4I7DA

Siah1 bound to synthetic peptide (ace)klrpvamvrp(prk)vr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
187
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords E3 ubiquitin-protein ligase SIAH1
total genus 45
structure length 187
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7dA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7dA01
3N9NA 5AIUA 1HYIA 4MVTA 3ZPV1 2OXQC 1D0JA 2LGLA 2EODA 4V3KC 5TABA 1Z6UA 2K16A 2CSYA 3O36A 2F1XA 4S3OB 4PPEA 2ECJA 2VPEA 3O7AA 4Z8MA 1XWHA 2Y1NA 3M63A 5B78A 2VJEA 2FUIA 3O37A 4YAXA 4ZDTA 4FJCA 3MQRA 3ZVZB 4ZUXU 4L7XA 2MT5A 2A25A 4XI1A 4NN2A 2PNXA 2YQLA 2UZGA 2YU4A 3IVVA 5KH3A 4LLBA 2M1RA 2MA6A 5G0FA 4B86C 4LK9A 2PUYA 4N4FA 2MD7B 1L0AA 2MD8C 1VYXA 4I7CA 4WZ2A 4YBSA 4LJNA 3N9LA 2YHOA 3U5OA 1X4UA 5DINA 3RPGC 2FOJA 1ZMSA 4GHUA 4X3GA 1WEQA 2YT5A 4YATA 4BBQA 5LCWB 5G04B 2YUCA 5FB0A 2FOOA 2VPDA 5I3LA 3DQVR 4AYCB 3HQHA 4F52B 2CR2A 4YBTA 1WEOA 2ECGA 2LGVA 2XEUA 5FB1A 2YREA 4W4UA 1WEEA 2HDPA 2KGIA 2EA6A 2F42A 2IDAA 4AVXA 2JMIA 4GJHA 1WIMA 4Q6FA 4WZ3B 3KV5A 4R8PK 3KNVA 1CZZA 3LQIA 3RPGB 5TDRA 3VK6A 1MM2A 4GNFA 2JMDA 1CZYA 2MA5A 4M4EA 1JM7A 2LRIC 1DVPA 3FL2A 3DPLR 1T1HA 2I50A 2VJFA 4FK5A 2RI7A 1WILA 2LGKA 3I2DA 5G05B 2M6MA 4A0CD 2KWOA 2RSDA 5D1LB 5KH9A 3C5KA 3HCUA 2CKLA 2K4DA 2F6NA 4R2YA 1F62A 2LGGA 2KU3A 4WA6A 1WEPA 2CSZA 4UP0A 1V87A 2YSMA 3O35A 1QSCA 4GWNA 2L43A 4YC9A 1G25A 3KV6A 3EB5A 4UP5A 3LQJA 2H0DB 4QF2A 2ECIA 3HTKC 2VNFA 2MUMA 3HQIA 1D01A 1WESA 2JRJA 2XXNA 5EYAF 5B8DA 2K1JA 1LDJB 4IC2A 4P5OB 3LRQA 5C13A 4ZQLA 4YBMA 2AN6A 3RTRB 3GV4A 2KGGA 5H9MA 2VP7A 4GNDA 3ZTGA 3L1ZB 2ECTA 2YYRA 2DX8A 3IVBA 1N87A 4CCGX 3L11A 2Y43A 1WEVA 3C6WA 1WEWA 5H1VA 3HQMA 2QJ0A 1WEUA 2MNZA 3EB6A 4A4CA 5TDWA 5AITA 4YABA 3O34A 2LN0A 2F1YA 3MHHA 4UI9B 4GNGA 5H1UA 2VPGA 2KIZA 2KFTA 2F1ZA 3NG2A 1WE9A 2XB1A 5B77A 2KWJA 2ECNA 2KWKA 3ZVYA 3HU6A 4YADA 4B7YC 3N9PA 2BAYA 1FBVA 2CT2A 2ECWA 4BHWA 3HCSA 3N9QA 4AUQB 3O33A 3SOWA 3ZYQA 4MSXA 2LQ6A 2KYUA 3N9MA 5FEYA 3U5NA 3QZVA 2K17A 2L5UA 2E6RA 4C9ZA 1FLKA 2KR4A 2HYED 2ECVA 2CKLB 2YQMA 3M99A 2MIQA 4V3LC 1FLLA 3M62A 2C2VS 3PHDA 4LKAA 1Z60A 1Z2QA 3U5MA 5LKXA 1WFKA 2F1WA 2C2LA 5LKZA 3LQHA 1LDKC 3HCTA 1VFYA 3MQSC 4QF3A 2QIZA 3HQLA 2KE1A 2M3HA 5DKAA 3T6RA 2YHNA 4I7BA 1E4UA 1WEMA 4WZ0A 1MM3A 5D1MB 4I7DA 4GWMA 2M85A 2G6QA 4L58A 1LB4A 5KH7A 1FP0A 4GNEA 2G45A 3ZPVE 3HSVA 2D8SA 1RF3A 1D00A 2G43A 3PURA 5J3XA 1HYJA 4PTBA 1CA4A 1JOCA 1D0AA 1U6GB 2FOPA 1LB6A 5B76A 2E6SA 3N9OA 1LB5A 5TRBA 1YY6A 1KZZA 1WENA 3ASLA 4A49A 5JG6A 4R7EA 3KQIA 4KG9A 2FUUA 4O64A 3ZJBA 1ZBDB 2L0BA 5B79A 5E1TA 1X4JA 3IVQA 3SOUA 2QICA 3SOXA 2F6JA 2KWNA 3ZNIA 1YZEA 3IHPA 3PUQA 4K8UA 5LKUA 1WGMA 4FO9A 4GB0A 3MHSA 2H0DA 4LADB 1RMDA 2LXPC 5TBNA 5H1TA 4AP4A 1CA9A 4AYCA 2YW8A 4IC3A 2Y1MA 1BORA 5B75A 3U5PA 3T7LA 4S3OC 1CHCA 4JJQA 1X4IA 2YURA 3SHBA 3O70A 2VPBA 5D1KB 2MNYA 2LV9A 5FERA 4O1VA 2LXHC 2EGPA 1VD4A 2NAAA 4TKPB 3V43A 3GL6A 3L1XA 2GKWA 1F3VB 4YSIA 2ZETC 2YSJA 2VJEB 2LDRA 2FSAA 2L80A 1IYMA 5LKTA 4N3WA 2VJFB 4CA1A 1K2FA 5C11A 2KREA 4A4BA 2L75A 1JM7B 4FIPA 2JMJA
chains in the Genus database with same CATH superfamily
2CSVA 3N9NA 5AIUA 1HYIA 4MVTA 5SVYA 3ZPV1 2OXQC 1D0JA 2LGLA 2EODA 4V3KC 5TABA 1Z6UA 5SVIA 2K16A 2CSYA 3O36A 2F1XA 2EXUA 4S3OB 4PPEA 2ECJA 2VPEA 3LDYA 3O7AA 4Z8MA 2EGMA 1XWHA 2Y1NA 3M63A 3FM8C 5B78A 2VJEA 2FUIA 2L7PA 3O37A 4YAXA 4ZDTA 3FJUB 4FJCA 3MQRA 3ZVZB 4ZUXU 4L7XA 2MT5A 2A25A 4XI1A 2P57A 4NN2A 2PNXA 4H9DA 2YQLA 2UZGA 2YU4A 3IVVA 5KH3A 4LLBA 2M1RA 2MA6A 5G0FA 4B86C 4LK9A 2PUYA 4N4FA 2MD7B 1L0AA 2MD8C 1VYXA 4I7CA 4WZ2A 4Z0OA 4YBSA 2FD4A 4LJNA 3N9LA 2YHOA 3U5OA 1X4UA 5DINA 3RPGC 2FOJA 1ZMSA 4GHUA 4X3GA 1WEQA 2YT5A 4YATA 4BBQA 5LCWB 5G04B 2YUCA 5FB0A 2FOOA 2VPDA 5I3LA 3DQVR 4AYCB 3HQHA 4F52B 2CR2A 4YBTA 1WEOA 2ECGA 2LGVA 2XEUA 2YREA 5FB1A 4W4UA 1WEEA 2HDPA 2KGIA 2EA6A 2F42A 2IDAA 2CONA 4O62A 2JMIA 4AVXA 4GJHA 1WIMA 4Q6FA 3MDBC 2KKYA 4WZ3B 3KV5A 4R8PK 3KNVA 2OWAA 1CZZA 3LQIA 3RPGB 5TDRA 3VK6A 1MM2A 4GNFA 2JMDA 1CZYA 2MA5A 4M4EA 3LJUX 1JM7A 2LRIC 1DVPA 2KKXA 3FL2A 3DPLR 1T1HA 2JM3A 2I50A 2VJFA 4FK5A 2RI7A 1WILA 2LGKA 2XOZA 3I2DA 5G05B 2M6MA 4A0CD 2KWOA 2RSDA 5D1LB 2XP0A 5KH9A 3C5KA 3HCUA 2CKLA 2K4DA 2F6NA 4R2YA 2XOCA 1F62A 2LGGA 2KU3A 4WA6A 1WEPA 2CSZA 4UP0A 1V87A 2LAUA 2YSMA 3O35A 1QSCA 4GWNA 2L43A 4YC9A 1G25A 3KV6A 3EB5A 2M13A 4UP5A 3LQJA 2H0DB 4QF2A 1MBMA 2ECIA 3HTKC 2VNFA 2MUMA 3HQIA 2E61A 1D01A 1WESA 2JRJA 2XXNA 5EYAF 5B8DA 2K1JA 1LDJB 4IC2A 4P5OB 3LRQA 5C13A 4ZQLA 1DCQA 4YBMA 2AN6A 3RTRB 3GV4A 2KGGA 5H9MA 2VP7A 4GNDA 3ZTGA 3L1ZB 2D8UA 2ECTA 2YYRA 2DX8A 3IVBA 1N87A 4CCGX 3L11A 2Y43A 3LVQE 1WEVA 5SVXA 3C6WA 1WEWA 5H1VA 3HQMA 2QJ0A 1WEUA 3FAOA 2MNZA 3EB6A 4A4CA 5TDWA 5AITA 4YABA 3T9KA 3O34A 2LN0A 2F1YA 3MHHA 4UI9B 4GNGA 5H1UA 2VPGA 2KIZA 2KFTA 2F1ZA 3NG2A 1WE9A 2XB1A 5B77A 3PLWA 2KWJA 2ECNA 2KWKA 3ZVYA 3E2DA 3HU6A 4YADA 4B7YC 3N9PA 5K3QA 2BAYA 3O47A 2DSMA 1FBVA 2CT2A 2ECWA 4BHWA 3HCSA 3N9QA 4AUQB 3O33A 3SOWA 3ZYQA 5SVIB 4MSXA 2LQ6A 2KYUA 3N9MA 2CRRA 5FEYA 3U5NA 3QZVA 2K17A 2L5UA 2E6RA 4C9ZA 1FLKA 2KR4A 2HYED 2ECVA 2CKLB 2YQMA 2XOYA 3M99A 2JUNA 2MIQA 3LVRE 4V3LC 1FLLA 3M62A 2C2VS 3PHDA 4LKAA 1Z60A 1Z2QA 2CRWA 3U5MA 5LKXA 1WFKA 2F1WA 2C2LA 5LKZA 3LQHA 1LDKC 3HCTA 1VFYA 4Z0RA 3MQSC 4QF3A 4F1PA 2QIZA 3HQLA 2KE1A 2M3HA 5DKAA 3T6RA 2IQJA 2YHNA 4I7BA 1E4UA 3H7HA 1WEMA 4WZ0A 1MM3A 2FFWA 5D1MB 4I7DA 4GWMA 2M85A 2G6QA 4L58A 1LB4A 5KH7A 1FP0A 2YVRA 2B0OE 4GNEA 2G45A 3ZPVE 3HSVA 3JUEA 2D8SA 1RF3A 1D00A 2G43A 3SUBA 2DJAA 3PURA 5J3XA 1HYJA 4PTBA 4OGEA 2RR4A 1CA4A 1JOCA 1D0AA 1U6GB 2FOPA 1LB6A 5B76A 2E6SA 3N9OA 3FANA 1LB5A 5TRBA 1YY6A 1KZZA 1WENA 3KDEC 3ASLA 4A49A 5JG6A 4R7EA 3KQIA 4KG9A 2FUUA 4O64A 3ZJBA 1ZBDB 2L0BA 3Q1DA 3DWDA 5B79A 5E1TA 1X4JA 3IVQA 3SOUA 2QICA 3SOXA 2F6JA 2KWNA 3ZNIA 1YZEA 3IHPA 4QQ4A 3PUQA 4K8UA 5LKUA 1WGMA 4FO9A 4GB0A 3MHSA 2H0DA 4LADB 1RMDA 2LXPC 5TBNA 5H1TA 4AP4A 1CA9A 4AYCA 3DDTA 2YW8A 4IC3A 4OGCA 2Y1MA 1BORA 5B75A 3U5PA 3T7LA 4S3OC 1CHCA 4JJQA 1X4IA 2YURA 3SHBA 3O70A 2VPBA 5D1KB 2MNYA 2LV9A 5FERA 4O1VA 2MKEA 2LXHC 2EGPA 1VD4A 2NAAA 3FEHA 4TKPB 3V43A 3GL6A 3L1XA 2GKWA 1F3VB 4YSIA 2ZETC 2YSJA 2VJEB 2LDRA 3M7KA 2FSAA 2L80A 1IYMA 5LKTA 4N3WA 2VJFB 4CA1A 1K2FA 5C11A 2KREA 4A4BA 2L75A 1JM7B 4FIPA 2JMJA
chains in the Genus database with same CATH topology
3N9NA 5AIUA 1HYIA 4MVTA 3ZPV1 2OXQC 1D0JA 2LGLA 2EODA 4V3KC 5TABA 1Z6UA 2K16A 2CSYA 3O36A 2F1XA 4S3OB 4PPEA 2ECJA 2VPEA 3O7AA 4Z8MA 1XWHA 2Y1NA 3M63A 5B78A 2VJEA 2FUIA 3O37A 4YAXA 4ZDTA 4FJCA 3MQRA 3ZVZB 4ZUXU 4L7XA 2MT5A 2A25A 4XI1A 4NN2A 2PNXA 2YQLA 2UZGA 2YU4A 3IVVA 5KH3A 4LLBA 2M1RA 2MA6A 5G0FA 4B86C 4LK9A 2PUYA 4N4FA 2MD7B 1L0AA 2MD8C 1VYXA 4I7CA 4WZ2A 4YBSA 4LJNA 3N9LA 2YHOA 3U5OA 1X4UA 5DINA 3RPGC 2FOJA 1ZMSA 4GHUA 4X3GA 1WEQA 2YT5A 4YATA 4BBQA 5LCWB 5G04B 2YUCA 5FB0A 2FOOA 2VPDA 5I3LA 3DQVR 4AYCB 3HQHA 4F52B 2CR2A 4YBTA 1WEOA 2ECGA 2LGVA 2XEUA 5FB1A 2YREA 4W4UA 1WEEA 2HDPA 2KGIA 2EA6A 2F42A 2IDAA 4AVXA 2JMIA 4GJHA 1WIMA 4Q6FA 4WZ3B 3KV5A 4R8PK 3KNVA 1CZZA 3LQIA 3RPGB 5TDRA 3VK6A 1MM2A 4GNFA 2JMDA 1CZYA 2MA5A 4M4EA 1JM7A 2LRIC 1DVPA 3FL2A 3DPLR 1T1HA 2I50A 2VJFA 4FK5A 2RI7A 1WILA 2LGKA 3I2DA 5G05B 2M6MA 4A0CD 2KWOA 2RSDA 5D1LB 5KH9A 3C5KA 3HCUA 2CKLA 2K4DA 2F6NA 4R2YA 1F62A 2LGGA 2KU3A 4WA6A 1WEPA 2CSZA 4UP0A 1V87A 2YSMA 3O35A 1QSCA 4GWNA 2L43A 4YC9A 1G25A 3KV6A 3EB5A 4UP5A 3LQJA 2H0DB 4QF2A 2ECIA 3HTKC 2VNFA 2MUMA 3HQIA 1D01A 1WESA 2JRJA 2XXNA 5EYAF 5B8DA 2K1JA 1LDJB 4IC2A 4P5OB 3LRQA 5C13A 4ZQLA 4YBMA 2AN6A 3RTRB 3GV4A 2KGGA 5H9MA 2VP7A 4GNDA 3ZTGA 3L1ZB 2ECTA 2YYRA 2DX8A 3IVBA 1N87A 4CCGX 3L11A 2Y43A 1WEVA 3C6WA 1WEWA 5H1VA 3HQMA 2QJ0A 1WEUA 2MNZA 3EB6A 4A4CA 5TDWA 5AITA 4YABA 3O34A 2LN0A 2F1YA 3MHHA 4UI9B 4GNGA 5H1UA 2VPGA 2KIZA 2KFTA 2F1ZA 3NG2A 1WE9A 2XB1A 5B77A 2KWJA 2ECNA 2KWKA 3ZVYA 3HU6A 4YADA 4B7YC 3N9PA 2BAYA 1FBVA 2CT2A 2ECWA 4BHWA 3HCSA 3N9QA 4AUQB 3O33A 3SOWA 3ZYQA 4MSXA 2LQ6A 2KYUA 3N9MA 5FEYA 3U5NA 3QZVA 2K17A 2L5UA 2E6RA 4C9ZA 1FLKA 2KR4A 2HYED 2ECVA 2CKLB 2YQMA 3M99A 2MIQA 4V3LC 1FLLA 3M62A 2C2VS 3PHDA 4LKAA 1Z60A 1Z2QA 3U5MA 5LKXA 1WFKA 2F1WA 2C2LA 5LKZA 3LQHA 1LDKC 3HCTA 1VFYA 3MQSC 4QF3A 2QIZA 3HQLA 2KE1A 2M3HA 5DKAA 3T6RA 2YHNA 4I7BA 1E4UA 1WEMA 4WZ0A 1MM3A 5D1MB 4I7DA 4GWMA 2M85A 2G6QA 4L58A 1LB4A 5KH7A 1FP0A 4GNEA 2G45A 3ZPVE 3HSVA 2D8SA 1RF3A 1D00A 2G43A 3PURA 5J3XA 1HYJA 4PTBA 1CA4A 1JOCA 1D0AA 1U6GB 2FOPA 1LB6A 5B76A 2E6SA 3N9OA 1LB5A 5TRBA 1YY6A 1KZZA 1WENA 3ASLA 4A49A 5JG6A 4R7EA 3KQIA 4KG9A 2FUUA 4O64A 3ZJBA 1ZBDB 2L0BA 5B79A 5E1TA 1X4JA 3IVQA 3SOUA 2QICA 3SOXA 2F6JA 2KWNA 3ZNIA 1YZEA 3IHPA 3PUQA 4K8UA 5LKUA 1WGMA 4FO9A 4GB0A 3MHSA 2H0DA 4LADB 1RMDA 2LXPC 5TBNA 5H1TA 4AP4A 1CA9A 4AYCA 2YW8A 4IC3A 2Y1MA 1BORA 5B75A 3U5PA 3T7LA 4S3OC 1CHCA 4JJQA 1X4IA 2YURA 3SHBA 3O70A 2VPBA 5D1KB 2MNYA 2LV9A 5FERA 4O1VA 2LXHC 2EGPA 1VD4A 2NAAA 4TKPB 3V43A 3GL6A 3L1XA 2GKWA 1F3VB 4YSIA 2ZETC 2YSJA 2VJEB 2LDRA 2FSAA 2L80A 1IYMA 5LKTA 4N3WA 2VJFB 4CA1A 1K2FA 5C11A 2KREA 4A4BA 2L75A 1JM7B 4FIPA 2JMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9N A;  5AIU A;  1HYI A;  4MVT A;  3ZPV 1;  2OXQ C;  1D0J A;  2LGL A;  2EOD A;  4V3K C;  5TAB A;  1Z6U A;  2K16 A;  2CSY A;  3O36 A;  2F1X A;  4S3O B;  4PPE A;  2ECJ A;  2VPE A;  3O7A A;  4Z8M A;  1XWH A;  2Y1N A;  3M63 A;  5B78 A;  2VJE A;  2FUI A;  3O37 A;  4YAX A;  4ZDT A;  4FJC A;  3MQR A;  3ZVZ B;  4ZUX U;  4L7X A;  2MT5 A;  2A25 A;  4XI1 A;  4NN2 A;  2PNX A;  2YQL A;  2UZG A;  2YU4 A;  3IVV A;  5KH3 A;  4LLB A;  2M1R A;  2MA6 A;  5G0F A;  4B86 C;  4LK9 A;  2PUY A;  4N4F A;  2MD7 B;  1L0A A;  2MD8 C;  1VYX A;  4I7C A;  4WZ2 A;  4YBS A;  4LJN A;  3N9L A;  2YHO A;  3U5O A;  1X4U A;  5DIN A;  3RPG C;  2FOJ A;  1ZMS A;  4GHU A;  4X3G A;  1WEQ A;  2YT5 A;  4YAT A;  4BBQ A;  5LCW B;  5G04 B;  2YUC A;  5FB0 A;  2FOO A;  2VPD A;  5I3L A;  3DQV R;  4AYC B;  3HQH A;  4F52 B;  2CR2 A;  4YBT A;  1WEO A;  2ECG A;  2LGV A;  2XEU A;  5FB1 A;  2YRE A;  4W4U A;  1WEE A;  2HDP A;  2KGI A;  2EA6 A;  2F42 A;  2IDA A;  4AVX A;  2JMI A;  4GJH A;  1WIM A;  4Q6F A;  4WZ3 B;  3KV5 A;  4R8P K;  3KNV A;  1CZZ A;  3LQI A;  3RPG B;  5TDR A;  3VK6 A;  1MM2 A;  4GNF A;  2JMD A;  1CZY A;  2MA5 A;  4M4E A;  1JM7 A;  2LRI C;  1DVP A;  3FL2 A;  3DPL R;  1T1H A;  2I50 A;  2VJF A;  4FK5 A;  2RI7 A;  1WIL A;  2LGK A;  3I2D A;  5G05 B;  2M6M A;  4A0C D;  2KWO A;  2RSD A;  5D1L B;  5KH9 A;  3C5K A;  3HCU A;  2CKL A;  2K4D A;  2F6N A;  4R2Y A;  1F62 A;  2LGG A;  2KU3 A;  4WA6 A;  1WEP A;  2CSZ A;  4UP0 A;  1V87 A;  2YSM A;  3O35 A;  1QSC A;  4GWN A;  2L43 A;  4YC9 A;  1G25 A;  3KV6 A;  3EB5 A;  4UP5 A;  3LQJ A;  2H0D B;  4QF2 A;  2ECI A;  3HTK C;  2VNF A;  2MUM A;  3HQI A;  1D01 A;  1WES A;  2JRJ A;  2XXN A;  5EYA F;  5B8D A;  2K1J A;  1LDJ B;  4IC2 A;  4P5O B;  3LRQ A;  5C13 A;  4ZQL A;  4YBM A;  2AN6 A;  3RTR B;  3GV4 A;  2KGG A;  5H9M A;  2VP7 A;  4GND A;  3ZTG A;  3L1Z B;  2ECT A;  2YYR A;  2DX8 A;  3IVB A;  1N87 A;  4CCG X;  3L11 A;  2Y43 A;  1WEV A;  3C6W A;  1WEW A;  5H1V A;  3HQM A;  2QJ0 A;  1WEU A;  2MNZ A;  3EB6 A;  4A4C A;  5TDW A;  5AIT A;  4YAB A;  3O34 A;  2LN0 A;  2F1Y A;  3MHH A;  4UI9 B;  4GNG A;  5H1U A;  2VPG A;  2KIZ A;  2KFT A;  2F1Z A;  3NG2 A;  1WE9 A;  2XB1 A;  5B77 A;  2KWJ A;  2ECN A;  2KWK A;  3ZVY A;  3HU6 A;  4YAD A;  4B7Y C;  3N9P A;  2BAY A;  1FBV A;  2CT2 A;  2ECW A;  4BHW A;  3HCS A;  3N9Q A;  4AUQ B;  3O33 A;  3SOW A;  3ZYQ A;  4MSX A;  2LQ6 A;  2KYU A;  3N9M A;  5FEY A;  3U5N A;  3QZV A;  2K17 A;  2L5U A;  2E6R A;  4C9Z A;  1FLK A;  2KR4 A;  2HYE D;  2ECV A;  2CKL B;  2YQM A;  3M99 A;  2MIQ A;  4V3L C;  1FLL A;  3M62 A;  2C2V S;  3PHD A;  4LKA A;  1Z60 A;  1Z2Q A;  3U5M A;  5LKX A;  1WFK A;  2F1W A;  2C2L A;  5LKZ A;  3LQH A;  1LDK C;  3HCT A;  1VFY A;  3MQS C;  4QF3 A;  2QIZ A;  3HQL A;  2KE1 A;  2M3H A;  5DKA A;  3T6R A;  2YHN A;  4I7B A;  1E4U A;  1WEM A;  4WZ0 A;  1MM3 A;  5D1M B;  4I7D A;  4GWM A;  2M85 A;  2G6Q A;  4L58 A;  1LB4 A;  5KH7 A;  1FP0 A;  4GNE A;  2G45 A;  3ZPV E;  3HSV A;  2D8S A;  1RF3 A;  1D00 A;  2G43 A;  3PUR A;  5J3X A;  1HYJ A;  4PTB A;  1CA4 A;  1JOC A;  1D0A A;  1U6G B;  2FOP A;  1LB6 A;  5B76 A;  2E6S A;  3N9O A;  1LB5 A;  5TRB A;  1YY6 A;  1KZZ A;  1WEN A;  3ASL A;  4A49 A;  5JG6 A;  4R7E A;  3KQI A;  4KG9 A;  2FUU A;  4O64 A;  3ZJB A;  1ZBD B;  2L0B A;  5B79 A;  5E1T A;  1X4J A;  3IVQ A;  3SOU A;  2QIC A;  3SOX A;  2F6J A;  2KWN A;  3ZNI A;  1YZE A;  3IHP A;  3PUQ A;  4K8U A;  5LKU A;  1WGM A;  4FO9 A;  4GB0 A;  3MHS A;  2H0D A;  4LAD B;  1RMD A;  2LXP C;  5TBN A;  5H1T A;  4AP4 A;  1CA9 A;  4AYC A;  2YW8 A;  4IC3 A;  2Y1M A;  1BOR A;  5B75 A;  3U5P A;  3T7L A;  4S3O C;  1CHC A;  4JJQ A;  1X4I A;  2YUR A;  3SHB A;  3O70 A;  2VPB A;  5D1K B;  2MNY A;  2LV9 A;  5FER A;  4O1V A;  2LXH C;  2EGP A;  1VD4 A;  2NAA A;  4TKP B;  3V43 A;  3GL6 A;  3L1X A;  2GKW A;  1F3V B;  4YSI A;  2ZET C;  2YSJ A;  2VJE B;  2LDR A;  2FSA A;  2L80 A;  1IYM A;  5LKT A;  4N3W A;  2VJF B;  4CA1 A;  1K2F A;  5C11 A;  2KRE A;  4A4B A;  2L75 A;  1JM7 B;  4FIP A;  2JMJ A; 
#chains in the Genus database with same CATH topology
 2CSV A;  3N9N A;  5AIU A;  1HYI A;  4MVT A;  5SVY A;  3ZPV 1;  2OXQ C;  1D0J A;  2LGL A;  2EOD A;  4V3K C;  5TAB A;  1Z6U A;  5SVI A;  2K16 A;  2CSY A;  3O36 A;  2F1X A;  2EXU A;  4S3O B;  4PPE A;  2ECJ A;  2VPE A;  3LDY A;  3O7A A;  4Z8M A;  2EGM A;  1XWH A;  2Y1N A;  3M63 A;  3FM8 C;  5B78 A;  2VJE A;  2FUI A;  2L7P A;  3O37 A;  4YAX A;  4ZDT A;  3FJU B;  4FJC A;  3MQR A;  3ZVZ B;  4ZUX U;  4L7X A;  2MT5 A;  2A25 A;  4XI1 A;  2P57 A;  4NN2 A;  2PNX A;  4H9D A;  2YQL A;  2UZG A;  2YU4 A;  3IVV A;  5KH3 A;  4LLB A;  2M1R A;  2MA6 A;  5G0F A;  4B86 C;  4LK9 A;  2PUY A;  4N4F A;  2MD7 B;  1L0A A;  2MD8 C;  1VYX A;  4I7C A;  4WZ2 A;  4Z0O A;  4YBS A;  2FD4 A;  4LJN A;  3N9L A;  2YHO A;  3U5O A;  1X4U A;  5DIN A;  3RPG C;  2FOJ A;  1ZMS A;  4GHU A;  4X3G A;  1WEQ A;  2YT5 A;  4YAT A;  4BBQ A;  5LCW B;  5G04 B;  2YUC A;  5FB0 A;  2FOO A;  2VPD A;  5I3L A;  3DQV R;  4AYC B;  3HQH A;  4F52 B;  2CR2 A;  4YBT A;  1WEO A;  2ECG A;  2LGV A;  2XEU A;  2YRE A;  5FB1 A;  4W4U A;  1WEE A;  2HDP A;  2KGI A;  2EA6 A;  2F42 A;  2IDA A;  2CON A;  4O62 A;  2JMI A;  4AVX A;  4GJH A;  1WIM A;  4Q6F A;  3MDB C;  2KKY A;  4WZ3 B;  3KV5 A;  4R8P K;  3KNV A;  2OWA A;  1CZZ A;  3LQI A;  3RPG B;  5TDR A;  3VK6 A;  1MM2 A;  4GNF A;  2JMD A;  1CZY A;  2MA5 A;  4M4E A;  3LJU X;  1JM7 A;  2LRI C;  1DVP A;  2KKX A;  3FL2 A;  3DPL R;  1T1H A;  2JM3 A;  2I50 A;  2VJF A;  4FK5 A;  2RI7 A;  1WIL A;  2LGK A;  2XOZ A;  3I2D A;  5G05 B;  2M6M A;  4A0C D;  2KWO A;  2RSD A;  5D1L B;  2XP0 A;  5KH9 A;  3C5K A;  3HCU A;  2CKL A;  2K4D A;  2F6N A;  4R2Y A;  2XOC A;  1F62 A;  2LGG A;  2KU3 A;  4WA6 A;  1WEP A;  2CSZ A;  4UP0 A;  1V87 A;  2LAU A;  2YSM A;  3O35 A;  1QSC A;  4GWN A;  2L43 A;  4YC9 A;  1G25 A;  3KV6 A;  3EB5 A;  2M13 A;  4UP5 A;  3LQJ A;  2H0D B;  4QF2 A;  1MBM A;  2ECI A;  3HTK C;  2VNF A;  2MUM A;  3HQI A;  2E61 A;  1D01 A;  1WES A;  2JRJ A;  2XXN A;  5EYA F;  5B8D A;  2K1J A;  1LDJ B;  4IC2 A;  4P5O B;  3LRQ A;  5C13 A;  4ZQL A;  1DCQ A;  4YBM A;  2AN6 A;  3RTR B;  3GV4 A;  2KGG A;  5H9M A;  2VP7 A;  4GND A;  3ZTG A;  3L1Z B;  2D8U A;  2ECT A;  2YYR A;  2DX8 A;  3IVB A;  1N87 A;  4CCG X;  3L11 A;  2Y43 A;  3LVQ E;  1WEV A;  5SVX A;  3C6W A;  1WEW A;  5H1V A;  3HQM A;  2QJ0 A;  1WEU A;  3FAO A;  2MNZ A;  3EB6 A;  4A4C A;  5TDW A;  5AIT A;  4YAB A;  3T9K A;  3O34 A;  2LN0 A;  2F1Y A;  3MHH A;  4UI9 B;  4GNG A;  5H1U A;  2VPG A;  2KIZ A;  2KFT A;  2F1Z A;  3NG2 A;  1WE9 A;  2XB1 A;  5B77 A;  3PLW A;  2KWJ A;  2ECN A;  2KWK A;  3ZVY A;  3E2D A;  3HU6 A;  4YAD A;  4B7Y C;  3N9P A;  5K3Q A;  2BAY A;  3O47 A;  2DSM A;  1FBV A;  2CT2 A;  2ECW A;  4BHW A;  3HCS A;  3N9Q A;  4AUQ B;  3O33 A;  3SOW A;  3ZYQ A;  5SVI B;  4MSX A;  2LQ6 A;  2KYU A;  3N9M A;  2CRR A;  5FEY A;  3U5N A;  3QZV A;  2K17 A;  2L5U A;  2E6R A;  4C9Z A;  1FLK A;  2KR4 A;  2HYE D;  2ECV A;  2CKL B;  2YQM A;  2XOY A;  3M99 A;  2JUN A;  2MIQ A;  3LVR E;  4V3L C;  1FLL A;  3M62 A;  2C2V S;  3PHD A;  4LKA A;  1Z60 A;  1Z2Q A;  2CRW A;  3U5M A;  5LKX A;  1WFK A;  2F1W A;  2C2L A;  5LKZ A;  3LQH A;  1LDK C;  3HCT A;  1VFY A;  4Z0R A;  3MQS C;  4QF3 A;  4F1P A;  2QIZ A;  3HQL A;  2KE1 A;  2M3H A;  5DKA A;  3T6R A;  2IQJ A;  2YHN A;  4I7B A;  1E4U A;  3H7H A;  1WEM A;  4WZ0 A;  1MM3 A;  2FFW A;  5D1M B;  4I7D A;  4GWM A;  2M85 A;  2G6Q A;  4L58 A;  1LB4 A;  5KH7 A;  1FP0 A;  2YVR A;  2B0O E;  4GNE A;  2G45 A;  3ZPV E;  3HSV A;  3JUE A;  2D8S A;  1RF3 A;  1D00 A;  2G43 A;  3SUB A;  2DJA A;  3PUR A;  5J3X A;  1HYJ A;  4PTB A;  4OGE A;  2RR4 A;  1CA4 A;  1JOC A;  1D0A A;  1U6G B;  2FOP A;  1LB6 A;  5B76 A;  2E6S A;  3N9O A;  3FAN A;  1LB5 A;  5TRB A;  1YY6 A;  1KZZ A;  1WEN A;  3KDE C;  3ASL A;  4A49 A;  5JG6 A;  4R7E A;  3KQI A;  4KG9 A;  2FUU A;  4O64 A;  3ZJB A;  1ZBD B;  2L0B A;  3Q1D A;  3DWD A;  5B79 A;  5E1T A;  1X4J A;  3IVQ A;  3SOU A;  2QIC A;  3SOX A;  2F6J A;  2KWN A;  3ZNI A;  1YZE A;  3IHP A;  4QQ4 A;  3PUQ A;  4K8U A;  5LKU A;  1WGM A;  4FO9 A;  4GB0 A;  3MHS A;  2H0D A;  4LAD B;  1RMD A;  2LXP C;  5TBN A;  5H1T A;  4AP4 A;  1CA9 A;  4AYC A;  3DDT A;  2YW8 A;  4IC3 A;  4OGC A;  2Y1M A;  1BOR A;  5B75 A;  3U5P A;  3T7L A;  4S3O C;  1CHC A;  4JJQ A;  1X4I A;  2YUR A;  3SHB A;  3O70 A;  2VPB A;  5D1K B;  2MNY A;  2LV9 A;  5FER A;  4O1V A;  2MKE A;  2LXH C;  2EGP A;  1VD4 A;  2NAA A;  3FEH A;  4TKP B;  3V43 A;  3GL6 A;  3L1X A;  2GKW A;  1F3V B;  4YSI A;  2ZET C;  2YSJ A;  2VJE B;  2LDR A;  3M7K A;  2FSA A;  2L80 A;  1IYM A;  5LKT A;  4N3W A;  2VJF B;  4CA1 A;  1K2F A;  5C11 A;  2KRE A;  4A4B A;  2L75 A;  1JM7 B;  4FIP A;  2JMJ A; 
#chains in the Genus database with same CATH homology
 3N9N A;  5AIU A;  1HYI A;  4MVT A;  3ZPV 1;  2OXQ C;  1D0J A;  2LGL A;  2EOD A;  4V3K C;  5TAB A;  1Z6U A;  2K16 A;  2CSY A;  3O36 A;  2F1X A;  4S3O B;  4PPE A;  2ECJ A;  2VPE A;  3O7A A;  4Z8M A;  1XWH A;  2Y1N A;  3M63 A;  5B78 A;  2VJE A;  2FUI A;  3O37 A;  4YAX A;  4ZDT A;  4FJC A;  3MQR A;  3ZVZ B;  4ZUX U;  4L7X A;  2MT5 A;  2A25 A;  4XI1 A;  4NN2 A;  2PNX A;  2YQL A;  2UZG A;  2YU4 A;  3IVV A;  5KH3 A;  4LLB A;  2M1R A;  2MA6 A;  5G0F A;  4B86 C;  4LK9 A;  2PUY A;  4N4F A;  2MD7 B;  1L0A A;  2MD8 C;  1VYX A;  4I7C A;  4WZ2 A;  4YBS A;  4LJN A;  3N9L A;  2YHO A;  3U5O A;  1X4U A;  5DIN A;  3RPG C;  2FOJ A;  1ZMS A;  4GHU A;  4X3G A;  1WEQ A;  2YT5 A;  4YAT A;  4BBQ A;  5LCW B;  5G04 B;  2YUC A;  5FB0 A;  2FOO A;  2VPD A;  5I3L A;  3DQV R;  4AYC B;  3HQH A;  4F52 B;  2CR2 A;  4YBT A;  1WEO A;  2ECG A;  2LGV A;  2XEU A;  5FB1 A;  2YRE A;  4W4U A;  1WEE A;  2HDP A;  2KGI A;  2EA6 A;  2F42 A;  2IDA A;  4AVX A;  2JMI A;  4GJH A;  1WIM A;  4Q6F A;  4WZ3 B;  3KV5 A;  4R8P K;  3KNV A;  1CZZ A;  3LQI A;  3RPG B;  5TDR A;  3VK6 A;  1MM2 A;  4GNF A;  2JMD A;  1CZY A;  2MA5 A;  4M4E A;  1JM7 A;  2LRI C;  1DVP A;  3FL2 A;  3DPL R;  1T1H A;  2I50 A;  2VJF A;  4FK5 A;  2RI7 A;  1WIL A;  2LGK A;  3I2D A;  5G05 B;  2M6M A;  4A0C D;  2KWO A;  2RSD A;  5D1L B;  5KH9 A;  3C5K A;  3HCU A;  2CKL A;  2K4D A;  2F6N A;  4R2Y A;  1F62 A;  2LGG A;  2KU3 A;  4WA6 A;  1WEP A;  2CSZ A;  4UP0 A;  1V87 A;  2YSM A;  3O35 A;  1QSC A;  4GWN A;  2L43 A;  4YC9 A;  1G25 A;  3KV6 A;  3EB5 A;  4UP5 A;  3LQJ A;  2H0D B;  4QF2 A;  2ECI A;  3HTK C;  2VNF A;  2MUM A;  3HQI A;  1D01 A;  1WES A;  2JRJ A;  2XXN A;  5EYA F;  5B8D A;  2K1J A;  1LDJ B;  4IC2 A;  4P5O B;  3LRQ A;  5C13 A;  4ZQL A;  4YBM A;  2AN6 A;  3RTR B;  3GV4 A;  2KGG A;  5H9M A;  2VP7 A;  4GND A;  3ZTG A;  3L1Z B;  2ECT A;  2YYR A;  2DX8 A;  3IVB A;  1N87 A;  4CCG X;  3L11 A;  2Y43 A;  1WEV A;  3C6W A;  1WEW A;  5H1V A;  3HQM A;  2QJ0 A;  1WEU A;  2MNZ A;  3EB6 A;  4A4C A;  5TDW A;  5AIT A;  4YAB A;  3O34 A;  2LN0 A;  2F1Y A;  3MHH A;  4UI9 B;  4GNG A;  5H1U A;  2VPG A;  2KIZ A;  2KFT A;  2F1Z A;  3NG2 A;  1WE9 A;  2XB1 A;  5B77 A;  2KWJ A;  2ECN A;  2KWK A;  3ZVY A;  3HU6 A;  4YAD A;  4B7Y C;  3N9P A;  2BAY A;  1FBV A;  2CT2 A;  2ECW A;  4BHW A;  3HCS A;  3N9Q A;  4AUQ B;  3O33 A;  3SOW A;  3ZYQ A;  4MSX A;  2LQ6 A;  2KYU A;  3N9M A;  5FEY A;  3U5N A;  3QZV A;  2K17 A;  2L5U A;  2E6R A;  4C9Z A;  1FLK A;  2KR4 A;  2HYE D;  2ECV A;  2CKL B;  2YQM A;  3M99 A;  2MIQ A;  4V3L C;  1FLL A;  3M62 A;  2C2V S;  3PHD A;  4LKA A;  1Z60 A;  1Z2Q A;  3U5M A;  5LKX A;  1WFK A;  2F1W A;  2C2L A;  5LKZ A;  3LQH A;  1LDK C;  3HCT A;  1VFY A;  3MQS C;  4QF3 A;  2QIZ A;  3HQL A;  2KE1 A;  2M3H A;  5DKA A;  3T6R A;  2YHN A;  4I7B A;  1E4U A;  1WEM A;  4WZ0 A;  1MM3 A;  5D1M B;  4I7D A;  4GWM A;  2M85 A;  2G6Q A;  4L58 A;  1LB4 A;  5KH7 A;  1FP0 A;  4GNE A;  2G45 A;  3ZPV E;  3HSV A;  2D8S A;  1RF3 A;  1D00 A;  2G43 A;  3PUR A;  5J3X A;  1HYJ A;  4PTB A;  1CA4 A;  1JOC A;  1D0A A;  1U6G B;  2FOP A;  1LB6 A;  5B76 A;  2E6S A;  3N9O A;  1LB5 A;  5TRB A;  1YY6 A;  1KZZ A;  1WEN A;  3ASL A;  4A49 A;  5JG6 A;  4R7E A;  3KQI A;  4KG9 A;  2FUU A;  4O64 A;  3ZJB A;  1ZBD B;  2L0B A;  5B79 A;  5E1T A;  1X4J A;  3IVQ A;  3SOU A;  2QIC A;  3SOX A;  2F6J A;  2KWN A;  3ZNI A;  1YZE A;  3IHP A;  3PUQ A;  4K8U A;  5LKU A;  1WGM A;  4FO9 A;  4GB0 A;  3MHS A;  2H0D A;  4LAD B;  1RMD A;  2LXP C;  5TBN A;  5H1T A;  4AP4 A;  1CA9 A;  4AYC A;  2YW8 A;  4IC3 A;  2Y1M A;  1BOR A;  5B75 A;  3U5P A;  3T7L A;  4S3O C;  1CHC A;  4JJQ A;  1X4I A;  2YUR A;  3SHB A;  3O70 A;  2VPB A;  5D1K B;  2MNY A;  2LV9 A;  5FER A;  4O1V A;  2LXH C;  2EGP A;  1VD4 A;  2NAA A;  4TKP B;  3V43 A;  3GL6 A;  3L1X A;  2GKW A;  1F3V B;  4YSI A;  2ZET C;  2YSJ A;  2VJE B;  2LDR A;  2FSA A;  2L80 A;  1IYM A;  5LKT A;  4N3W A;  2VJF B;  4CA1 A;  1K2F A;  5C11 A;  2KRE A;  4A4B A;  2L75 A;  1JM7 B;  4FIP A;  2JMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...