4I7DA

Siah1 bound to synthetic peptide (ace)klrpvamvrp(prk)vr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
187
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 187
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7dA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7dA01
2KREA 2CKLA 1KZZA 4R7EA 2NAAA 4YAXA 3ZYQA 4V3LC 4A4CA 1U6GB 4UI9B 2YT5A 1L0AA 4YBMA 1CA4A 4B86C 3IVVA 3IVBA 4A49A 1F3VB 1YZEA 4GNDA 3IHPA 2M6MA 1X4UA 5D1KB 4PPEA 1FBVA 4GB0A 3EB6A 1WEWA 1BORA 4I7BA 3HQLA 1Z60A 4JJQA 3HCTA 2EGPA 1LB5A 3T7LA 2HYED 2EODA 5H1VA 4WZ3B 3HQIA 2MUMA 2HDPA 2OXQC 2KFTA 2G45A 4AVXA 2FSAA 3O70A 4GWNA 2YSJA 4QF2A 2YUCA 2ECNA 5D1LB 2KWNA 4WZ2A 3MHSA 3HQHA 2YU4A 5EYAF 2YQMA 4GNGA 4UP5A 1FP0A 1YY6A 2LGKA 2A25A 2QJ0A 3ASLA 1Z2QA 1WEPA 1MM3A 2VJEB 2F6JA 5H9MA 4FO9A 3ZTGA 5G04B 1D01A 2ECIA 1X4IA 2YQLA 2LGGA 3SHBA 4YADA 2MIQA 2QICA 1T1HA 4NN2A 3RPGB 2EA6A 2XXNA 2YYRA 1ZBDB 2KWOA 3GV4A 5TABA 3EB5A 1DVPA 2F6NA 1K2FA 3O36A 4M4EA 3O7AA 2CR2A 4AUQB 4BHWA 2MA6A 2ECGA 5TRBA 1WIMA 3PUQA 5E1TA 5DINA 1WE9A 2MT5A 2VNFA 4V3KC 5J3XA 5B76A 3C6WA 4IC3A 2CSYA 1ZMSA 2Y1MA 5B79A 3LQIA 3L1XA 1N87A 1CZZA 4R2YA 2VPDA 4CA1A 2K1JA 1WEVA 2M85A 2LDRA 5LKUA 1WEEA 3KV6A 3MQRA 2PUYA 1WGMA 2L75A 3T6RA 2MD7B 5LKXA 2KGIA 4B7YC 2K4DA 2IDAA 3NG2A 4FK5A 4GNFA 5G0FA 1MM2A 2CT2A 2H0DB 3DQVR 3ZNIA 3U5PA 3SOWA 4CCGX 2ECTA 1RMDA 4AYCA 3DPLR 2K17A 5H1TA 4LKAA 1WILA 5TDWA 1F62A 1JM7B 4TKPB 4I7CA 4YBTA 4A4BA 1G25A 4GJHA 2LXHC 2Y43A 3KV5A 2GKWA 5I3LA 3GL6A 1FLKA 5D1MB 2KR4A 4N3WA 3RPGC 2E6SA 2F42A 2VJFB 2D8SA 4N4FA 4P5OB 2CKLB 2RI7A 3N9LA 4YSIA 2C2LA 2L43A 5C11A 4L7XA 3HCUA 3I2DA 5C13A 1WEMA 2ECWA 2AN6A 4GWMA 2KGGA 3FL2A 3LRQA 4MVTA 4YC9A 3U5MA 1WEUA 1HYJA 2M3HA 3M62A 1Z6UA 2G6QA 4WA6A 2JRJA 2ECVA 4PTBA 2M1RA 4GNEA 1LB4A 2F1ZA 4LLBA 5TBNA 2JMJA 2LXPC 2LQ6A 3HQMA 5FEYA 2LRIC 3C5KA 2MD8C 2LV9A 1WFKA 5B75A 5B78A 1D0AA 1IYMA 2YHOA 4X3GA 4S3OB 2MNYA 5AIUA 4FJCA 2MNZA 4IC2A 5TDRA 4KG9A 4YBSA 2LGLA 4ZDTA 3N9NA 4I7DA 5LKTA 3ZJBA 1LB6A 4GHUA 2FUIA 2JMDA 4BBQA 4ZUXU 4Q6FA 5KH3A 3MHHA 3LQJA 3SOUA 4A0CD 3HSVA 2BAYA 4XI1A 1E4UA 3IVQA 1LDJB 4L58A 3N9QA 4UP0A 5B8DA 2DX8A 2F1YA 1CHCA 1WESA 2KU3A 5LCWB 3O34A 2XEUA 2FOPA 3O35A 3V43A 3HCSA 1D0JA 2YURA 3RTRB 2G43A 1VYXA 2E6RA 3KQIA 2VJEA 4ZQLA 4C9ZA 3SOXA 4WZ0A 4LADB 5B77A 2L5UA 3ZPV1 2YHNA 3HU6A 4FIPA 2PNXA 1LDKC 2VPBA 5FERA 5KH7A 2KIZA 1CA9A 3HTKC 3L11A 4LK9A 4Z8MA 3ZVZB 4LJNA 2ECJA 2KWJA 2L0BA 3U5OA 2VPGA 2ZETC 3LQHA 2FOOA 2VP7A 3QZVA 2YSMA 2F1XA 2LGVA 4S3OC 3M99A 2QIZA 2C2VS 2F1WA 3O37A 5JG6A 4O1VA 4O64A 4K8UA 2K16A 2YW8A 2MA5A 4F52B 2VPEA 3O33A 3VK6A 4AP4A 5LKZA 4YABA 4AYCB 1X4JA 4YATA 2FOJA 4W4UA 5DKAA 2XB1A 2Y1NA 1WEQA 3L1ZB 5AITA 5H1UA 1VFYA 1FLLA 2H0DA 1RF3A 4MSXA 3PHDA 2KE1A 1VD4A 2JMIA 3ZVYA 3ZPVE 1V87A 1HYIA 2KYUA 2FUUA 2LN0A 3PURA 4QF3A 4R8PK 3N9PA 1JM7A 2RSDA 5FB0A 1CZYA 3MQSC 3U5NA 1WENA 2L80A 3N9MA 3KNVA 2UZGA 1QSCA 5FB1A 2I50A 2KWKA 3N9OA 2YREA 1D00A 5G05B 1XWHA 2CSZA 1WEOA 3M63A 1JOCA 5KH9A 2VJFA
chains in the Genus database with same CATH superfamily
2KREA 2CKLA 1KZZA 4R7EA 2NAAA 3FAOA 5K3QA 4YAXA 3ZYQA 4V3LC 4A4CA 1U6GB 2CRRA 4UI9B 2YT5A 1L0AA 4YBMA 3FANA 1CA4A 4B86C 3IVVA 3IVBA 4A49A 1F3VB 1YZEA 3IHPA 4GNDA 2M6MA 1X4UA 5D1KB 4PPEA 1FBVA 4GB0A 3EB6A 1WEWA 1BORA 3KDEC 4I7BA 2YVRA 3HQLA 1Z60A 4JJQA 3HCTA 2EGPA 1LB5A 3T7LA 2HYED 3E2DA 3FJUB 2EODA 5H1VA 4WZ3B 3HQIA 2MUMA 2HDPA 2OXQC 2KFTA 2G45A 4AVXA 2FSAA 3O70A 4GWNA 2YSJA 4QF2A 2YUCA 2ECNA 5D1LB 2KWNA 4WZ2A 3MHSA 3HQHA 2YU4A 5EYAF 2YQMA 4GNGA 4UP5A 1FP0A 1YY6A 2LGKA 2A25A 2QJ0A 3ASLA 4O62A 1Z2QA 1WEPA 1MM3A 2MKEA 2VJEB 2F6JA 5H9MA 4FO9A 3ZTGA 5G04B 1D01A 3JUEA 2ECIA 1X4IA 2YQLA 2LGGA 3SHBA 4YADA 2MIQA 2QICA 1T1HA 4NN2A 3RPGB 2EA6A 2XXNA 2YYRA 1ZBDB 2KWOA 3GV4A 5TABA 3EB5A 1DVPA 2F6NA 1K2FA 3O36A 4M4EA 3O7AA 2CR2A 4AUQB 4BHWA 2MA6A 2EXUA 2ECGA 5TRBA 4F1PA 1WIMA 3PUQA 5E1TA 2KKXA 5DINA 1WE9A 2MT5A 2VNFA 4V3KC 3H7HA 5J3XA 5B76A 3C6WA 4IC3A 2CSYA 1ZMSA 2Y1MA 5B79A 3LQIA 3L1XA 1N87A 1CZZA 3DWDA 3M7KA 4R2YA 2VPDA 4CA1A 2K1JA 1WEVA 3FEHA 2M85A 2LDRA 5LKUA 1WEEA 3KV6A 3MQRA 2PUYA 1WGMA 3DDTA 2L75A 3T6RA 2MD7B 5LKXA 2KGIA 4B7YC 2K4DA 2IDAA 3NG2A 4FK5A 4GNFA 3LVRE 5G0FA 1MM2A 2CT2A 2H0DB 3DQVR 3ZNIA 3Q1DA 3U5PA 3SOWA 4CCGX 2ECTA 1RMDA 4AYCA 3DPLR 2JUNA 2K17A 5H1TA 4LKAA 2M13A 1WILA 5TDWA 1F62A 1JM7B 4TKPB 4I7CA 4YBTA 4A4BA 1G25A 4GJHA 2LXHC 2Y43A 3O47A 3KV5A 2GKWA 5I3LA 3GL6A 1FLKA 5D1MB 2KR4A 3T9KA 2CRWA 2P57A 4N3WA 3RPGC 2E6SA 2F42A 2VJFB 2D8SA 4N4FA 4P5OB 2CKLB 2RI7A 3N9LA 4YSIA 2JM3A 2C2LA 2L43A 5C11A 2FD4A 4L7XA 3HCUA 3I2DA 5C13A 2B0OE 1WEMA 2ECWA 2AN6A 4GWMA 2KGGA 3FL2A 3LRQA 4MVTA 4YC9A 3U5MA 3SUBA 1WEUA 1HYJA 2M3HA 3M62A 1Z6UA 2G6QA 4WA6A 2JRJA 2ECVA 4PTBA 2M1RA 4GNEA 1LB4A 2F1ZA 4LLBA 5TBNA 2JMJA 2LXPC 2LQ6A 3HQMA 5FEYA 2LRIC 3C5KA 2MD8C 2LV9A 1WFKA 5B75A 5B78A 1D0AA 1IYMA 4H9DA 2YHOA 4X3GA 4S3OB 2MNYA 2DSMA 5AIUA 2RR4A 4FJCA 2XOCA 2XOYA 2MNZA 4IC2A 1MBMA 5TDRA 4KG9A 4YBSA 2LGLA 4ZDTA 3N9NA 4I7DA 5LKTA 3ZJBA 1LB6A 4GHUA 2FUIA 2JMDA 4BBQA 4ZUXU 4Q6FA 5KH3A 3MHHA 3LQJA 2E61A 3SOUA 4A0CD 3HSVA 2BAYA 4XI1A 1E4UA 5SVXA 3IVQA 1LDJB 5SVYA 4L58A 3N9QA 4UP0A 5B8DA 2DX8A 2F1YA 1CHCA 1WESA 2KU3A 5LCWB 3O34A 2OWAA 2XEUA 2FOPA 4Z0OA 3O35A 3V43A 3HCSA 1D0JA 2YURA 3RTRB 2G43A 1VYXA 2E6RA 3KQIA 2VJEA 2D8UA 2DJAA 3PLWA 4ZQLA 4C9ZA 3SOXA 4WZ0A 4LADB 5B77A 2L5UA 3ZPV1 2YHNA 5SVIB 3HU6A 2LAUA 4FIPA 2PNXA 1LDKC 2VPBA 5FERA 5KH7A 2KIZA 2EGMA 1CA9A 2IQJA 3LDYA 3HTKC 3L11A 4LK9A 4Z8MA 3ZVZB 4LJNA 2L7PA 2ECJA 2KWJA 2L0BA 3U5OA 2VPGA 2ZETC 3LQHA 2FOOA 2VP7A 3QZVA 2YSMA 2F1XA 2LGVA 2XP0A 4OGCA 4S3OC 3M99A 2QIZA 2C2VS 2F1WA 3O37A 4QQ4A 5JG6A 4O1VA 4O64A 4K8UA 2K16A 2YW8A 2MA5A 4F52B 2VPEA 3O33A 2FFWA 3VK6A 4AP4A 2CSVA 5LKZA 4YABA 4AYCB 1X4JA 4YATA 2FOJA 4W4UA 5DKAA 2XB1A 2Y1NA 1WEQA 3MDBC 3L1ZB 5AITA 2CONA 5H1UA 1VFYA 1FLLA 2H0DA 1RF3A 4MSXA 3PHDA 2KE1A 3FM8C 2XOZA 4OGEA 1VD4A 2JMIA 3ZVYA 2KKYA 3ZPVE 1V87A 1HYIA 2KYUA 2FUUA 2LN0A 3PURA 4Z0RA 4QF3A 4R8PK 1DCQA 3N9PA 1JM7A 2RSDA 3LVQE 5FB0A 1CZYA 3MQSC 3U5NA 1WENA 2L80A 3N9MA 3KNVA 2UZGA 1QSCA 5FB1A 2I50A 5SVIA 2KWKA 3N9OA 2YREA 1D00A 3LJUX 5G05B 1XWHA 2CSZA 1WEOA 3M63A 1JOCA 5KH9A 2VJFA
chains in the Genus database with same CATH topology
2KREA 2CKLA 1KZZA 4R7EA 2NAAA 4YAXA 3ZYQA 4V3LC 4A4CA 1U6GB 4UI9B 2YT5A 1L0AA 4YBMA 1CA4A 4B86C 3IVVA 3IVBA 4A49A 1F3VB 1YZEA 4GNDA 3IHPA 2M6MA 1X4UA 5D1KB 4PPEA 1FBVA 4GB0A 3EB6A 1WEWA 1BORA 4I7BA 3HQLA 1Z60A 4JJQA 3HCTA 2EGPA 1LB5A 3T7LA 2HYED 2EODA 5H1VA 4WZ3B 3HQIA 2MUMA 2HDPA 2OXQC 2KFTA 2G45A 4AVXA 2FSAA 3O70A 4GWNA 2YSJA 4QF2A 2YUCA 2ECNA 5D1LB 2KWNA 4WZ2A 3MHSA 3HQHA 2YU4A 5EYAF 2YQMA 4GNGA 4UP5A 1FP0A 1YY6A 2LGKA 2A25A 2QJ0A 3ASLA 1Z2QA 1WEPA 1MM3A 2VJEB 2F6JA 5H9MA 4FO9A 3ZTGA 5G04B 1D01A 2ECIA 1X4IA 2YQLA 2LGGA 3SHBA 4YADA 2MIQA 2QICA 1T1HA 4NN2A 3RPGB 2EA6A 2XXNA 2YYRA 1ZBDB 2KWOA 3GV4A 5TABA 3EB5A 1DVPA 2F6NA 1K2FA 3O36A 4M4EA 3O7AA 2CR2A 4AUQB 4BHWA 2MA6A 2ECGA 5TRBA 1WIMA 3PUQA 5E1TA 5DINA 1WE9A 2MT5A 2VNFA 4V3KC 5J3XA 5B76A 3C6WA 4IC3A 2CSYA 1ZMSA 2Y1MA 5B79A 3LQIA 3L1XA 1N87A 1CZZA 4R2YA 2VPDA 4CA1A 2K1JA 1WEVA 2M85A 2LDRA 5LKUA 1WEEA 3KV6A 3MQRA 2PUYA 1WGMA 2L75A 3T6RA 2MD7B 5LKXA 2KGIA 4B7YC 2K4DA 2IDAA 3NG2A 4FK5A 4GNFA 5G0FA 1MM2A 2CT2A 2H0DB 3DQVR 3ZNIA 3U5PA 3SOWA 4CCGX 2ECTA 1RMDA 4AYCA 3DPLR 2K17A 5H1TA 4LKAA 1WILA 5TDWA 1F62A 1JM7B 4TKPB 4I7CA 4YBTA 4A4BA 1G25A 4GJHA 2LXHC 2Y43A 3KV5A 2GKWA 5I3LA 3GL6A 1FLKA 5D1MB 2KR4A 4N3WA 3RPGC 2E6SA 2F42A 2VJFB 2D8SA 4N4FA 4P5OB 2CKLB 2RI7A 3N9LA 4YSIA 2C2LA 2L43A 5C11A 4L7XA 3HCUA 3I2DA 5C13A 1WEMA 2ECWA 2AN6A 4GWMA 2KGGA 3FL2A 3LRQA 4MVTA 4YC9A 3U5MA 1WEUA 1HYJA 2M3HA 3M62A 1Z6UA 2G6QA 4WA6A 2JRJA 2ECVA 4PTBA 2M1RA 4GNEA 1LB4A 2F1ZA 4LLBA 5TBNA 2JMJA 2LXPC 2LQ6A 3HQMA 5FEYA 2LRIC 3C5KA 2MD8C 2LV9A 1WFKA 5B75A 5B78A 1D0AA 1IYMA 2YHOA 4X3GA 4S3OB 2MNYA 5AIUA 4FJCA 2MNZA 4IC2A 5TDRA 4KG9A 4YBSA 2LGLA 4ZDTA 3N9NA 4I7DA 5LKTA 3ZJBA 1LB6A 4GHUA 2FUIA 2JMDA 4BBQA 4ZUXU 4Q6FA 5KH3A 3MHHA 3LQJA 3SOUA 4A0CD 3HSVA 2BAYA 4XI1A 1E4UA 3IVQA 1LDJB 4L58A 3N9QA 4UP0A 5B8DA 2DX8A 2F1YA 1CHCA 1WESA 2KU3A 5LCWB 3O34A 2XEUA 2FOPA 3O35A 3V43A 3HCSA 1D0JA 2YURA 3RTRB 2G43A 1VYXA 2E6RA 3KQIA 2VJEA 4ZQLA 4C9ZA 3SOXA 4WZ0A 4LADB 5B77A 2L5UA 3ZPV1 2YHNA 3HU6A 4FIPA 2PNXA 1LDKC 2VPBA 5FERA 5KH7A 2KIZA 1CA9A 3HTKC 3L11A 4LK9A 4Z8MA 3ZVZB 4LJNA 2ECJA 2KWJA 2L0BA 3U5OA 2VPGA 2ZETC 3LQHA 2FOOA 2VP7A 3QZVA 2YSMA 2F1XA 2LGVA 4S3OC 3M99A 2QIZA 2C2VS 2F1WA 3O37A 5JG6A 4O1VA 4O64A 4K8UA 2K16A 2YW8A 2MA5A 4F52B 2VPEA 3O33A 3VK6A 4AP4A 5LKZA 4YABA 4AYCB 1X4JA 4YATA 2FOJA 4W4UA 5DKAA 2XB1A 2Y1NA 1WEQA 3L1ZB 5AITA 5H1UA 1VFYA 1FLLA 2H0DA 1RF3A 4MSXA 3PHDA 2KE1A 1VD4A 2JMIA 3ZVYA 3ZPVE 1V87A 1HYIA 2KYUA 2FUUA 2LN0A 3PURA 4QF3A 4R8PK 3N9PA 1JM7A 2RSDA 5FB0A 1CZYA 3MQSC 3U5NA 1WENA 2L80A 3N9MA 3KNVA 2UZGA 1QSCA 5FB1A 2I50A 2KWKA 3N9OA 2YREA 1D00A 5G05B 1XWHA 2CSZA 1WEOA 3M63A 1JOCA 5KH9A 2VJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRE A;  2CKL A;  1KZZ A;  4R7E A;  2NAA A;  4YAX A;  3ZYQ A;  4V3L C;  4A4C A;  1U6G B;  4UI9 B;  2YT5 A;  1L0A A;  4YBM A;  1CA4 A;  4B86 C;  3IVV A;  3IVB A;  4A49 A;  1F3V B;  1YZE A;  4GND A;  3IHP A;  2M6M A;  1X4U A;  5D1K B;  4PPE A;  1FBV A;  4GB0 A;  3EB6 A;  1WEW A;  1BOR A;  4I7B A;  3HQL A;  1Z60 A;  4JJQ A;  3HCT A;  2EGP A;  1LB5 A;  3T7L A;  2HYE D;  2EOD A;  5H1V A;  4WZ3 B;  3HQI A;  2MUM A;  2HDP A;  2OXQ C;  2KFT A;  2G45 A;  4AVX A;  2FSA A;  3O70 A;  4GWN A;  2YSJ A;  4QF2 A;  2YUC A;  2ECN A;  5D1L B;  2KWN A;  4WZ2 A;  3MHS A;  3HQH A;  2YU4 A;  5EYA F;  2YQM A;  4GNG A;  4UP5 A;  1FP0 A;  1YY6 A;  2LGK A;  2A25 A;  2QJ0 A;  3ASL A;  1Z2Q A;  1WEP A;  1MM3 A;  2VJE B;  2F6J A;  5H9M A;  4FO9 A;  3ZTG A;  5G04 B;  1D01 A;  2ECI A;  1X4I A;  2YQL A;  2LGG A;  3SHB A;  4YAD A;  2MIQ A;  2QIC A;  1T1H A;  4NN2 A;  3RPG B;  2EA6 A;  2XXN A;  2YYR A;  1ZBD B;  2KWO A;  3GV4 A;  5TAB A;  3EB5 A;  1DVP A;  2F6N A;  1K2F A;  3O36 A;  4M4E A;  3O7A A;  2CR2 A;  4AUQ B;  4BHW A;  2MA6 A;  2ECG A;  5TRB A;  1WIM A;  3PUQ A;  5E1T A;  5DIN A;  1WE9 A;  2MT5 A;  2VNF A;  4V3K C;  5J3X A;  5B76 A;  3C6W A;  4IC3 A;  2CSY A;  1ZMS A;  2Y1M A;  5B79 A;  3LQI A;  3L1X A;  1N87 A;  1CZZ A;  4R2Y A;  2VPD A;  4CA1 A;  2K1J A;  1WEV A;  2M85 A;  2LDR A;  5LKU A;  1WEE A;  3KV6 A;  3MQR A;  2PUY A;  1WGM A;  2L75 A;  3T6R A;  2MD7 B;  5LKX A;  2KGI A;  4B7Y C;  2K4D A;  2IDA A;  3NG2 A;  4FK5 A;  4GNF A;  5G0F A;  1MM2 A;  2CT2 A;  2H0D B;  3DQV R;  3ZNI A;  3U5P A;  3SOW A;  4CCG X;  2ECT A;  1RMD A;  4AYC A;  3DPL R;  2K17 A;  5H1T A;  4LKA A;  1WIL A;  5TDW A;  1F62 A;  1JM7 B;  4TKP B;  4I7C A;  4YBT A;  4A4B A;  1G25 A;  4GJH A;  2LXH C;  2Y43 A;  3KV5 A;  2GKW A;  5I3L A;  3GL6 A;  1FLK A;  5D1M B;  2KR4 A;  4N3W A;  3RPG C;  2E6S A;  2F42 A;  2VJF B;  2D8S A;  4N4F A;  4P5O B;  2CKL B;  2RI7 A;  3N9L A;  4YSI A;  2C2L A;  2L43 A;  5C11 A;  4L7X A;  3HCU A;  3I2D A;  5C13 A;  1WEM A;  2ECW A;  2AN6 A;  4GWM A;  2KGG A;  3FL2 A;  3LRQ A;  4MVT A;  4YC9 A;  3U5M A;  1WEU A;  1HYJ A;  2M3H A;  3M62 A;  1Z6U A;  2G6Q A;  4WA6 A;  2JRJ A;  2ECV A;  4PTB A;  2M1R A;  4GNE A;  1LB4 A;  2F1Z A;  4LLB A;  5TBN A;  2JMJ A;  2LXP C;  2LQ6 A;  3HQM A;  5FEY A;  2LRI C;  3C5K A;  2MD8 C;  2LV9 A;  1WFK A;  5B75 A;  5B78 A;  1D0A A;  1IYM A;  2YHO A;  4X3G A;  4S3O B;  2MNY A;  5AIU A;  4FJC A;  2MNZ A;  4IC2 A;  5TDR A;  4KG9 A;  4YBS A;  2LGL A;  4ZDT A;  3N9N A;  4I7D A;  5LKT A;  3ZJB A;  1LB6 A;  4GHU A;  2FUI A;  2JMD A;  4BBQ A;  4ZUX U;  4Q6F A;  5KH3 A;  3MHH A;  3LQJ A;  3SOU A;  4A0C D;  3HSV A;  2BAY A;  4XI1 A;  1E4U A;  3IVQ A;  1LDJ B;  4L58 A;  3N9Q A;  4UP0 A;  5B8D A;  2DX8 A;  2F1Y A;  1CHC A;  1WES A;  2KU3 A;  5LCW B;  3O34 A;  2XEU A;  2FOP A;  3O35 A;  3V43 A;  3HCS A;  1D0J A;  2YUR A;  3RTR B;  2G43 A;  1VYX A;  2E6R A;  3KQI A;  2VJE A;  4ZQL A;  4C9Z A;  3SOX A;  4WZ0 A;  4LAD B;  5B77 A;  2L5U A;  3ZPV 1;  2YHN A;  3HU6 A;  4FIP A;  2PNX A;  1LDK C;  2VPB A;  5FER A;  5KH7 A;  2KIZ A;  1CA9 A;  3HTK C;  3L11 A;  4LK9 A;  4Z8M A;  3ZVZ B;  4LJN A;  2ECJ A;  2KWJ A;  2L0B A;  3U5O A;  2VPG A;  2ZET C;  3LQH A;  2FOO A;  2VP7 A;  3QZV A;  2YSM A;  2F1X A;  2LGV A;  4S3O C;  3M99 A;  2QIZ A;  2C2V S;  2F1W A;  3O37 A;  5JG6 A;  4O1V A;  4O64 A;  4K8U A;  2K16 A;  2YW8 A;  2MA5 A;  4F52 B;  2VPE A;  3O33 A;  3VK6 A;  4AP4 A;  5LKZ A;  4YAB A;  4AYC B;  1X4J A;  4YAT A;  2FOJ A;  4W4U A;  5DKA A;  2XB1 A;  2Y1N A;  1WEQ A;  3L1Z B;  5AIT A;  5H1U A;  1VFY A;  1FLL A;  2H0D A;  1RF3 A;  4MSX A;  3PHD A;  2KE1 A;  1VD4 A;  2JMI A;  3ZVY A;  3ZPV E;  1V87 A;  1HYI A;  2KYU A;  2FUU A;  2LN0 A;  3PUR A;  4QF3 A;  4R8P K;  3N9P A;  1JM7 A;  2RSD A;  5FB0 A;  1CZY A;  3MQS C;  3U5N A;  1WEN A;  2L80 A;  3N9M A;  3KNV A;  2UZG A;  1QSC A;  5FB1 A;  2I50 A;  2KWK A;  3N9O A;  2YRE A;  1D00 A;  5G05 B;  1XWH A;  2CSZ A;  1WEO A;  3M63 A;  1JOC A;  5KH9 A;  2VJF A; 
#chains in the Genus database with same CATH topology
 2KRE A;  2CKL A;  1KZZ A;  4R7E A;  2NAA A;  3FAO A;  5K3Q A;  4YAX A;  3ZYQ A;  4V3L C;  4A4C A;  1U6G B;  2CRR A;  4UI9 B;  2YT5 A;  1L0A A;  4YBM A;  3FAN A;  1CA4 A;  4B86 C;  3IVV A;  3IVB A;  4A49 A;  1F3V B;  1YZE A;  3IHP A;  4GND A;  2M6M A;  1X4U A;  5D1K B;  4PPE A;  1FBV A;  4GB0 A;  3EB6 A;  1WEW A;  1BOR A;  3KDE C;  4I7B A;  2YVR A;  3HQL A;  1Z60 A;  4JJQ A;  3HCT A;  2EGP A;  1LB5 A;  3T7L A;  2HYE D;  3E2D A;  3FJU B;  2EOD A;  5H1V A;  4WZ3 B;  3HQI A;  2MUM A;  2HDP A;  2OXQ C;  2KFT A;  2G45 A;  4AVX A;  2FSA A;  3O70 A;  4GWN A;  2YSJ A;  4QF2 A;  2YUC A;  2ECN A;  5D1L B;  2KWN A;  4WZ2 A;  3MHS A;  3HQH A;  2YU4 A;  5EYA F;  2YQM A;  4GNG A;  4UP5 A;  1FP0 A;  1YY6 A;  2LGK A;  2A25 A;  2QJ0 A;  3ASL A;  4O62 A;  1Z2Q A;  1WEP A;  1MM3 A;  2MKE A;  2VJE B;  2F6J A;  5H9M A;  4FO9 A;  3ZTG A;  5G04 B;  1D01 A;  3JUE A;  2ECI A;  1X4I A;  2YQL A;  2LGG A;  3SHB A;  4YAD A;  2MIQ A;  2QIC A;  1T1H A;  4NN2 A;  3RPG B;  2EA6 A;  2XXN A;  2YYR A;  1ZBD B;  2KWO A;  3GV4 A;  5TAB A;  3EB5 A;  1DVP A;  2F6N A;  1K2F A;  3O36 A;  4M4E A;  3O7A A;  2CR2 A;  4AUQ B;  4BHW A;  2MA6 A;  2EXU A;  2ECG A;  5TRB A;  4F1P A;  1WIM A;  3PUQ A;  5E1T A;  2KKX A;  5DIN A;  1WE9 A;  2MT5 A;  2VNF A;  4V3K C;  3H7H A;  5J3X A;  5B76 A;  3C6W A;  4IC3 A;  2CSY A;  1ZMS A;  2Y1M A;  5B79 A;  3LQI A;  3L1X A;  1N87 A;  1CZZ A;  3DWD A;  3M7K A;  4R2Y A;  2VPD A;  4CA1 A;  2K1J A;  1WEV A;  3FEH A;  2M85 A;  2LDR A;  5LKU A;  1WEE A;  3KV6 A;  3MQR A;  2PUY A;  1WGM A;  3DDT A;  2L75 A;  3T6R A;  2MD7 B;  5LKX A;  2KGI A;  4B7Y C;  2K4D A;  2IDA A;  3NG2 A;  4FK5 A;  4GNF A;  3LVR E;  5G0F A;  1MM2 A;  2CT2 A;  2H0D B;  3DQV R;  3ZNI A;  3Q1D A;  3U5P A;  3SOW A;  4CCG X;  2ECT A;  1RMD A;  4AYC A;  3DPL R;  2JUN A;  2K17 A;  5H1T A;  4LKA A;  2M13 A;  1WIL A;  5TDW A;  1F62 A;  1JM7 B;  4TKP B;  4I7C A;  4YBT A;  4A4B A;  1G25 A;  4GJH A;  2LXH C;  2Y43 A;  3O47 A;  3KV5 A;  2GKW A;  5I3L A;  3GL6 A;  1FLK A;  5D1M B;  2KR4 A;  3T9K A;  2CRW A;  2P57 A;  4N3W A;  3RPG C;  2E6S A;  2F42 A;  2VJF B;  2D8S A;  4N4F A;  4P5O B;  2CKL B;  2RI7 A;  3N9L A;  4YSI A;  2JM3 A;  2C2L A;  2L43 A;  5C11 A;  2FD4 A;  4L7X A;  3HCU A;  3I2D A;  5C13 A;  2B0O E;  1WEM A;  2ECW A;  2AN6 A;  4GWM A;  2KGG A;  3FL2 A;  3LRQ A;  4MVT A;  4YC9 A;  3U5M A;  3SUB A;  1WEU A;  1HYJ A;  2M3H A;  3M62 A;  1Z6U A;  2G6Q A;  4WA6 A;  2JRJ A;  2ECV A;  4PTB A;  2M1R A;  4GNE A;  1LB4 A;  2F1Z A;  4LLB A;  5TBN A;  2JMJ A;  2LXP C;  2LQ6 A;  3HQM A;  5FEY A;  2LRI C;  3C5K A;  2MD8 C;  2LV9 A;  1WFK A;  5B75 A;  5B78 A;  1D0A A;  1IYM A;  4H9D A;  2YHO A;  4X3G A;  4S3O B;  2MNY A;  2DSM A;  5AIU A;  2RR4 A;  4FJC A;  2XOC A;  2XOY A;  2MNZ A;  4IC2 A;  1MBM A;  5TDR A;  4KG9 A;  4YBS A;  2LGL A;  4ZDT A;  3N9N A;  4I7D A;  5LKT A;  3ZJB A;  1LB6 A;  4GHU A;  2FUI A;  2JMD A;  4BBQ A;  4ZUX U;  4Q6F A;  5KH3 A;  3MHH A;  3LQJ A;  2E61 A;  3SOU A;  4A0C D;  3HSV A;  2BAY A;  4XI1 A;  1E4U A;  5SVX A;  3IVQ A;  1LDJ B;  5SVY A;  4L58 A;  3N9Q A;  4UP0 A;  5B8D A;  2DX8 A;  2F1Y A;  1CHC A;  1WES A;  2KU3 A;  5LCW B;  3O34 A;  2OWA A;  2XEU A;  2FOP A;  4Z0O A;  3O35 A;  3V43 A;  3HCS A;  1D0J A;  2YUR A;  3RTR B;  2G43 A;  1VYX A;  2E6R A;  3KQI A;  2VJE A;  2D8U A;  2DJA A;  3PLW A;  4ZQL A;  4C9Z A;  3SOX A;  4WZ0 A;  4LAD B;  5B77 A;  2L5U A;  3ZPV 1;  2YHN A;  5SVI B;  3HU6 A;  2LAU A;  4FIP A;  2PNX A;  1LDK C;  2VPB A;  5FER A;  5KH7 A;  2KIZ A;  2EGM A;  1CA9 A;  2IQJ A;  3LDY A;  3HTK C;  3L11 A;  4LK9 A;  4Z8M A;  3ZVZ B;  4LJN A;  2L7P A;  2ECJ A;  2KWJ A;  2L0B A;  3U5O A;  2VPG A;  2ZET C;  3LQH A;  2FOO A;  2VP7 A;  3QZV A;  2YSM A;  2F1X A;  2LGV A;  2XP0 A;  4OGC A;  4S3O C;  3M99 A;  2QIZ A;  2C2V S;  2F1W A;  3O37 A;  4QQ4 A;  5JG6 A;  4O1V A;  4O64 A;  4K8U A;  2K16 A;  2YW8 A;  2MA5 A;  4F52 B;  2VPE A;  3O33 A;  2FFW A;  3VK6 A;  4AP4 A;  2CSV A;  5LKZ A;  4YAB A;  4AYC B;  1X4J A;  4YAT A;  2FOJ A;  4W4U A;  5DKA A;  2XB1 A;  2Y1N A;  1WEQ A;  3MDB C;  3L1Z B;  5AIT A;  2CON A;  5H1U A;  1VFY A;  1FLL A;  2H0D A;  1RF3 A;  4MSX A;  3PHD A;  2KE1 A;  3FM8 C;  2XOZ A;  4OGE A;  1VD4 A;  2JMI A;  3ZVY A;  2KKY A;  3ZPV E;  1V87 A;  1HYI A;  2KYU A;  2FUU A;  2LN0 A;  3PUR A;  4Z0R A;  4QF3 A;  4R8P K;  1DCQ A;  3N9P A;  1JM7 A;  2RSD A;  3LVQ E;  5FB0 A;  1CZY A;  3MQS C;  3U5N A;  1WEN A;  2L80 A;  3N9M A;  3KNV A;  2UZG A;  1QSC A;  5FB1 A;  2I50 A;  5SVI A;  2KWK A;  3N9O A;  2YRE A;  1D00 A;  3LJU X;  5G05 B;  1XWH A;  2CSZ A;  1WEO A;  3M63 A;  1JOC A;  5KH9 A;  2VJF A; 
#chains in the Genus database with same CATH homology
 2KRE A;  2CKL A;  1KZZ A;  4R7E A;  2NAA A;  4YAX A;  3ZYQ A;  4V3L C;  4A4C A;  1U6G B;  4UI9 B;  2YT5 A;  1L0A A;  4YBM A;  1CA4 A;  4B86 C;  3IVV A;  3IVB A;  4A49 A;  1F3V B;  1YZE A;  4GND A;  3IHP A;  2M6M A;  1X4U A;  5D1K B;  4PPE A;  1FBV A;  4GB0 A;  3EB6 A;  1WEW A;  1BOR A;  4I7B A;  3HQL A;  1Z60 A;  4JJQ A;  3HCT A;  2EGP A;  1LB5 A;  3T7L A;  2HYE D;  2EOD A;  5H1V A;  4WZ3 B;  3HQI A;  2MUM A;  2HDP A;  2OXQ C;  2KFT A;  2G45 A;  4AVX A;  2FSA A;  3O70 A;  4GWN A;  2YSJ A;  4QF2 A;  2YUC A;  2ECN A;  5D1L B;  2KWN A;  4WZ2 A;  3MHS A;  3HQH A;  2YU4 A;  5EYA F;  2YQM A;  4GNG A;  4UP5 A;  1FP0 A;  1YY6 A;  2LGK A;  2A25 A;  2QJ0 A;  3ASL A;  1Z2Q A;  1WEP A;  1MM3 A;  2VJE B;  2F6J A;  5H9M A;  4FO9 A;  3ZTG A;  5G04 B;  1D01 A;  2ECI A;  1X4I A;  2YQL A;  2LGG A;  3SHB A;  4YAD A;  2MIQ A;  2QIC A;  1T1H A;  4NN2 A;  3RPG B;  2EA6 A;  2XXN A;  2YYR A;  1ZBD B;  2KWO A;  3GV4 A;  5TAB A;  3EB5 A;  1DVP A;  2F6N A;  1K2F A;  3O36 A;  4M4E A;  3O7A A;  2CR2 A;  4AUQ B;  4BHW A;  2MA6 A;  2ECG A;  5TRB A;  1WIM A;  3PUQ A;  5E1T A;  5DIN A;  1WE9 A;  2MT5 A;  2VNF A;  4V3K C;  5J3X A;  5B76 A;  3C6W A;  4IC3 A;  2CSY A;  1ZMS A;  2Y1M A;  5B79 A;  3LQI A;  3L1X A;  1N87 A;  1CZZ A;  4R2Y A;  2VPD A;  4CA1 A;  2K1J A;  1WEV A;  2M85 A;  2LDR A;  5LKU A;  1WEE A;  3KV6 A;  3MQR A;  2PUY A;  1WGM A;  2L75 A;  3T6R A;  2MD7 B;  5LKX A;  2KGI A;  4B7Y C;  2K4D A;  2IDA A;  3NG2 A;  4FK5 A;  4GNF A;  5G0F A;  1MM2 A;  2CT2 A;  2H0D B;  3DQV R;  3ZNI A;  3U5P A;  3SOW A;  4CCG X;  2ECT A;  1RMD A;  4AYC A;  3DPL R;  2K17 A;  5H1T A;  4LKA A;  1WIL A;  5TDW A;  1F62 A;  1JM7 B;  4TKP B;  4I7C A;  4YBT A;  4A4B A;  1G25 A;  4GJH A;  2LXH C;  2Y43 A;  3KV5 A;  2GKW A;  5I3L A;  3GL6 A;  1FLK A;  5D1M B;  2KR4 A;  4N3W A;  3RPG C;  2E6S A;  2F42 A;  2VJF B;  2D8S A;  4N4F A;  4P5O B;  2CKL B;  2RI7 A;  3N9L A;  4YSI A;  2C2L A;  2L43 A;  5C11 A;  4L7X A;  3HCU A;  3I2D A;  5C13 A;  1WEM A;  2ECW A;  2AN6 A;  4GWM A;  2KGG A;  3FL2 A;  3LRQ A;  4MVT A;  4YC9 A;  3U5M A;  1WEU A;  1HYJ A;  2M3H A;  3M62 A;  1Z6U A;  2G6Q A;  4WA6 A;  2JRJ A;  2ECV A;  4PTB A;  2M1R A;  4GNE A;  1LB4 A;  2F1Z A;  4LLB A;  5TBN A;  2JMJ A;  2LXP C;  2LQ6 A;  3HQM A;  5FEY A;  2LRI C;  3C5K A;  2MD8 C;  2LV9 A;  1WFK A;  5B75 A;  5B78 A;  1D0A A;  1IYM A;  2YHO A;  4X3G A;  4S3O B;  2MNY A;  5AIU A;  4FJC A;  2MNZ A;  4IC2 A;  5TDR A;  4KG9 A;  4YBS A;  2LGL A;  4ZDT A;  3N9N A;  4I7D A;  5LKT A;  3ZJB A;  1LB6 A;  4GHU A;  2FUI A;  2JMD A;  4BBQ A;  4ZUX U;  4Q6F A;  5KH3 A;  3MHH A;  3LQJ A;  3SOU A;  4A0C D;  3HSV A;  2BAY A;  4XI1 A;  1E4U A;  3IVQ A;  1LDJ B;  4L58 A;  3N9Q A;  4UP0 A;  5B8D A;  2DX8 A;  2F1Y A;  1CHC A;  1WES A;  2KU3 A;  5LCW B;  3O34 A;  2XEU A;  2FOP A;  3O35 A;  3V43 A;  3HCS A;  1D0J A;  2YUR A;  3RTR B;  2G43 A;  1VYX A;  2E6R A;  3KQI A;  2VJE A;  4ZQL A;  4C9Z A;  3SOX A;  4WZ0 A;  4LAD B;  5B77 A;  2L5U A;  3ZPV 1;  2YHN A;  3HU6 A;  4FIP A;  2PNX A;  1LDK C;  2VPB A;  5FER A;  5KH7 A;  2KIZ A;  1CA9 A;  3HTK C;  3L11 A;  4LK9 A;  4Z8M A;  3ZVZ B;  4LJN A;  2ECJ A;  2KWJ A;  2L0B A;  3U5O A;  2VPG A;  2ZET C;  3LQH A;  2FOO A;  2VP7 A;  3QZV A;  2YSM A;  2F1X A;  2LGV A;  4S3O C;  3M99 A;  2QIZ A;  2C2V S;  2F1W A;  3O37 A;  5JG6 A;  4O1V A;  4O64 A;  4K8U A;  2K16 A;  2YW8 A;  2MA5 A;  4F52 B;  2VPE A;  3O33 A;  3VK6 A;  4AP4 A;  5LKZ A;  4YAB A;  4AYC B;  1X4J A;  4YAT A;  2FOJ A;  4W4U A;  5DKA A;  2XB1 A;  2Y1N A;  1WEQ A;  3L1Z B;  5AIT A;  5H1U A;  1VFY A;  1FLL A;  2H0D A;  1RF3 A;  4MSX A;  3PHD A;  2KE1 A;  1VD4 A;  2JMI A;  3ZVY A;  3ZPV E;  1V87 A;  1HYI A;  2KYU A;  2FUU A;  2LN0 A;  3PUR A;  4QF3 A;  4R8P K;  3N9P A;  1JM7 A;  2RSD A;  5FB0 A;  1CZY A;  3MQS C;  3U5N A;  1WEN A;  2L80 A;  3N9M A;  3KNV A;  2UZG A;  1QSC A;  5FB1 A;  2I50 A;  2KWK A;  3N9O A;  2YRE A;  1D00 A;  5G05 B;  1XWH A;  2CSZ A;  1WEO A;  3M63 A;  1JOC A;  5KH9 A;  2VJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...