4I7DA

Siah1 bound to synthetic peptide (ace)klrpvamvrp(prk)vr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
187
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords E3 ubiquitin-protein ligase SIAH1
total genus 45
structure length 187
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7dA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7dA01
4FK5A 2D8SA 2YSJA 4X3GA 4IC3A 1CA4A 1LDKC 2JMIA 5FB0A 2F1WA 3ZTGA 1WIMA 1Z6UA 5TDRA 4Z8MA 3MHHA 4ZDTA 2AN6A 1ZMSA 3L1ZB 4S3OB 2F1XA 4V3KC 2EGPA 3LRQA 3HU6A 5JG6A 2MIQA 3L11A 4I7CA 1YZEA 3FL2A 3N9MA 4LADB 2Y1NA 1N87A 2LV9A 3SOWA 3HSVA 2E6RA 3DPLR 4GB0A 4N3WA 3U5MA 2LGLA 2LXHC 1WESA 1BORA 4R7EA 5C13A 1WEUA 4MSXA 3NG2A 4S3OC 4KG9A 2M1RA 2K1JA 2F1YA 1JOCA 2K16A 4WZ3B 2XXNA 3RTRB 2KFTA 2CSYA 2PNXA 3T6RA 2M6MA 1F3VB 3ZJBA 1ZBDB 5KH7A 1QSCA 4WA6A 3O36A 4GNFA 2FUUA 2LN0A 2XEUA 2RI7A 5LKXA 3ZPV1 2L75A 1HYJA 4W4UA 4YADA 2VPEA 4R2YA 3T7LA 1RF3A 4GJHA 5LKZA 3ZVYA 4A49A 4LKAA 4YBTA 2LGKA 4FJCA 5B76A 5AITA 5EYAF 2ZETC 2KWJA 1JM7A 2YQMA 1LB5A 2KWOA 1WFKA 3C5KA 2VNFA 3N9LA 4WZ0A 2YSMA 2KE1A 2FOPA 3HQLA 3M99A 2C2LA 4Q6FA 3KV5A 4BBQA 3HCTA 3HCUA 1CZZA 2HDPA 4R8PK 2VJFA 1KZZA 3RPGB 1DVPA 2YUCA 3O37A 1CHCA 2GKWA 4YBSA 2LGGA 5B77A 3M62A 2M85A 5LCWB 4AYCB 2VJEB 4O1VA 3U5NA 3U5PA 4B7YC 2YT5A 2L0BA 3LQIA 4LLBA 2LQ6A 2ECIA 2KGIA 1Z2QA 2KR4A 2CR2A 2ECWA 5H9MA 1WEOA 2QJ0A 2K4DA 2QIZA 3SOXA 2CT2A 3IVBA 4C9ZA 4UI9B 3U5OA 1WEMA 2ECNA 3N9NA 3MHSA 5D1KB 4YBMA 3ZVZB 3IHPA 3O33A 2E6SA 4B86C 3M63A 3KQIA 2YHOA 3DQVR 1X4IA 4GNEA 4QF3A 1LB6A 4CA1A 3KNVA 1FBVA 5E1TA 1FLKA 2L80A 4YATA 5I3LA 1WEWA 2CKLB 3EB5A 3HQMA 4QF2A 5C11A 3MQRA 1MM2A 5B78A 2ECGA 3N9OA 3IVVA 2YURA 3PUQA 1G25A 1Z60A 2F6NA 3LQJA 2H0DB 2K17A 2YREA 2MA6A 4I7BA 4GNDA 5TRBA 2MD8C 2IDAA 4L7XA 1WENA 3HQIA 2BAYA 1WEQA 1X4JA 2LXPC 4NN2A 5FB1A 4ZUXU 1VFYA 2VPBA 4AUQB 3C6WA 2FOOA 4O64A 1F62A 3O35A 1RMDA 4FO9A 1CA9A 2OXQC 3L1XA 3QZVA 4FIPA 4PTBA 5LKTA 2A25A 2CKLA 2ECVA 2ECJA 2EA6A 4UP5A 4K8UA 4YSIA 2PUYA 2JMDA 2YQLA 2MUMA 5AIUA 5FEYA 2LDRA 1LB4A 2H0DA 3PHDA 5FERA 3O70A 3ASLA 4N4FA 2KU3A 4YAXA 3GL6A 1CZYA 2G43A 5B8DA 2XB1A 3IVQA 2F6JA 2FUIA 4AVXA 3HTKC 4A4CA 1D0JA 3KV6A 5KH9A 5TDWA 1VD4A 3HQHA 2G6QA 3ZYQA 2MNZA 5DINA 4TKPB 1WEEA 2YU4A 4V3LC 1X4UA 4BHWA 1WGMA 2QICA 4AP4A 2MT5A 4LJNA 2MD7B 2F42A 4L58A 2HYED 2KWKA 2VPDA 1U6GB 2MNYA 2JMJA 4GNGA 1XWHA 2F1ZA 1VYXA 2KIZA 4AYCA 1D00A 3N9QA 5DKAA 2YHNA 1D01A 5J3XA 4YC9A 4XI1A 3SHBA 1WILA 2EODA 3PURA 2NAAA 4CCGX 5TABA 2VJFB 3MQSC 1FLLA 2CSZA 1L0AA 5G04B 2L43A 3EB6A 2JRJA 4MVTA 2KYUA 2VPGA 2Y1MA 1LDJB 2DX8A 4I7DA 2FSAA 4PPEA 5H1VA 2MA5A 5KH3A 2VJEA 5H1UA 4GHUA 3ZPVE 4GWMA 3ZNIA 2LRIC 2RSDA 1E4UA 1JM7B 2C2VS 3HCSA 5LKUA 3VK6A 4P5OB 1IYMA 3O7AA 1MM3A 4M4EA 2I50A 5G05B 2YYRA 2ECTA 1V87A 2LGVA 1WEPA 3SOUA 2Y43A 5TBNA 4A4BA 4YABA 5G0FA 2KWNA 3RPGC 2FOJA 1FP0A 4LK9A 5B79A 4ZQLA 3I2DA 1WE9A 3N9PA 1HYIA 2UZGA 4GWNA 3O34A 2M3HA 1D0AA 2YW8A 2G45A 3V43A 4JJQA 5B75A 2KREA 4UP0A 5H1TA 4IC2A 3GV4A 1YY6A 3LQHA 4F52B 1T1HA 2VP7A 1WEVA 2KGGA 1K2FA 4WZ2A 5D1MB 4A0CD 5D1LB 2L5UA
chains in the Genus database with same CATH superfamily
4FK5A 2D8SA 2YSJA 4X3GA 4H9DA 4IC3A 1CA4A 4F1PA 1LDKC 2EGMA 2JMIA 5FB0A 2F1WA 3ZTGA 1WIMA 2FD4A 1Z6UA 2OWAA 5TDRA 4Z8MA 3MHHA 4ZDTA 2AN6A 1ZMSA 2DSMA 3L1ZB 4S3OB 2F1XA 4V3KC 2EGPA 3LRQA 3HU6A 5JG6A 2MIQA 3L11A 4I7CA 1YZEA 3FL2A 3N9MA 2KKXA 4LADB 2Y1NA 1N87A 2LV9A 3SOWA 3HSVA 2E6RA 3O47A 3DPLR 4GB0A 4N3WA 3U5MA 2LGLA 2LXHC 3FJUB 1WESA 1BORA 4R7EA 5C13A 1WEUA 4MSXA 2FFWA 3NG2A 4S3OC 4KG9A 2M1RA 2DJAA 2YVRA 2K1JA 2F1YA 1JOCA 2K16A 4WZ3B 2XXNA 3RTRB 2KFTA 2CSYA 2PNXA 3T6RA 2M6MA 1F3VB 3ZJBA 1ZBDB 5KH7A 1QSCA 4WA6A 3O36A 4QQ4A 4GNFA 2LAUA 2FUUA 2LN0A 2XEUA 3LVRE 2RI7A 5LKXA 1MBMA 3ZPV1 2L75A 1HYJA 4W4UA 4YADA 2VPEA 4R2YA 3T7LA 1RF3A 4GJHA 5LKZA 3ZVYA 4A49A 4LKAA 4YBTA 2XOYA 2LGKA 4FJCA 5B76A 5AITA 5EYAF 2ZETC 2KWJA 1JM7A 2YQMA 1LB5A 2KWOA 1WFKA 3C5KA 2VNFA 3N9LA 4WZ0A 2YSMA 2KE1A 2FOPA 3HQLA 3M99A 2C2LA 4Q6FA 3KV5A 3PLWA 4BBQA 3LDYA 3HCTA 3HCUA 1CZZA 4Z0OA 2HDPA 4R8PK 2VJFA 1KZZA 3RPGB 1DVPA 2CRRA 2YUCA 3O37A 1CHCA 2GKWA 4YBSA 2LGGA 3Q1DA 5B77A 3M62A 2M85A 5LCWB 4AYCB 2VJEB 4O1VA 3U5NA 3U5PA 4B7YC 2YT5A 2L0BA 3LQIA 4LLBA 2LQ6A 2ECIA 2KGIA 1Z2QA 2KR4A 2CR2A 2ECWA 5H9MA 1WEOA 2QJ0A 2K4DA 2QIZA 3SOXA 2CT2A 3IVBA 4C9ZA 4UI9B 3U5OA 1WEMA 3FM8C 2ECNA 3N9NA 3MHSA 5D1KB 4YBMA 3ZVZB 3IHPA 3FAOA 3O33A 2E6SA 4B86C 3M63A 3KQIA 2YHOA 3DQVR 1X4IA 4GNEA 4QF3A 1LB6A 4CA1A 3KNVA 1FBVA 5E1TA 1FLKA 2L80A 4YATA 2XOCA 5I3LA 3E2DA 1WEWA 2CKLB 2M13A 3LJUX 3JUEA 3EB5A 3HQMA 4QF2A 5C11A 3MQRA 1MM2A 5B78A 2ECGA 2IQJA 3N9OA 3IVVA 3SUBA 2YURA 2D8UA 3PUQA 1G25A 1Z60A 2F6NA 3LQJA 2H0DB 2K17A 2YREA 2MA6A 4I7BA 4GNDA 5TRBA 2MD8C 2IDAA 4L7XA 1WENA 3HQIA 2BAYA 1WEQA 1X4JA 5SVIB 2LXPC 4NN2A 5FB1A 4ZUXU 1VFYA 2VPBA 4AUQB 5SVYA 3C6WA 2FOOA 4O64A 1F62A 2B0OE 3O35A 1RMDA 2EXUA 4FO9A 2E61A 1CA9A 2OXQC 3L1XA 3QZVA 4FIPA 4PTBA 5LKTA 2L7PA 2A25A 2CKLA 3H7HA 2ECVA 2ECJA 2EA6A 4UP5A 4K8UA 4YSIA 2PUYA 2JMDA 2YQLA 2MUMA 5AIUA 5FEYA 2LDRA 1LB4A 3LVQE 2H0DA 3PHDA 5FERA 3O70A 3ASLA 4N4FA 2KU3A 4YAXA 3GL6A 4O62A 1CZYA 2G43A 5B8DA 2XB1A 3IVQA 2F6JA 2FUIA 3T9KA 4AVXA 3HTKC 4A4CA 1D0JA 3KV6A 5KH9A 5TDWA 1VD4A 3HQHA 2G6QA 3ZYQA 2MNZA 5DINA 2P57A 3DWDA 4TKPB 1WEEA 2YU4A 4V3LC 2CRWA 1X4UA 4BHWA 2CSVA 1WGMA 3FANA 2QICA 4AP4A 2MT5A 4LJNA 2MD7B 2F42A 4L58A 2HYED 2KWKA 2VPDA 2KKYA 1U6GB 2MNYA 2JMJA 4GNGA 1XWHA 5SVXA 2F1ZA 1VYXA 2KIZA 4AYCA 1D00A 3N9QA 5DKAA 2YHNA 1D01A 5J3XA 4OGEA 4YC9A 4XI1A 2JM3A 3SHBA 1WILA 2EODA 3PURA 2XOZA 2NAAA 2JUNA 4CCGX 5TABA 2RR4A 5K3QA 2VJFB 3MQSC 1FLLA 2CSZA 1L0AA 5G04B 1DCQA 5SVIA 2L43A 3KDEC 3EB6A 2JRJA 4MVTA 2KYUA 2MKEA 2VPGA 2CONA 2Y1MA 1LDJB 2DX8A 4I7DA 2FSAA 4PPEA 5H1VA 2MA5A 5KH3A 2VJEA 2XP0A 5H1UA 4GHUA 3ZPVE 4GWMA 3ZNIA 2LRIC 2RSDA 1E4UA 1JM7B 2C2VS 3HCSA 3MDBC 5LKUA 3VK6A 3DDTA 4P5OB 3FEHA 1IYMA 3O7AA 1MM3A 4M4EA 2I50A 5G05B 2YYRA 2ECTA 1V87A 2LGVA 1WEPA 3SOUA 2Y43A 5TBNA 4A4BA 4YABA 3M7KA 5G0FA 2KWNA 3RPGC 2FOJA 1FP0A 4OGCA 4LK9A 5B79A 4ZQLA 3I2DA 1WE9A 3N9PA 1HYIA 2UZGA 4GWNA 3O34A 2M3HA 1D0AA 2YW8A 2G45A 3V43A 4JJQA 5B75A 2KREA 4UP0A 5H1TA 4IC2A 3GV4A 1YY6A 3LQHA 4F52B 1T1HA 2VP7A 1WEVA 2KGGA 1K2FA 4WZ2A 5D1MB 4A0CD 5D1LB 4Z0RA 2L5UA
chains in the Genus database with same CATH topology
4FK5A 2D8SA 2YSJA 4X3GA 4IC3A 1CA4A 1LDKC 2JMIA 5FB0A 2F1WA 3ZTGA 1WIMA 1Z6UA 5TDRA 4Z8MA 3MHHA 4ZDTA 2AN6A 1ZMSA 3L1ZB 4S3OB 2F1XA 4V3KC 2EGPA 3LRQA 3HU6A 5JG6A 2MIQA 3L11A 4I7CA 1YZEA 3FL2A 3N9MA 4LADB 2Y1NA 1N87A 2LV9A 3SOWA 3HSVA 2E6RA 3DPLR 4GB0A 4N3WA 3U5MA 2LGLA 2LXHC 1WESA 1BORA 4R7EA 5C13A 1WEUA 4MSXA 3NG2A 4S3OC 4KG9A 2M1RA 2K1JA 2F1YA 1JOCA 2K16A 4WZ3B 2XXNA 3RTRB 2KFTA 2CSYA 2PNXA 3T6RA 2M6MA 1F3VB 3ZJBA 1ZBDB 5KH7A 1QSCA 4WA6A 3O36A 4GNFA 2FUUA 2LN0A 2XEUA 2RI7A 5LKXA 3ZPV1 2L75A 1HYJA 4W4UA 4YADA 2VPEA 4R2YA 3T7LA 1RF3A 4GJHA 5LKZA 3ZVYA 4A49A 4LKAA 4YBTA 2LGKA 4FJCA 5B76A 5AITA 5EYAF 2ZETC 2KWJA 1JM7A 2YQMA 1LB5A 2KWOA 1WFKA 3C5KA 2VNFA 3N9LA 4WZ0A 2YSMA 2KE1A 2FOPA 3HQLA 3M99A 2C2LA 4Q6FA 3KV5A 4BBQA 3HCTA 3HCUA 1CZZA 2HDPA 4R8PK 2VJFA 1KZZA 3RPGB 1DVPA 2YUCA 3O37A 1CHCA 2GKWA 4YBSA 2LGGA 5B77A 3M62A 2M85A 5LCWB 4AYCB 2VJEB 4O1VA 3U5NA 3U5PA 4B7YC 2YT5A 2L0BA 3LQIA 4LLBA 2LQ6A 2ECIA 2KGIA 1Z2QA 2KR4A 2CR2A 2ECWA 5H9MA 1WEOA 2QJ0A 2K4DA 2QIZA 3SOXA 2CT2A 3IVBA 4C9ZA 4UI9B 3U5OA 1WEMA 2ECNA 3N9NA 3MHSA 5D1KB 4YBMA 3ZVZB 3IHPA 3O33A 2E6SA 4B86C 3M63A 3KQIA 2YHOA 3DQVR 1X4IA 4GNEA 4QF3A 1LB6A 4CA1A 3KNVA 1FBVA 5E1TA 1FLKA 2L80A 4YATA 5I3LA 1WEWA 2CKLB 3EB5A 3HQMA 4QF2A 5C11A 3MQRA 1MM2A 5B78A 2ECGA 3N9OA 3IVVA 2YURA 3PUQA 1G25A 1Z60A 2F6NA 3LQJA 2H0DB 2K17A 2YREA 2MA6A 4I7BA 4GNDA 5TRBA 2MD8C 2IDAA 4L7XA 1WENA 3HQIA 2BAYA 1WEQA 1X4JA 2LXPC 4NN2A 5FB1A 4ZUXU 1VFYA 2VPBA 4AUQB 3C6WA 2FOOA 4O64A 1F62A 3O35A 1RMDA 4FO9A 1CA9A 2OXQC 3L1XA 3QZVA 4FIPA 4PTBA 5LKTA 2A25A 2CKLA 2ECVA 2ECJA 2EA6A 4UP5A 4K8UA 4YSIA 2PUYA 2JMDA 2YQLA 2MUMA 5AIUA 5FEYA 2LDRA 1LB4A 2H0DA 3PHDA 5FERA 3O70A 3ASLA 4N4FA 2KU3A 4YAXA 3GL6A 1CZYA 2G43A 5B8DA 2XB1A 3IVQA 2F6JA 2FUIA 4AVXA 3HTKC 4A4CA 1D0JA 3KV6A 5KH9A 5TDWA 1VD4A 3HQHA 2G6QA 3ZYQA 2MNZA 5DINA 4TKPB 1WEEA 2YU4A 4V3LC 1X4UA 4BHWA 1WGMA 2QICA 4AP4A 2MT5A 4LJNA 2MD7B 2F42A 4L58A 2HYED 2KWKA 2VPDA 1U6GB 2MNYA 2JMJA 4GNGA 1XWHA 2F1ZA 1VYXA 2KIZA 4AYCA 1D00A 3N9QA 5DKAA 2YHNA 1D01A 5J3XA 4YC9A 4XI1A 3SHBA 1WILA 2EODA 3PURA 2NAAA 4CCGX 5TABA 2VJFB 3MQSC 1FLLA 2CSZA 1L0AA 5G04B 2L43A 3EB6A 2JRJA 4MVTA 2KYUA 2VPGA 2Y1MA 1LDJB 2DX8A 4I7DA 2FSAA 4PPEA 5H1VA 2MA5A 5KH3A 2VJEA 5H1UA 4GHUA 3ZPVE 4GWMA 3ZNIA 2LRIC 2RSDA 1E4UA 1JM7B 2C2VS 3HCSA 5LKUA 3VK6A 4P5OB 1IYMA 3O7AA 1MM3A 4M4EA 2I50A 5G05B 2YYRA 2ECTA 1V87A 2LGVA 1WEPA 3SOUA 2Y43A 5TBNA 4A4BA 4YABA 5G0FA 2KWNA 3RPGC 2FOJA 1FP0A 4LK9A 5B79A 4ZQLA 3I2DA 1WE9A 3N9PA 1HYIA 2UZGA 4GWNA 3O34A 2M3HA 1D0AA 2YW8A 2G45A 3V43A 4JJQA 5B75A 2KREA 4UP0A 5H1TA 4IC2A 3GV4A 1YY6A 3LQHA 4F52B 1T1HA 2VP7A 1WEVA 2KGGA 1K2FA 4WZ2A 5D1MB 4A0CD 5D1LB 2L5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK5 A;  2D8S A;  2YSJ A;  4X3G A;  4IC3 A;  1CA4 A;  1LDK C;  2JMI A;  5FB0 A;  2F1W A;  3ZTG A;  1WIM A;  1Z6U A;  5TDR A;  4Z8M A;  3MHH A;  4ZDT A;  2AN6 A;  1ZMS A;  3L1Z B;  4S3O B;  2F1X A;  4V3K C;  2EGP A;  3LRQ A;  3HU6 A;  5JG6 A;  2MIQ A;  3L11 A;  4I7C A;  1YZE A;  3FL2 A;  3N9M A;  4LAD B;  2Y1N A;  1N87 A;  2LV9 A;  3SOW A;  3HSV A;  2E6R A;  3DPL R;  4GB0 A;  4N3W A;  3U5M A;  2LGL A;  2LXH C;  1WES A;  1BOR A;  4R7E A;  5C13 A;  1WEU A;  4MSX A;  3NG2 A;  4S3O C;  4KG9 A;  2M1R A;  2K1J A;  2F1Y A;  1JOC A;  2K16 A;  4WZ3 B;  2XXN A;  3RTR B;  2KFT A;  2CSY A;  2PNX A;  3T6R A;  2M6M A;  1F3V B;  3ZJB A;  1ZBD B;  5KH7 A;  1QSC A;  4WA6 A;  3O36 A;  4GNF A;  2FUU A;  2LN0 A;  2XEU A;  2RI7 A;  5LKX A;  3ZPV 1;  2L75 A;  1HYJ A;  4W4U A;  4YAD A;  2VPE A;  4R2Y A;  3T7L A;  1RF3 A;  4GJH A;  5LKZ A;  3ZVY A;  4A49 A;  4LKA A;  4YBT A;  2LGK A;  4FJC A;  5B76 A;  5AIT A;  5EYA F;  2ZET C;  2KWJ A;  1JM7 A;  2YQM A;  1LB5 A;  2KWO A;  1WFK A;  3C5K A;  2VNF A;  3N9L A;  4WZ0 A;  2YSM A;  2KE1 A;  2FOP A;  3HQL A;  3M99 A;  2C2L A;  4Q6F A;  3KV5 A;  4BBQ A;  3HCT A;  3HCU A;  1CZZ A;  2HDP A;  4R8P K;  2VJF A;  1KZZ A;  3RPG B;  1DVP A;  2YUC A;  3O37 A;  1CHC A;  2GKW A;  4YBS A;  2LGG A;  5B77 A;  3M62 A;  2M85 A;  5LCW B;  4AYC B;  2VJE B;  4O1V A;  3U5N A;  3U5P A;  4B7Y C;  2YT5 A;  2L0B A;  3LQI A;  4LLB A;  2LQ6 A;  2ECI A;  2KGI A;  1Z2Q A;  2KR4 A;  2CR2 A;  2ECW A;  5H9M A;  1WEO A;  2QJ0 A;  2K4D A;  2QIZ A;  3SOX A;  2CT2 A;  3IVB A;  4C9Z A;  4UI9 B;  3U5O A;  1WEM A;  2ECN A;  3N9N A;  3MHS A;  5D1K B;  4YBM A;  3ZVZ B;  3IHP A;  3O33 A;  2E6S A;  4B86 C;  3M63 A;  3KQI A;  2YHO A;  3DQV R;  1X4I A;  4GNE A;  4QF3 A;  1LB6 A;  4CA1 A;  3KNV A;  1FBV A;  5E1T A;  1FLK A;  2L80 A;  4YAT A;  5I3L A;  1WEW A;  2CKL B;  3EB5 A;  3HQM A;  4QF2 A;  5C11 A;  3MQR A;  1MM2 A;  5B78 A;  2ECG A;  3N9O A;  3IVV A;  2YUR A;  3PUQ A;  1G25 A;  1Z60 A;  2F6N A;  3LQJ A;  2H0D B;  2K17 A;  2YRE A;  2MA6 A;  4I7B A;  4GND A;  5TRB A;  2MD8 C;  2IDA A;  4L7X A;  1WEN A;  3HQI A;  2BAY A;  1WEQ A;  1X4J A;  2LXP C;  4NN2 A;  5FB1 A;  4ZUX U;  1VFY A;  2VPB A;  4AUQ B;  3C6W A;  2FOO A;  4O64 A;  1F62 A;  3O35 A;  1RMD A;  4FO9 A;  1CA9 A;  2OXQ C;  3L1X A;  3QZV A;  4FIP A;  4PTB A;  5LKT A;  2A25 A;  2CKL A;  2ECV A;  2ECJ A;  2EA6 A;  4UP5 A;  4K8U A;  4YSI A;  2PUY A;  2JMD A;  2YQL A;  2MUM A;  5AIU A;  5FEY A;  2LDR A;  1LB4 A;  2H0D A;  3PHD A;  5FER A;  3O70 A;  3ASL A;  4N4F A;  2KU3 A;  4YAX A;  3GL6 A;  1CZY A;  2G43 A;  5B8D A;  2XB1 A;  3IVQ A;  2F6J A;  2FUI A;  4AVX A;  3HTK C;  4A4C A;  1D0J A;  3KV6 A;  5KH9 A;  5TDW A;  1VD4 A;  3HQH A;  2G6Q A;  3ZYQ A;  2MNZ A;  5DIN A;  4TKP B;  1WEE A;  2YU4 A;  4V3L C;  1X4U A;  4BHW A;  1WGM A;  2QIC A;  4AP4 A;  2MT5 A;  4LJN A;  2MD7 B;  2F42 A;  4L58 A;  2HYE D;  2KWK A;  2VPD A;  1U6G B;  2MNY A;  2JMJ A;  4GNG A;  1XWH A;  2F1Z A;  1VYX A;  2KIZ A;  4AYC A;  1D00 A;  3N9Q A;  5DKA A;  2YHN A;  1D01 A;  5J3X A;  4YC9 A;  4XI1 A;  3SHB A;  1WIL A;  2EOD A;  3PUR A;  2NAA A;  4CCG X;  5TAB A;  2VJF B;  3MQS C;  1FLL A;  2CSZ A;  1L0A A;  5G04 B;  2L43 A;  3EB6 A;  2JRJ A;  4MVT A;  2KYU A;  2VPG A;  2Y1M A;  1LDJ B;  2DX8 A;  4I7D A;  2FSA A;  4PPE A;  5H1V A;  2MA5 A;  5KH3 A;  2VJE A;  5H1U A;  4GHU A;  3ZPV E;  4GWM A;  3ZNI A;  2LRI C;  2RSD A;  1E4U A;  1JM7 B;  2C2V S;  3HCS A;  5LKU A;  3VK6 A;  4P5O B;  1IYM A;  3O7A A;  1MM3 A;  4M4E A;  2I50 A;  5G05 B;  2YYR A;  2ECT A;  1V87 A;  2LGV A;  1WEP A;  3SOU A;  2Y43 A;  5TBN A;  4A4B A;  4YAB A;  5G0F A;  2KWN A;  3RPG C;  2FOJ A;  1FP0 A;  4LK9 A;  5B79 A;  4ZQL A;  3I2D A;  1WE9 A;  3N9P A;  1HYI A;  2UZG A;  4GWN A;  3O34 A;  2M3H A;  1D0A A;  2YW8 A;  2G45 A;  3V43 A;  4JJQ A;  5B75 A;  2KRE A;  4UP0 A;  5H1T A;  4IC2 A;  3GV4 A;  1YY6 A;  3LQH A;  4F52 B;  1T1H A;  2VP7 A;  1WEV A;  2KGG A;  1K2F A;  4WZ2 A;  5D1M B;  4A0C D;  5D1L B;  2L5U A; 
#chains in the Genus database with same CATH topology
 4FK5 A;  2D8S A;  2YSJ A;  4X3G A;  4H9D A;  4IC3 A;  1CA4 A;  4F1P A;  1LDK C;  2EGM A;  2JMI A;  5FB0 A;  2F1W A;  3ZTG A;  1WIM A;  2FD4 A;  1Z6U A;  2OWA A;  5TDR A;  4Z8M A;  3MHH A;  4ZDT A;  2AN6 A;  1ZMS A;  2DSM A;  3L1Z B;  4S3O B;  2F1X A;  4V3K C;  2EGP A;  3LRQ A;  3HU6 A;  5JG6 A;  2MIQ A;  3L11 A;  4I7C A;  1YZE A;  3FL2 A;  3N9M A;  2KKX A;  4LAD B;  2Y1N A;  1N87 A;  2LV9 A;  3SOW A;  3HSV A;  2E6R A;  3O47 A;  3DPL R;  4GB0 A;  4N3W A;  3U5M A;  2LGL A;  2LXH C;  3FJU B;  1WES A;  1BOR A;  4R7E A;  5C13 A;  1WEU A;  4MSX A;  2FFW A;  3NG2 A;  4S3O C;  4KG9 A;  2M1R A;  2DJA A;  2YVR A;  2K1J A;  2F1Y A;  1JOC A;  2K16 A;  4WZ3 B;  2XXN A;  3RTR B;  2KFT A;  2CSY A;  2PNX A;  3T6R A;  2M6M A;  1F3V B;  3ZJB A;  1ZBD B;  5KH7 A;  1QSC A;  4WA6 A;  3O36 A;  4QQ4 A;  4GNF A;  2LAU A;  2FUU A;  2LN0 A;  2XEU A;  3LVR E;  2RI7 A;  5LKX A;  1MBM A;  3ZPV 1;  2L75 A;  1HYJ A;  4W4U A;  4YAD A;  2VPE A;  4R2Y A;  3T7L A;  1RF3 A;  4GJH A;  5LKZ A;  3ZVY A;  4A49 A;  4LKA A;  4YBT A;  2XOY A;  2LGK A;  4FJC A;  5B76 A;  5AIT A;  5EYA F;  2ZET C;  2KWJ A;  1JM7 A;  2YQM A;  1LB5 A;  2KWO A;  1WFK A;  3C5K A;  2VNF A;  3N9L A;  4WZ0 A;  2YSM A;  2KE1 A;  2FOP A;  3HQL A;  3M99 A;  2C2L A;  4Q6F A;  3KV5 A;  3PLW A;  4BBQ A;  3LDY A;  3HCT A;  3HCU A;  1CZZ A;  4Z0O A;  2HDP A;  4R8P K;  2VJF A;  1KZZ A;  3RPG B;  1DVP A;  2CRR A;  2YUC A;  3O37 A;  1CHC A;  2GKW A;  4YBS A;  2LGG A;  3Q1D A;  5B77 A;  3M62 A;  2M85 A;  5LCW B;  4AYC B;  2VJE B;  4O1V A;  3U5N A;  3U5P A;  4B7Y C;  2YT5 A;  2L0B A;  3LQI A;  4LLB A;  2LQ6 A;  2ECI A;  2KGI A;  1Z2Q A;  2KR4 A;  2CR2 A;  2ECW A;  5H9M A;  1WEO A;  2QJ0 A;  2K4D A;  2QIZ A;  3SOX A;  2CT2 A;  3IVB A;  4C9Z A;  4UI9 B;  3U5O A;  1WEM A;  3FM8 C;  2ECN A;  3N9N A;  3MHS A;  5D1K B;  4YBM A;  3ZVZ B;  3IHP A;  3FAO A;  3O33 A;  2E6S A;  4B86 C;  3M63 A;  3KQI A;  2YHO A;  3DQV R;  1X4I A;  4GNE A;  4QF3 A;  1LB6 A;  4CA1 A;  3KNV A;  1FBV A;  5E1T A;  1FLK A;  2L80 A;  4YAT A;  2XOC A;  5I3L A;  3E2D A;  1WEW A;  2CKL B;  2M13 A;  3LJU X;  3JUE A;  3EB5 A;  3HQM A;  4QF2 A;  5C11 A;  3MQR A;  1MM2 A;  5B78 A;  2ECG A;  2IQJ A;  3N9O A;  3IVV A;  3SUB A;  2YUR A;  2D8U A;  3PUQ A;  1G25 A;  1Z60 A;  2F6N A;  3LQJ A;  2H0D B;  2K17 A;  2YRE A;  2MA6 A;  4I7B A;  4GND A;  5TRB A;  2MD8 C;  2IDA A;  4L7X A;  1WEN A;  3HQI A;  2BAY A;  1WEQ A;  1X4J A;  5SVI B;  2LXP C;  4NN2 A;  5FB1 A;  4ZUX U;  1VFY A;  2VPB A;  4AUQ B;  5SVY A;  3C6W A;  2FOO A;  4O64 A;  1F62 A;  2B0O E;  3O35 A;  1RMD A;  2EXU A;  4FO9 A;  2E61 A;  1CA9 A;  2OXQ C;  3L1X A;  3QZV A;  4FIP A;  4PTB A;  5LKT A;  2L7P A;  2A25 A;  2CKL A;  3H7H A;  2ECV A;  2ECJ A;  2EA6 A;  4UP5 A;  4K8U A;  4YSI A;  2PUY A;  2JMD A;  2YQL A;  2MUM A;  5AIU A;  5FEY A;  2LDR A;  1LB4 A;  3LVQ E;  2H0D A;  3PHD A;  5FER A;  3O70 A;  3ASL A;  4N4F A;  2KU3 A;  4YAX A;  3GL6 A;  4O62 A;  1CZY A;  2G43 A;  5B8D A;  2XB1 A;  3IVQ A;  2F6J A;  2FUI A;  3T9K A;  4AVX A;  3HTK C;  4A4C A;  1D0J A;  3KV6 A;  5KH9 A;  5TDW A;  1VD4 A;  3HQH A;  2G6Q A;  3ZYQ A;  2MNZ A;  5DIN A;  2P57 A;  3DWD A;  4TKP B;  1WEE A;  2YU4 A;  4V3L C;  2CRW A;  1X4U A;  4BHW A;  2CSV A;  1WGM A;  3FAN A;  2QIC A;  4AP4 A;  2MT5 A;  4LJN A;  2MD7 B;  2F42 A;  4L58 A;  2HYE D;  2KWK A;  2VPD A;  2KKY A;  1U6G B;  2MNY A;  2JMJ A;  4GNG A;  1XWH A;  5SVX A;  2F1Z A;  1VYX A;  2KIZ A;  4AYC A;  1D00 A;  3N9Q A;  5DKA A;  2YHN A;  1D01 A;  5J3X A;  4OGE A;  4YC9 A;  4XI1 A;  2JM3 A;  3SHB A;  1WIL A;  2EOD A;  3PUR A;  2XOZ A;  2NAA A;  2JUN A;  4CCG X;  5TAB A;  2RR4 A;  5K3Q A;  2VJF B;  3MQS C;  1FLL A;  2CSZ A;  1L0A A;  5G04 B;  1DCQ A;  5SVI A;  2L43 A;  3KDE C;  3EB6 A;  2JRJ A;  4MVT A;  2KYU A;  2MKE A;  2VPG A;  2CON A;  2Y1M A;  1LDJ B;  2DX8 A;  4I7D A;  2FSA A;  4PPE A;  5H1V A;  2MA5 A;  5KH3 A;  2VJE A;  2XP0 A;  5H1U A;  4GHU A;  3ZPV E;  4GWM A;  3ZNI A;  2LRI C;  2RSD A;  1E4U A;  1JM7 B;  2C2V S;  3HCS A;  3MDB C;  5LKU A;  3VK6 A;  3DDT A;  4P5O B;  3FEH A;  1IYM A;  3O7A A;  1MM3 A;  4M4E A;  2I50 A;  5G05 B;  2YYR A;  2ECT A;  1V87 A;  2LGV A;  1WEP A;  3SOU A;  2Y43 A;  5TBN A;  4A4B A;  4YAB A;  3M7K A;  5G0F A;  2KWN A;  3RPG C;  2FOJ A;  1FP0 A;  4OGC A;  4LK9 A;  5B79 A;  4ZQL A;  3I2D A;  1WE9 A;  3N9P A;  1HYI A;  2UZG A;  4GWN A;  3O34 A;  2M3H A;  1D0A A;  2YW8 A;  2G45 A;  3V43 A;  4JJQ A;  5B75 A;  2KRE A;  4UP0 A;  5H1T A;  4IC2 A;  3GV4 A;  1YY6 A;  3LQH A;  4F52 B;  1T1H A;  2VP7 A;  1WEV A;  2KGG A;  1K2F A;  4WZ2 A;  5D1M B;  4A0C D;  5D1L B;  4Z0R A;  2L5U A; 
#chains in the Genus database with same CATH homology
 4FK5 A;  2D8S A;  2YSJ A;  4X3G A;  4IC3 A;  1CA4 A;  1LDK C;  2JMI A;  5FB0 A;  2F1W A;  3ZTG A;  1WIM A;  1Z6U A;  5TDR A;  4Z8M A;  3MHH A;  4ZDT A;  2AN6 A;  1ZMS A;  3L1Z B;  4S3O B;  2F1X A;  4V3K C;  2EGP A;  3LRQ A;  3HU6 A;  5JG6 A;  2MIQ A;  3L11 A;  4I7C A;  1YZE A;  3FL2 A;  3N9M A;  4LAD B;  2Y1N A;  1N87 A;  2LV9 A;  3SOW A;  3HSV A;  2E6R A;  3DPL R;  4GB0 A;  4N3W A;  3U5M A;  2LGL A;  2LXH C;  1WES A;  1BOR A;  4R7E A;  5C13 A;  1WEU A;  4MSX A;  3NG2 A;  4S3O C;  4KG9 A;  2M1R A;  2K1J A;  2F1Y A;  1JOC A;  2K16 A;  4WZ3 B;  2XXN A;  3RTR B;  2KFT A;  2CSY A;  2PNX A;  3T6R A;  2M6M A;  1F3V B;  3ZJB A;  1ZBD B;  5KH7 A;  1QSC A;  4WA6 A;  3O36 A;  4GNF A;  2FUU A;  2LN0 A;  2XEU A;  2RI7 A;  5LKX A;  3ZPV 1;  2L75 A;  1HYJ A;  4W4U A;  4YAD A;  2VPE A;  4R2Y A;  3T7L A;  1RF3 A;  4GJH A;  5LKZ A;  3ZVY A;  4A49 A;  4LKA A;  4YBT A;  2LGK A;  4FJC A;  5B76 A;  5AIT A;  5EYA F;  2ZET C;  2KWJ A;  1JM7 A;  2YQM A;  1LB5 A;  2KWO A;  1WFK A;  3C5K A;  2VNF A;  3N9L A;  4WZ0 A;  2YSM A;  2KE1 A;  2FOP A;  3HQL A;  3M99 A;  2C2L A;  4Q6F A;  3KV5 A;  4BBQ A;  3HCT A;  3HCU A;  1CZZ A;  2HDP A;  4R8P K;  2VJF A;  1KZZ A;  3RPG B;  1DVP A;  2YUC A;  3O37 A;  1CHC A;  2GKW A;  4YBS A;  2LGG A;  5B77 A;  3M62 A;  2M85 A;  5LCW B;  4AYC B;  2VJE B;  4O1V A;  3U5N A;  3U5P A;  4B7Y C;  2YT5 A;  2L0B A;  3LQI A;  4LLB A;  2LQ6 A;  2ECI A;  2KGI A;  1Z2Q A;  2KR4 A;  2CR2 A;  2ECW A;  5H9M A;  1WEO A;  2QJ0 A;  2K4D A;  2QIZ A;  3SOX A;  2CT2 A;  3IVB A;  4C9Z A;  4UI9 B;  3U5O A;  1WEM A;  2ECN A;  3N9N A;  3MHS A;  5D1K B;  4YBM A;  3ZVZ B;  3IHP A;  3O33 A;  2E6S A;  4B86 C;  3M63 A;  3KQI A;  2YHO A;  3DQV R;  1X4I A;  4GNE A;  4QF3 A;  1LB6 A;  4CA1 A;  3KNV A;  1FBV A;  5E1T A;  1FLK A;  2L80 A;  4YAT A;  5I3L A;  1WEW A;  2CKL B;  3EB5 A;  3HQM A;  4QF2 A;  5C11 A;  3MQR A;  1MM2 A;  5B78 A;  2ECG A;  3N9O A;  3IVV A;  2YUR A;  3PUQ A;  1G25 A;  1Z60 A;  2F6N A;  3LQJ A;  2H0D B;  2K17 A;  2YRE A;  2MA6 A;  4I7B A;  4GND A;  5TRB A;  2MD8 C;  2IDA A;  4L7X A;  1WEN A;  3HQI A;  2BAY A;  1WEQ A;  1X4J A;  2LXP C;  4NN2 A;  5FB1 A;  4ZUX U;  1VFY A;  2VPB A;  4AUQ B;  3C6W A;  2FOO A;  4O64 A;  1F62 A;  3O35 A;  1RMD A;  4FO9 A;  1CA9 A;  2OXQ C;  3L1X A;  3QZV A;  4FIP A;  4PTB A;  5LKT A;  2A25 A;  2CKL A;  2ECV A;  2ECJ A;  2EA6 A;  4UP5 A;  4K8U A;  4YSI A;  2PUY A;  2JMD A;  2YQL A;  2MUM A;  5AIU A;  5FEY A;  2LDR A;  1LB4 A;  2H0D A;  3PHD A;  5FER A;  3O70 A;  3ASL A;  4N4F A;  2KU3 A;  4YAX A;  3GL6 A;  1CZY A;  2G43 A;  5B8D A;  2XB1 A;  3IVQ A;  2F6J A;  2FUI A;  4AVX A;  3HTK C;  4A4C A;  1D0J A;  3KV6 A;  5KH9 A;  5TDW A;  1VD4 A;  3HQH A;  2G6Q A;  3ZYQ A;  2MNZ A;  5DIN A;  4TKP B;  1WEE A;  2YU4 A;  4V3L C;  1X4U A;  4BHW A;  1WGM A;  2QIC A;  4AP4 A;  2MT5 A;  4LJN A;  2MD7 B;  2F42 A;  4L58 A;  2HYE D;  2KWK A;  2VPD A;  1U6G B;  2MNY A;  2JMJ A;  4GNG A;  1XWH A;  2F1Z A;  1VYX A;  2KIZ A;  4AYC A;  1D00 A;  3N9Q A;  5DKA A;  2YHN A;  1D01 A;  5J3X A;  4YC9 A;  4XI1 A;  3SHB A;  1WIL A;  2EOD A;  3PUR A;  2NAA A;  4CCG X;  5TAB A;  2VJF B;  3MQS C;  1FLL A;  2CSZ A;  1L0A A;  5G04 B;  2L43 A;  3EB6 A;  2JRJ A;  4MVT A;  2KYU A;  2VPG A;  2Y1M A;  1LDJ B;  2DX8 A;  4I7D A;  2FSA A;  4PPE A;  5H1V A;  2MA5 A;  5KH3 A;  2VJE A;  5H1U A;  4GHU A;  3ZPV E;  4GWM A;  3ZNI A;  2LRI C;  2RSD A;  1E4U A;  1JM7 B;  2C2V S;  3HCS A;  5LKU A;  3VK6 A;  4P5O B;  1IYM A;  3O7A A;  1MM3 A;  4M4E A;  2I50 A;  5G05 B;  2YYR A;  2ECT A;  1V87 A;  2LGV A;  1WEP A;  3SOU A;  2Y43 A;  5TBN A;  4A4B A;  4YAB A;  5G0F A;  2KWN A;  3RPG C;  2FOJ A;  1FP0 A;  4LK9 A;  5B79 A;  4ZQL A;  3I2D A;  1WE9 A;  3N9P A;  1HYI A;  2UZG A;  4GWN A;  3O34 A;  2M3H A;  1D0A A;  2YW8 A;  2G45 A;  3V43 A;  4JJQ A;  5B75 A;  2KRE A;  4UP0 A;  5H1T A;  4IC2 A;  3GV4 A;  1YY6 A;  3LQH A;  4F52 B;  1T1H A;  2VP7 A;  1WEV A;  2KGG A;  1K2F A;  4WZ2 A;  5D1M B;  4A0C D;  5D1L B;  2L5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...