2DA 2H0DB 5K3QA 5G04B 1WESA 3PURA 5FB0A 1D0JA 1X4UA 2L0BA 5FERA 3SOWA 2EGPA 2LXPC 1CA9A 1L0AA 4YADA 4S3OC 5J3XA 4JJQA 3MDBC 5B78A 3HCTA 2YQLA 4GNFA 3RPGC 2YURA 5KH3A 4IC2A 2YW8A 5AIUA 1F62A 2XOYA 4I7CA 1CZZA 3IVQA 2CRWA 5LKTA 2NAAA 1XWHA 4WA6A 3FEHA 4F52B 2KKXA 5I3LA 2IQJA 2C2VS 2M85A 3M99A 1MM2A 2MA6A 2XEUA 4S3OB 2MIQA 4L7XA 5TDWA 1D0AA 1MM3A 3ZJBA 5DKAA 5D1MB 2JM3A 2MT5A 4LADB 3RPGB 1N87A 4N4FA 2L43A 3NG2A 4MVTA 2KIZA 3L1ZB 5B76A 4I7DA 4AP4A 3O35A 3KV5A 2RI7A 2JMIA 5B79A 4YBTA 2VPGA 2Y1MA 4Z8MA 4AUQB 4ZDTA 5TABA 1YZEA 5G05B 3C5KA 2P57A 5H1TA 3FJUB 1Z2QA 2E61A 2OWAA 4GWMA 1DVPA 2DSMA 2K1JA 4CA1A 4GNEA 5D1KB 2F42A 5KH9A 3LRQA 3MQSC 2KWNA 2CR2A 3HQLA 2FD4A 1FP0A 4GWNA 2MUMA 2VJFA 4Z0OA 5D1LB 3LQIA 3IHPA 5LKUA 5SVIA 2Y1NA 3EB6A 5B77A 3DQVR 2EXUA 3LVRE 4XI1A 4O1VA 4OGCA 1HYJA 1VD4A 3O36A 4V3LC 4X3GA 2K17A 2OXQC 2K4DA 4QQ4A 2ECWA 3O34A 3T7LA 3U5NA 5H1VA 1E4UA 4F1PA 2ECJA 1RF3A 2CSZA 3KQIA 1KZZA 2CONA 2MNZA 3FM8C 4WZ2A 5C13A 2E6RA 3IVVA 3ASLA 1CZYA 3N9OA 4FK5A 2LN0A 2RR4A 2YREA 3O47A 1HYIA 3VK6A 2XOZA 4YBSA 3LJUX 3O70A 4TKPB 1F3VB 2YVRA 4ZQLA 3V43A 5B75A 1WEUA 1CHCA 1ZBDB 3SOUA 4LLBA 3H7HA 4UI9B 2ECNA 4GHUA 2FOJA 4PTBA 4W4UA 3FL2A 3HTKC 4BHWA 3M7KA 4O62A 2RSDA 5G0FA 4A4CA 2JRJA 4N3WA 4CCGX 2LXHC 2AN6A 2CT2A 3KV6A 2CKLA 4M4EA 5AITA 5SVYA 2HYED 4C9ZA 1QSCA 3O37A 3HQHA 2LV9A 4QF3A 1WFKA 1LDJB 2CSYA 4GNDA 2DJAA 2F1ZA 3ZPVE 2XOCA 4NN2A 2KWKA 4P5OB 5LKZA 2XXNA 5SVXA 2JMJA 1IYMA 2M3HA 3LQJA 4PPEA 2KYUA 3L1XA 4A0CD 2MD7B 2PNXA 1LB4A 2LAUA 4YAXA 4LKAA 1FBVA 2VJFB 5H9MA 1WEOA 3KNVA 2KE1A 5KH7A 2XP0A 3N9QA 3E2DA 2ECGA 3O33A 4Q6FA 1JOCA 5TRBA 3EB5A 3U5OA 1BORA 3HSVA 3DWDA 2KGGA 2F1YA 3PUQA 4BBQA 3N9MA 2QICA 3FANA 2L5UA 2HDPA 3LQHA 2KWJA 5LCWB 3ZVYA 2LGLA 3PHDA 1ZMSA 1RMDA 2LGKA 2QJ0A 1YY6A 3ZYQA 2YSJA 2L80A 4GNGA 1WEWA 2YU4A 3M63A 4B7YC 2VJEA 3Q1DA 4GJHA 3GL6A 4Z0RA 2F1WA 3N9NA 3SUBA 3IVBA 2JMDA 2LQ6A 3U5MA 2D8UA 5C11A 1LB6A 4A49A 3GV4A 5EYAF 1WENA 1FLLA 2LRIC 2K16A 3MHHA 3U5PA 2CKLB 1DCQA 1U6GB 4L58A 2ECIA 4FO9A 1LDKC 1FLKA 1G25A 2ECTA 4O64A 2G43A 1D00A 1WGMA 2FUUA 3MQRA 4KG9A 3HCUA 2L75A 5FEYA 2MNYA 3DPLR 2VP7A 4AYCA 2VPBA 3SOXA 2ECVA 1X4IA 2FFWA 3O7AA 3SHBA 5B8DA 2A25A 2EA6A 2MD8C 1T1HA 1WEQA 3ZVZB 4K8UA 1JM7A 2XB1A 2G6QA 2H0DA 4GB0A 1Z60A 5FB1A 3FAOA 5E1TA 2KWOA 5TDRA 3LVQE 2JUNA 2D8SA 3ZPV1 1K2FA 3JUEA 3M62A 2CSVA 4YSIA 2F6JA 1WEPA 2IDAA 2M6MA 2LDRA 2M1RA 3HQMA 3QZVA 1WEMA 2YUCA 2MKEA 2YHOA 5LKXA 3N9LA 5TBNA 2C2LA 2KGIA 2LGGA 2CRRA 2PUYA 3C6WA 4B86C 2VPEA 2BAYA 3T9KA 2KKYA 1WIMA 5H1UA 2FSAA 4I7BA 2YQMA 2MA5A 5SVIB 3RTRB 3DDTA 2YSMA 2FUIA 2YYRA 4H9DA 4FIPA 1WE9A 2F6NA 1CA4A 2VJEB 2E6SA 4YATA 4YBMA 4V3KC 4YC9A 2DX8A 4WZ3B 4R8PK 3HQIA 4A4BA 2L7PA 4UP5A 4LK9A 3HU6A 1WEEA 1D01A 2F1XA 2KR4A 4MSXA 2YHNA 2KU3A 1V87A 1LB5A 3ZTGA 2FOPA 4ZUXU 2KREA 4LJNA 1X4JA 2EODA 2Y43A 2G45A 4YABA 1VYXA 5DINA 2I50A 2VNFA 5JG6A 4FJCA 1WEVA 4IC3A 1VFYA 4OGEA 2GKWA 2EGMA 1Z6UA 2QIZA 3T6RA 3MHSA 4QF2A 2LGVA 1MBMA
chains in the Genus database with same CATH topology
3L11A 2KFTA 2UZGA 3HCSA 4UP0A 4AVXA 2ZETC 4AYCB 2YT5A 1WILA 2FOOA 3N9PA 4R7EA 3ZNIA 2VPDA 1JM7B 4R2YA 4WZ0A 3I2DA 2H0DB 5G04B 1WESA 3PURA 5FB0A 1D0JA 1X4UA 2L0BA 5FERA 3SOWA 2EGPA 2LXPC 1CA9A 1L0AA 4YADA 4S3OC 5J3XA 4JJQA 5B78A 3HCTA 2YQLA 4GNFA 3RPGC 2YURA 5KH3A 4IC2A 2YW8A 5AIUA 1F62A 4I7CA 1CZZA 3IVQA 5LKTA 2NAAA 1XWHA 4WA6A 4F52B 5I3LA 2C2VS 2M85A 3M99A 1MM2A 2MA6A 2XEUA 4S3OB 2MIQA 4L7XA 5TDWA 1D0AA 1MM3A 3ZJBA 5DKAA 5D1MB 2MT5A 4LADB 3RPGB 1N87A 4N4FA 2L43A 3NG2A 4MVTA 2KIZA 3L1ZB 5B76A 4I7DA 4AP4A 3O35A 3KV5A 2RI7A 2JMIA 5B79A 4YBTA 2VPGA 2Y1MA 4Z8MA 4AUQB 4ZDTA 5TABA 1YZEA 5G05B 3C5KA 5H1TA 1Z2QA 4GWMA 1DVPA 4GNEA 2K1JA 4CA1A 5D1KB 2F42A 5KH9A 3LRQA 3MQSC 2KWNA 2CR2A 3HQLA 1FP0A 4GWNA 2MUMA 2VJFA 5D1LB 3LQIA 3IHPA 5LKUA 2Y1NA 3EB6A 5B77A 3DQVR 4XI1A 4O1VA 1HYJA 1VD4A 3O36A 4V3LC 4X3GA 2K17A 2OXQC 2K4DA 2ECWA 3O34A 3T7LA 3U5NA 5H1VA 1E4UA 2ECJA 1RF3A 2CSZA 3KQIA 1KZZA 4WZ2A 2MNZA 5C13A 2E6RA 3IVVA 3ASLA 1CZYA 3N9OA 4FK5A 2LN0A 2YREA 1HYIA 3VK6A 4YBSA 3O70A 4TKPB 1F3VB 4ZQLA 3V43A 5B75A 1WEUA 1CHCA 1ZBDB 3SOUA 4LLBA 4UI9B 2ECNA 4GHUA 2FOJA 4PTBA 4W4UA 3FL2A 3HTKC 4BHWA 2RSDA 5G0FA 4A4CA 2JRJA 4N3WA 4CCGX 2LXHC 2AN6A 2CT2A 3KV6A 2CKLA 4M4EA 5AITA 2HYED 4C9ZA 1QSCA 3O37A 3HQHA 2LV9A 4QF3A 1WFKA 1LDJB 2CSYA 4GNDA 2F1ZA 3ZPVE 4NN2A 2KWKA 4P5OB 5LKZA 2XXNA 2JMJA 1IYMA 2M3HA 3LQJA 4PPEA 2KYUA 3L1XA 4A0CD 2MD7B 2PNXA 1LB4A 4YAXA 4LKAA 1FBVA 2VJFB 5H9MA 1WEOA 3KNVA 2KE1A 5KH7A 3N9QA 2ECGA 3O33A 4Q6FA 1JOCA 5TRBA 3EB5A 3U5OA 1BORA 3HSVA 2KGGA 2F1YA 3PUQA 4BBQA 3N9MA 2QICA 2L5UA 2HDPA 3LQHA 2KWJA 5LCWB 3ZVYA 2LGLA 3PHDA 1ZMSA 1RMDA 2LGKA 2QJ0A 1YY6A 3ZYQA 2YSJA 2L80A 4GNGA 1WEWA 2YU4A 3M63A 4B7YC 2VJEA 4GJHA 3GL6A 2F1WA 3N9NA 3IVBA 2JMDA 2LQ6A 3U5MA 5C11A 1LB6A 4A49A 3GV4A 5EYAF 1WENA 1FLLA 2LRIC 2K16A 3MHHA 3U5PA 2CKLB 1U6GB 4L58A 2ECIA 4FO9A 1LDKC 1FLKA 1G25A 2ECTA 4O64A 2G43A 1D00A 1WGMA 2FUUA 3MQRA 4KG9A 3HCUA 2L75A 5FEYA 2MNYA 3DPLR 2VP7A 4AYCA 2VPBA 3SOXA 2ECVA 1X4IA 3O7AA 3SHBA 5B8DA 2A25A 2EA6A 2MD8C 1T1HA 1WEQA 3ZVZB 4K8UA 1JM7A 2XB1A 2G6QA 2H0DA 4GB0A 1Z60A 5FB1A 5E1TA 2KWOA 5TDRA 2D8SA 3ZPV1 1K2FA 3M62A 4YSIA 2F6JA 1WEPA 2IDAA 2M6MA 2LDRA 2M1RA 3HQMA 3QZVA 1WEMA 2YUCA 2YHOA 5LKXA 3N9LA 5TBNA 2C2LA 2KGIA 2LGGA 2PUYA 3C6WA 4B86C 2VPEA 2BAYA 1WIMA 5H1UA 2FSAA 4I7BA 2YQMA 2MA5A 3RTRB 2YSMA 2FUIA 2YYRA 4FIPA 1WE9A 2F6NA 1CA4A 2VJEB 2E6SA 4YATA 4YBMA 4V3KC 4YC9A 2DX8A 4WZ3B 4R8PK 3HQIA 4A4BA 4UP5A 4LK9A 3HU6A 1WEEA 1D01A 2F1XA 2KR4A 4MSXA 2YHNA 2KU3A 1V87A 1LB5A 3ZTGA 2FOPA 4ZUXU 2KREA 4LJNA 1X4JA 2EODA 2Y43A 2G45A 4YABA 1VYXA 5DINA 2I50A 2VNFA 5JG6A 4FJCA 1WEVA 4IC3A 1VFYA 2GKWA 2QIZA 1Z6UA 3T6RA 3MHSA 4QF2A 2LGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L11 A;  2KFT A;  2UZG A;  3HCS A;  4UP0 A;  4AVX A;  2ZET C;  4AYC B;  2YT5 A;  1WIL A;  2FOO A;  3N9P A;  4R7E A;  3ZNI A;  2VPD A;  1JM7 B;  4R2Y A;  4WZ0 A;  3I2D A;  2H0D B;  5G04 B;  1WES A;  3PUR A;  5FB0 A;  1D0J A;  1X4U A;  2L0B A;  5FER A;  3SOW A;  2EGP A;  2LXP C;  1CA9 A;  1L0A A;  4YAD A;  4S3O C;  5J3X A;  4JJQ A;  5B78 A;  3HCT A;  2YQL A;  4GNF A;  3RPG C;  2YUR A;  5KH3 A;  4IC2 A;  2YW8 A;  5AIU A;  1F62 A;  4I7C A;  1CZZ A;  3IVQ A;  5LKT A;  2NAA A;  1XWH A;  4WA6 A;  4F52 B;  5I3L A;  2C2V S;  2M85 A;  3M99 A;  1MM2 A;  2MA6 A;  2XEU A;  4S3O B;  2MIQ A;  4L7X A;  5TDW A;  1D0A A;  1MM3 A;  3ZJB A;  5DKA A;  5D1M B;  2MT5 A;  4LAD B;  3RPG B;  1N87 A;  4N4F A;  2L43 A;  3NG2 A;  4MVT A;  2KIZ A;  3L1Z B;  5B76 A;  4I7D A;  4AP4 A;  3O35 A;  3KV5 A;  2RI7 A;  2JMI A;  5B79 A;  4YBT A;  2VPG A;  2Y1M A;  4Z8M A;  4AUQ B;  4ZDT A;  5TAB A;  1YZE A;  5G05 B;  3C5K A;  5H1T A;  1Z2Q A;  4GWM A;  1DVP A;  4GNE A;  2K1J A;  4CA1 A;  5D1K B;  2F42 A;  5KH9 A;  3LRQ A;  3MQS C;  2KWN A;  2CR2 A;  3HQL A;  1FP0 A;  4GWN A;  2MUM A;  2VJF A;  5D1L B;  3LQI A;  3IHP A;  5LKU A;  2Y1N A;  3EB6 A;  5B77 A;  3DQV R;  4XI1 A;  4O1V A;  1HYJ A;  1VD4 A;  3O36 A;  4V3L C;  4X3G A;  2K17 A;  2OXQ C;  2K4D A;  2ECW A;  3O34 A;  3T7L A;  3U5N A;  5H1V A;  1E4U A;  2ECJ A;  1RF3 A;  2CSZ A;  3KQI A;  1KZZ A;  4WZ2 A;  2MNZ A;  5C13 A;  2E6R A;  3IVV A;  3ASL A;  1CZY A;  3N9O A;  4FK5 A;  2LN0 A;  2YRE A;  1HYI A;  3VK6 A;  4YBS A;  3O70 A;  4TKP B;  1F3V B;  4ZQL A;  3V43 A;  5B75 A;  1WEU A;  1CHC A;  1ZBD B;  3SOU A;  4LLB A;  4UI9 B;  2ECN A;  4GHU A;  2FOJ A;  4PTB A;  4W4U A;  3FL2 A;  3HTK C;  4BHW A;  2RSD A;  5G0F A;  4A4C A;  2JRJ A;  4N3W A;  4CCG X;  2LXH C;  2AN6 A;  2CT2 A;  3KV6 A;  2CKL A;  4M4E A;  5AIT A;  2HYE D;  4C9Z A;  1QSC A;  3O37 A;  3HQH A;  2LV9 A;  4QF3 A;  1WFK A;  1LDJ B;  2CSY A;  4GND A;  2F1Z A;  3ZPV E;  4NN2 A;  2KWK A;  4P5O B;  5LKZ A;  2XXN A;  2JMJ A;  1IYM A;  2M3H A;  3LQJ A;  4PPE A;  2KYU A;  3L1X A;  4A0C D;  2MD7 B;  2PNX A;  1LB4 A;  4YAX A;  4LKA A;  1FBV A;  2VJF B;  5H9M A;  1WEO A;  3KNV A;  2KE1 A;  5KH7 A;  3N9Q A;  2ECG A;  3O33 A;  4Q6F A;  1JOC A;  5TRB A;  3EB5 A;  3U5O A;  1BOR A;  3HSV A;  2KGG A;  2F1Y A;  3PUQ A;  4BBQ A;  3N9M A;  2QIC A;  2L5U A;  2HDP A;  3LQH A;  2KWJ A;  5LCW B;  3ZVY A;  2LGL A;  3PHD A;  1ZMS A;  1RMD A;  2LGK A;  2QJ0 A;  1YY6 A;  3ZYQ A;  2YSJ A;  2L80 A;  4GNG A;  1WEW A;  2YU4 A;  3M63 A;  4B7Y C;  2VJE A;  4GJH A;  3GL6 A;  2F1W A;  3N9N A;  3IVB A;  2JMD A;  2LQ6 A;  3U5M A;  5C11 A;  1LB6 A;  4A49 A;  3GV4 A;  5EYA F;  1WEN A;  1FLL A;  2LRI C;  2K16 A;  3MHH A;  3U5P A;  2CKL B;  1U6G B;  4L58 A;  2ECI A;  4FO9 A;  1LDK C;  1FLK A;  1G25 A;  2ECT A;  4O64 A;  2G43 A;  1D00 A;  1WGM A;  2FUU A;  3MQR A;  4KG9 A;  3HCU A;  2L75 A;  5FEY A;  2MNY A;  3DPL R;  2VP7 A;  4AYC A;  2VPB A;  3SOX A;  2ECV A;  1X4I A;  3O7A A;  3SHB A;  5B8D A;  2A25 A;  2EA6 A;  2MD8 C;  1T1H A;  1WEQ A;  3ZVZ B;  4K8U A;  1JM7 A;  2XB1 A;  2G6Q A;  2H0D A;  4GB0 A;  1Z60 A;  5FB1 A;  5E1T A;  2KWO A;  5TDR A;  2D8S A;  3ZPV 1;  1K2F A;  3M62 A;  4YSI A;  2F6J A;  1WEP A;  2IDA A;  2M6M A;  2LDR A;  2M1R A;  3HQM A;  3QZV A;  1WEM A;  2YUC A;  2YHO A;  5LKX A;  3N9L A;  5TBN A;  2C2L A;  2KGI A;  2LGG A;  2PUY A;  3C6W A;  4B86 C;  2VPE A;  2BAY A;  1WIM A;  5H1U A;  2FSA A;  4I7B A;  2YQM A;  2MA5 A;  3RTR B;  2YSM A;  2FUI A;  2YYR A;  4FIP A;  1WE9 A;  2F6N A;  1CA4 A;  2VJE B;  2E6S A;  4YAT A;  4YBM A;  4V3K C;  4YC9 A;  2DX8 A;  4WZ3 B;  4R8P K;  3HQI A;  4A4B A;  4UP5 A;  4LK9 A;  3HU6 A;  1WEE A;  1D01 A;  2F1X A;  2KR4 A;  4MSX A;  2YHN A;  2KU3 A;  1V87 A;  1LB5 A;  3ZTG A;  2FOP A;  4ZUX U;  2KRE A;  4LJN A;  1X4J A;  2EOD A;  2Y43 A;  2G45 A;  4YAB A;  1VYX A;  5DIN A;  2I50 A;  2VNF A;  5JG6 A;  4FJC A;  1WEV A;  4IC3 A;  1VFY A;  2GKW A;  2QIZ A;  1Z6U A;  3T6R A;  3MHS A;  4QF2 A;  2LGV A; 
#chains in the Genus database with same CATH topology
 3L11 A;  2KFT A;  3LDY A;  2UZG A;  3HCS A;  3PLW A;  4UP0 A;  4AVX A;  2ZET C;  4AYC B;  2YT5 A;  1WIL A;  2FOO A;  3N9P A;  4R7E A;  3ZNI A;  2VPD A;  2M13 A;  3KDE C;  2B0O E;  4R2Y A;  4WZ0 A;  1JM7 B;  3I2D A;  2H0D B;  5K3Q A;  5G04 B;  1WES A;  3PUR A;  5FB0 A;  1D0J A;  1X4U A;  2L0B A;  5FER A;  3SOW A;  2EGP A;  2LXP C;  1CA9 A;  1L0A A;  4YAD A;  4S3O C;  5J3X A;  4JJQ A;  3MDB C;  5B78 A;  3HCT A;  2YQL A;  4GNF A;  3RPG C;  2YUR A;  5KH3 A;  4IC2 A;  2YW8 A;  5AIU A;  1F62 A;  2XOY A;  4I7C A;  1CZZ A;  3IVQ A;  2CRW A;  5LKT A;  2NAA A;  1XWH A;  4WA6 A;  3FEH A;  4F52 B;  2KKX A;  5I3L A;  2IQJ A;  2C2V S;  2M85 A;  3M99 A;  1MM2 A;  2MA6 A;  2XEU A;  4S3O B;  2MIQ A;  4L7X A;  5TDW A;  1D0A A;  1MM3 A;  3ZJB A;  5DKA A;  5D1M B;  2JM3 A;  2MT5 A;  4LAD B;  3RPG B;  1N87 A;  4N4F A;  2L43 A;  3NG2 A;  4MVT A;  2KIZ A;  3L1Z B;  5B76 A;  4I7D A;  4AP4 A;  3O35 A;  3KV5 A;  2RI7 A;  2JMI A;  5B79 A;  4YBT A;  2VPG A;  2Y1M A;  4Z8M A;  4AUQ B;  4ZDT A;  5TAB A;  1YZE A;  5G05 B;  3C5K A;  2P57 A;  5H1T A;  3FJU B;  1Z2Q A;  2E61 A;  2OWA A;  4GWM A;  1DVP A;  2DSM A;  2K1J A;  4CA1 A;  4GNE A;  5D1K B;  2F42 A;  5KH9 A;  3LRQ A;  3MQS C;  2KWN A;  2CR2 A;  3HQL A;  2FD4 A;  1FP0 A;  4GWN A;  2MUM A;  2VJF A;  4Z0O A;  5D1L B;  3LQI A;  3IHP A;  5LKU A;  5SVI A;  2Y1N A;  3EB6 A;  5B77 A;  3DQV R;  2EXU A;  3LVR E;  4XI1 A;  4O1V A;  4OGC A;  1HYJ A;  1VD4 A;  3O36 A;  4V3L C;  4X3G A;  2K17 A;  2OXQ C;  2K4D A;  4QQ4 A;  2ECW A;  3O34 A;  3T7L A;  3U5N A;  5H1V A;  1E4U A;  4F1P A;  2ECJ A;  1RF3 A;  2CSZ A;  3KQI A;  1KZZ A;  2CON A;  2MNZ A;  3FM8 C;  4WZ2 A;  5C13 A;  2E6R A;  3IVV A;  3ASL A;  1CZY A;  3N9O A;  4FK5 A;  2LN0 A;  2RR4 A;  2YRE A;  3O47 A;  1HYI A;  3VK6 A;  2XOZ A;  4YBS A;  3LJU X;  3O70 A;  4TKP B;  1F3V B;  2YVR A;  4ZQL A;  3V43 A;  5B75 A;  1WEU A;  1CHC A;  1ZBD B;  3SOU A;  4LLB A;  3H7H A;  4UI9 B;  2ECN A;  4GHU A;  2FOJ A;  4PTB A;  4W4U A;  3FL2 A;  3HTK C;  4BHW A;  3M7K A;  4O62 A;  2RSD A;  5G0F A;  4A4C A;  2JRJ A;  4N3W A;  4CCG X;  2LXH C;  2AN6 A;  2CT2 A;  3KV6 A;  2CKL A;  4M4E A;  5AIT A;  5SVY A;  2HYE D;  4C9Z A;  1QSC A;  3O37 A;  3HQH A;  2LV9 A;  4QF3 A;  1WFK A;  1LDJ B;  2CSY A;  4GND A;  2DJA A;  2F1Z A;  3ZPV E;  2XOC A;  4NN2 A;  2KWK A;  4P5O B;  5LKZ A;  2XXN A;  5SVX A;  2JMJ A;  1IYM A;  2M3H A;  3LQJ A;  4PPE A;  2KYU A;  3L1X A;  4A0C D;  2MD7 B;  2PNX A;  1LB4 A;  2LAU A;  4YAX A;  4LKA A;  1FBV A;  2VJF B;  5H9M A;  1WEO A;  3KNV A;  2KE1 A;  5KH7 A;  2XP0 A;  3N9Q A;  3E2D A;  2ECG A;  3O33 A;  4Q6F A;  1JOC A;  5TRB A;  3EB5 A;  3U5O A;  1BOR A;  3HSV A;  3DWD A;  2KGG A;  2F1Y A;  3PUQ A;  4BBQ A;  3N9M A;  2QIC A;  3FAN A;  2L5U A;  2HDP A;  3LQH A;  2KWJ A;  5LCW B;  3ZVY A;  2LGL A;  3PHD A;  1ZMS A;  1RMD A;  2LGK A;  2QJ0 A;  1YY6 A;  3ZYQ A;  2YSJ A;  2L80 A;  4GNG A;  1WEW A;  2YU4 A;  3M63 A;  4B7Y C;  2VJE A;  3Q1D A;  4GJH A;  3GL6 A;  4Z0R A;  2F1W A;  3N9N A;  3SUB A;  3IVB A;  2JMD A;  2LQ6 A;  3U5M A;  2D8U A;  5C11 A;  1LB6 A;  4A49 A;  3GV4 A;  5EYA F;  1WEN A;  1FLL A;  2LRI C;  2K16 A;  3MHH A;  3U5P A;  2CKL B;  1DCQ A;  1U6G B;  4L58 A;  2ECI A;  4FO9 A;  1LDK C;  1FLK A;  1G25 A;  2ECT A;  4O64 A;  2G43 A;  1D00 A;  1WGM A;  2FUU A;  3MQR A;  4KG9 A;  3HCU A;  2L75 A;  5FEY A;  2MNY A;  3DPL R;  2VP7 A;  4AYC A;  2VPB A;  3SOX A;  2ECV A;  1X4I A;  2FFW A;  3O7A A;  3SHB A;  5B8D A;  2A25 A;  2EA6 A;  2MD8 C;  1T1H A;  1WEQ A;  3ZVZ B;  4K8U A;  1JM7 A;  2XB1 A;  2G6Q A;  2H0D A;  4GB0 A;  1Z60 A;  5FB1 A;  3FAO A;  5E1T A;  2KWO A;  5TDR A;  3LVQ E;  2JUN A;  2D8S A;  3ZPV 1;  1K2F A;  3JUE A;  3M62 A;  2CSV A;  4YSI A;  2F6J A;  1WEP A;  2IDA A;  2M6M A;  2LDR A;  2M1R A;  3HQM A;  3QZV A;  1WEM A;  2YUC A;  2MKE A;  2YHO A;  5LKX A;  3N9L A;  5TBN A;  2C2L A;  2KGI A;  2LGG A;  2CRR A;  2PUY A;  3C6W A;  4B86 C;  2VPE A;  2BAY A;  3T9K A;  2KKY A;  1WIM A;  5H1U A;  2FSA A;  4I7B A;  2YQM A;  2MA5 A;  5SVI B;  3RTR B;  3DDT A;  2YSM A;  2FUI A;  2YYR A;  4H9D A;  4FIP A;  1WE9 A;  2F6N A;  1CA4 A;  2VJE B;  2E6S A;  4YAT A;  4YBM A;  4V3K C;  4YC9 A;  2DX8 A;  4WZ3 B;  4R8P K;  3HQI A;  4A4B A;  2L7P A;  4UP5 A;  4LK9 A;  3HU6 A;  1WEE A;  1D01 A;  2F1X A;  2KR4 A;  4MSX A;  2YHN A;  2KU3 A;  1V87 A;  1LB5 A;  3ZTG A;  2FOP A;  4ZUX U;  2KRE A;  4LJN A;  1X4J A;  2EOD A;  2Y43 A;  2G45 A;  4YAB A;  1VYX A;  5DIN A;  2I50 A;  2VNF A;  5JG6 A;  4FJC A;  1WEV A;  4IC3 A;  1VFY A;  4OGE A;  2GKW A;  2EGM A;  1Z6U A;  2QIZ A;  3T6R A;  3MHS A;  4QF2 A;  2LGV A;  1MBM A; 
#chains in the Genus database with same CATH homology
 3L11 A;  2KFT A;  2UZG A;  3HCS A;  4UP0 A;  4AVX A;  2ZET C;  4AYC B;  2YT5 A;  1WIL A;  2FOO A;  3N9P A;  4R7E A;  3ZNI A;  2VPD A;  1JM7 B;  4R2Y A;  4WZ0 A;  3I2D A;  2H0D B;  5G04 B;  1WES A;  3PUR A;  5FB0 A;  1D0J A;  1X4U A;  2L0B A;  5FER A;  3SOW A;  2EGP A;  2LXP C;  1CA9 A;  1L0A A;  4YAD A;  4S3O C;  5J3X A;  4JJQ A;  5B78 A;  3HCT A;  2YQL A;  4GNF A;  3RPG C;  2YUR A;  5KH3 A;  4IC2 A;  2YW8 A;  5AIU A;  1F62 A;  4I7C A;  1CZZ A;  3IVQ A;  5LKT A;  2NAA A;  1XWH A;  4WA6 A;  4F52 B;  5I3L A;  2C2V S;  2M85 A;  3M99 A;  1MM2 A;  2MA6 A;  2XEU A;  4S3O B;  2MIQ A;  4L7X A;  5TDW A;  1D0A A;  1MM3 A;  3ZJB A;  5DKA A;  5D1M B;  2MT5 A;  4LAD B;  3RPG B;  1N87 A;  4N4F A;  2L43 A;  3NG2 A;  4MVT A;  2KIZ A;  3L1Z B;  5B76 A;  4I7D A;  4AP4 A;  3O35 A;  3KV5 A;  2RI7 A;  2JMI A;  5B79 A;  4YBT A;  2VPG A;  2Y1M A;  4Z8M A;  4AUQ B;  4ZDT A;  5TAB A;  1YZE A;  5G05 B;  3C5K A;  5H1T A;  1Z2Q A;  4GWM A;  1DVP A;  4GNE A;  2K1J A;  4CA1 A;  5D1K B;  2F42 A;  5KH9 A;  3LRQ A;  3MQS C;  2KWN A;  2CR2 A;  3HQL A;  1FP0 A;  4GWN A;  2MUM A;  2VJF A;  5D1L B;  3LQI A;  3IHP A;  5LKU A;  2Y1N A;  3EB6 A;  5B77 A;  3DQV R;  4XI1 A;  4O1V A;  1HYJ A;  1VD4 A;  3O36 A;  4V3L C;  4X3G A;  2K17 A;  2OXQ C;  2K4D A;  2ECW A;  3O34 A;  3T7L A;  3U5N A;  5H1V A;  1E4U A;  2ECJ A;  1RF3 A;  2CSZ A;  3KQI A;  1KZZ A;  4WZ2 A;  2MNZ A;  5C13 A;  2E6R A;  3IVV A;  3ASL A;  1CZY A;  3N9O A;  4FK5 A;  2LN0 A;  2YRE A;  1HYI A;  3VK6 A;  4YBS A;  3O70 A;  4TKP B;  1F3V B;  4ZQL A;  3V43 A;  5B75 A;  1WEU A;  1CHC A;  1ZBD B;  3SOU A;  4LLB A;  4UI9 B;  2ECN A;  4GHU A;  2FOJ A;  4PTB A;  4W4U A;  3FL2 A;  3HTK C;  4BHW A;  2RSD A;  5G0F A;  4A4C A;  2JRJ A;  4N3W A;  4CCG X;  2LXH C;  2AN6 A;  2CT2 A;  3KV6 A;  2CKL A;  4M4E A;  5AIT A;  2HYE D;  4C9Z A;  1QSC A;  3O37 A;  3HQH A;  2LV9 A;  4QF3 A;  1WFK A;  1LDJ B;  2CSY A;  4GND A;  2F1Z A;  3ZPV E;  4NN2 A;  2KWK A;  4P5O B;  5LKZ A;  2XXN A;  2JMJ A;  1IYM A;  2M3H A;  3LQJ A;  4PPE A;  2KYU A;  3L1X A;  4A0C D;  2MD7 B;  2PNX A;  1LB4 A;  4YAX A;  4LKA A;  1FBV A;  2VJF B;  5H9M A;  1WEO A;  3KNV A;  2KE1 A;  5KH7 A;  3N9Q A;  2ECG A;  3O33 A;  4Q6F A;  1JOC A;  5TRB A;  3EB5 A;  3U5O A;  1BOR A;  3HSV A;  2KGG A;  2F1Y A;  3PUQ A;  4BBQ A;  3N9M A;  2QIC A;  2L5U A;  2HDP A;  3LQH A;  2KWJ A;  5LCW B;  3ZVY A;  2LGL A;  3PHD A;  1ZMS A;  1RMD A;  2LGK A;  2QJ0 A;  1YY6 A;  3ZYQ A;  2YSJ A;  2L80 A;  4GNG A;  1WEW A;  2YU4 A;  3M63 A;  4B7Y C;  2VJE A;  4GJH A;  3GL6 A;  2F1W A;  3N9N A;  3IVB A;  2JMD A;  2LQ6 A;  3U5M A;  5C11 A;  1LB6 A;  4A49 A;  3GV4 A;  5EYA F;  1WEN A;  1FLL A;  2LRI C;  2K16 A;  3MHH A;  3U5P A;  2CKL B;  1U6G B;  4L58 A;  2ECI A;  4FO9 A;  1LDK C;  1FLK A;  1G25 A;  2ECT A;  4O64 A;  2G43 A;  1D00 A;  1WGM A;  2FUU A;  3MQR A;  4KG9 A;  3HCU A;  2L75 A;  5FEY A;  2MNY A;  3DPL R;  2VP7 A;  4AYC A;  2VPB A;  3SOX A;  2ECV A;  1X4I A;  3O7A A;  3SHB A;  5B8D A;  2A25 A;  2EA6 A;  2MD8 C;  1T1H A;  1WEQ A;  3ZVZ B;  4K8U A;  1JM7 A;  2XB1 A;  2G6Q A;  2H0D A;  4GB0 A;  1Z60 A;  5FB1 A;  5E1T A;  2KWO A;  5TDR A;  2D8S A;  3ZPV 1;  1K2F A;  3M62 A;  4YSI A;  2F6J A;  1WEP A;  2IDA A;  2M6M A;  2LDR A;  2M1R A;  3HQM A;  3QZV A;  1WEM A;  2YUC A;  2YHO A;  5LKX A;  3N9L A;  5TBN A;  2C2L A;  2KGI A;  2LGG A;  2PUY A;  3C6W A;  4B86 C;  2VPE A;  2BAY A;  1WIM A;  5H1U A;  2FSA A;  4I7B A;  2YQM A;  2MA5 A;  3RTR B;  2YSM A;  2FUI A;  2YYR A;  4FIP A;  1WE9 A;  2F6N A;  1CA4 A;  2VJE B;  2E6S A;  4YAT A;  4YBM A;  4V3K C;  4YC9 A;  2DX8 A;  4WZ3 B;  4R8P K;  3HQI A;  4A4B A;  4UP5 A;  4LK9 A;  3HU6 A;  1WEE A;  1D01 A;  2F1X A;  2KR4 A;  4MSX A;  2YHN A;  2KU3 A;  1V87 A;  1LB5 A;  3ZTG A;  2FOP A;  4ZUX U;  2KRE A;  4LJN A;  1X4J A;  2EOD A;  2Y43 A;  2G45 A;  4YAB A;  1VYX A;  5DIN A;  2I50 A;  2VNF A;  5JG6 A;  4FJC A;  1WEV A;  4IC3 A;  1VFY A;  2GKW A;  2QIZ A;  1Z6U A;  3T6R A;  3MHS A;  4QF2 A;  2LGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...