4I7DA

Siah1 bound to synthetic peptide (ace)klrpvamvrp(prk)vr
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
187
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 45
structure length 187
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7dA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7dA01
4GJHA 2VPEA 1V87A 2L0BA 5H9MA 4GHUA 4AUQB 3SOWA 2VPBA 4F52B 1MM3A 2FOPA 5FEYA 4BHWA 5C13A 2YT5A 1K2FA 3IVVA 3DQVR 5I3LA 1D0JA 1FBVA 5LKUA 2CKLB 4ZUXU 2LN0A 4TKPB 4PPEA 3HQLA 4CCGX 1X4UA 2YREA 3HCSA 2YSJA 4CA1A 3O35A 2VPDA 3KV6A 4UP0A 1BORA 2K17A 2CKLA 2YUCA 2LDRA 4YBSA 3HCUA 5AIUA 1CA9A 3T6RA 2M85A 2KGIA 4P5OB 3HCTA 3LQHA 3ZVYA 2JMIA 4S3OC 4QF2A 4NN2A 2PUYA 2F1YA 5B76A 2YURA 3VK6A 2QJ0A 1CA4A 4LKAA 2OXQC 4GWNA 2UZGA 3NG2A 3PURA 3MHHA 2KWJA 3LRQA 4MSXA 3LQIA 2MUMA 3U5NA 4ZQLA 2MT5A 3RPGB 4B86C 2C2VS 2K4DA 5B8DA 1LB5A 2JMJA 2YQLA 3PUQA 1DVPA 4WA6A 1WESA 5LKXA 4V3KC 5TBNA 1LDJB 1VFYA 4YATA 4LJNA 3SOXA 1QSCA 2NAAA 2KIZA 5G05B 5FB0A 2E6RA 5H1VA 2YW8A 3N9MA 5KH3A 2KE1A 3N9OA 2MNYA 1ZMSA 4LK9A 2KYUA 1WILA 1WEMA 3EB5A 2IDAA 4ZDTA 5H1TA 3SHBA 4L7XA 3N9NA 4W4UA 2CR2A 1U6GB 3I2DA 1N87A 1D0AA 1Z2QA 1F62A 2ECTA 4WZ3B 1YY6A 3EB6A 3L1ZB 4FO9A 2VJFB 4IC2A 1F3VB 5FERA 5J3XA 1E4UA 5AITA 5LCWB 3O33A 3IHPA 4LLBA 4GB0A 4GNGA 1RF3A 4IC3A 2PNXA 2M1RA 2MA6A 5TDRA 4UP5A 5B77A 2KU3A 2YQMA 2VJFA 2XB1A 4YAXA 2HYED 3L1XA 1LDKC 3ZYQA 2FUUA 3N9LA 1ZBDB 4I7DA 2CSYA 2LGLA 4V3LC 4C9ZA 1WEOA 3O7AA 5LKZA 4A0CD 3DPLR 4AP4A 4B7YC 2CSZA 3HSVA 1IYMA 2CT2A 2ECJA 2KGGA 3T7LA 5KH9A 4AYCB 2YSMA 3C5KA 1CHCA 3C6WA 3PHDA 1FP0A 4YBMA 3MHSA 3GV4A 2L5UA 4S3OB 4Z8MA 1HYIA 2BAYA 2F1XA 5B79A 1Z6UA 4YSIA 2VP7A 2KWKA 5D1LB 3L11A 2K16A 4AVXA 2GKWA 4M4EA 3ZVZB 4AYCA 4KG9A 2ECVA 2A25A 2QIZA 2LGKA 4FJCA 4FIPA 2LXPC 5DKAA 2LXHC 4FK5A 2ZETC 1KZZA 4O1VA 1WEQA 4R8PK 2MD7B 4YABA 2YU4A 4GNFA 3V43A 2C2LA 2VJEB 2MIQA 4N3WA 1YZEA 3M99A 2FSAA 1RMDA 2G43A 2L75A 3ASLA 2F6NA 1WEPA 1WIMA 3MQSC 2Y1NA 3N9PA 1FLLA 1Z60A 2FUIA 2VJEA 4GNEA 1JM7B 5E1TA 5TDWA 5H1UA 2M3HA 4A4BA 2EA6A 1VD4A 3U5MA 1HYJA 2MNZA 2KWOA 1MM2A 2Y43A 2JMDA 2HDPA 1JM7A 5EYAF 2MA5A 2H0DB 3KQIA 3HQHA 5TABA 3KNVA 5C11A 4YC9A 2LRIC 3ZPVE 1T1HA 4R2YA 2FOOA 5LKTA 1JOCA 4N4FA 3QZVA 4UI9B 3RTRB 2F1ZA 1X4IA 2H0DA 5G0FA 5B78A 2LV9A 2ECIA 1G25A 5D1MB 2FOJA 2M6MA 5JG6A 1X4JA 1XWHA 2K1JA 3LQJA 2F1WA 1LB4A 4I7CA 2D8SA 2I50A 2F6JA 1LB6A 3IVBA 4O64A 3ZTGA 4A49A 4QF3A 2AN6A 2ECGA 2YHNA 2F42A 1WEWA 3ZPV1 3HQMA 4K8UA 3GL6A 2JRJA 3ZNIA 1WFKA 2EGPA 1CZYA 1D01A 2YHOA 4R7EA 2VNFA 3SOUA 3O34A 2KFTA 2EODA 2KR4A 3IVQA 3U5PA 4Q6FA 4BBQA 3MQRA 1WEVA 1WE9A 3ZJBA 1WGMA 2LQ6A 3RPGC 5DINA 2KWNA 1VYXA 2XEUA 3O70A 3KV5A 2Y1MA 4WZ2A 4LADB 2L80A 4YADA 5B75A 1CZZA 2ECWA 2QICA 4JJQA 3O37A 2YYRA 4GWMA 2VPGA 5G04B 3M62A 2RI7A 3U5OA 2RSDA 2L43A 4YBTA 4I7BA 1WENA 3O36A 1WEEA 4X3GA 1L0AA 5D1KB 1D00A 2ECNA 3HTKC 4MVTA 2DX8A 3FL2A 4WZ0A 2MD8C 4L58A 2E6SA 2LGGA 2XXNA 4GNDA 4XI1A 2LGVA 1WEUA 3M63A 5TRBA 1FLKA 3HQIA 5KH7A 2KREA 2G6QA 2G45A 3N9QA 4PTBA 4A4CA 5FB1A 3HU6A
chains in the Genus database with same CATH superfamily
4GJHA 2VPEA 1V87A 2L0BA 5H9MA 4GHUA 4AUQB 3FEHA 2YVRA 3SOWA 2VPBA 4F52B 1MM3A 2FOPA 5FEYA 4BHWA 5C13A 2YT5A 1K2FA 3IVVA 3DQVR 5I3LA 1D0JA 1FBVA 5LKUA 2M13A 2CKLB 4ZUXU 2LN0A 4TKPB 4PPEA 3HQLA 4CCGX 1X4UA 2YREA 3HCSA 4Z0OA 2YSJA 4CA1A 3O35A 2VPDA 3KV6A 4UP0A 1BORA 2K17A 2CKLA 2XOYA 2YUCA 2LDRA 4YBSA 2XP0A 3HCUA 5AIUA 1CA9A 3T6RA 2M85A 2JUNA 2KGIA 4P5OB 2EXUA 3HCTA 3LQHA 3ZVYA 2JMIA 4S3OC 2FFWA 4QF2A 4NN2A 2PUYA 2F1YA 5B76A 2YURA 2KKXA 3VK6A 2QJ0A 1CA4A 4LKAA 2CONA 2OXQC 4GWNA 2UZGA 3NG2A 3PURA 3MHHA 2KWJA 3LRQA 4MSXA 3LQIA 5SVXA 2MUMA 3U5NA 4ZQLA 2MT5A 3RPGB 3FJUB 4B86C 3LVQE 2C2VS 2K4DA 5B8DA 2P57A 1LB5A 2JMJA 2YQLA 3PUQA 1DVPA 4WA6A 1WESA 5LKXA 2XOZA 4V3KC 5TBNA 1LDJB 1VFYA 2JM3A 4YATA 4LJNA 3SOXA 1QSCA 2NAAA 2KIZA 5G05B 5FB0A 2E6RA 5H1VA 2YW8A 3N9MA 5KH3A 2KE1A 3N9OA 2MNYA 1ZMSA 4LK9A 2KYUA 1WILA 1WEMA 3EB5A 2CRWA 2IDAA 4ZDTA 5H1TA 3SHBA 4L7XA 3N9NA 4W4UA 3O47A 5K3QA 2CR2A 1U6GB 3I2DA 1N87A 1D0AA 4O62A 1Z2QA 1F62A 2ECTA 4OGEA 4WZ3B 1YY6A 3EB6A 3L1ZB 4FO9A 2VJFB 4IC2A 1F3VB 5FERA 5J3XA 1E4UA 5AITA 5LCWB 2RR4A 3O33A 3IHPA 4LLBA 4GB0A 4GNGA 1RF3A 2LAUA 4IC3A 2PNXA 2M1RA 2MA6A 2EGMA 1DCQA 5TDRA 4UP5A 5B77A 2KU3A 2YQMA 2VJFA 2B0OE 2XB1A 4YAXA 2HYED 3L1XA 3E2DA 1LDKC 3ZYQA 2DJAA 2FUUA 3N9LA 1ZBDB 3Q1DA 3DWDA 4I7DA 2CSYA 2CRRA 2LGLA 4V3LC 4C9ZA 1WEOA 3O7AA 3T9KA 5LKZA 4A0CD 2DSMA 3DPLR 4AP4A 4B7YC 2CSZA 3HSVA 1IYMA 2CT2A 2ECJA 2KGGA 3T7LA 5KH9A 4AYCB 2YSMA 3C5KA 1CHCA 4H9DA 3C6WA 3PHDA 1FP0A 4YBMA 3MHSA 3SUBA 3GV4A 2L5UA 4S3OB 4Z8MA 1HYIA 3PLWA 2BAYA 2F1XA 5B79A 1Z6UA 4YSIA 2VP7A 2KWKA 5D1LB 3L11A 2K16A 4AVXA 2GKWA 4M4EA 3ZVZB 4AYCA 4KG9A 2ECVA 2A25A 2QIZA 2LGKA 4FJCA 2D8UA 2LXPC 4FIPA 5DKAA 2LXHC 4FK5A 2E61A 3FM8C 2ZETC 1KZZA 4O1VA 1WEQA 4R8PK 4OGCA 2MD7B 4YABA 2YU4A 4GNFA 5SVYA 3V43A 2C2LA 2VJEB 2MIQA 4N3WA 1YZEA 3M99A 2FSAA 1RMDA 2G43A 2L75A 3ASLA 2F6NA 1WEPA 1WIMA 3MQSC 2Y1NA 3N9PA 1FLLA 1Z60A 2FUIA 2VJEA 4GNEA 1JM7B 5E1TA 5TDWA 5H1UA 2M3HA 4A4BA 2EA6A 1VD4A 3U5MA 1HYJA 2MNZA 2KWOA 1MM2A 2Y43A 2JMDA 2HDPA 1JM7A 5EYAF 3DDTA 2MA5A 2H0DB 3KQIA 3HQHA 5TABA 3KNVA 5C11A 4YC9A 2LRIC 3ZPVE 1T1HA 4R2YA 2FOOA 5LKTA 1JOCA 4N4FA 3H7HA 3QZVA 4UI9B 3RTRB 2CSVA 2F1ZA 1X4IA 2H0DA 5G0FA 5B78A 3MDBC 2LV9A 2ECIA 1G25A 5D1MB 2FOJA 2M6MA 5JG6A 1X4JA 1XWHA 2K1JA 3LQJA 2F1WA 1LB4A 4I7CA 2D8SA 2I50A 2F6JA 5SVIB 1LB6A 3IVBA 4O64A 4Z0RA 3ZTGA 4A49A 4QF3A 2AN6A 2ECGA 2YHNA 4QQ4A 2F42A 1WEWA 3JUEA 3ZPV1 3HQMA 4K8UA 3GL6A 5SVIA 2JRJA 3ZNIA 1WFKA 2EGPA 2XOCA 1CZYA 1D01A 2YHOA 4R7EA 2VNFA 3SOUA 3O34A 2KFTA 2EODA 2KR4A 3IVQA 3FANA 3U5PA 4Q6FA 2OWAA 4BBQA 3MQRA 1WEVA 3M7KA 1WE9A 2L7PA 3ZJBA 2MKEA 1WGMA 2LQ6A 3RPGC 5DINA 2KWNA 1VYXA 2XEUA 4F1PA 3O70A 2IQJA 3KV5A 3KDEC 2Y1MA 4WZ2A 4LADB 2L80A 4YADA 5B75A 3FAOA 1CZZA 2ECWA 2FD4A 2QICA 4JJQA 3O37A 2YYRA 4GWMA 2VPGA 5G04B 3M62A 2RI7A 3U5OA 2RSDA 2L43A 4YBTA 4I7BA 1WENA 3O36A 1WEEA 4X3GA 1L0AA 5D1KB 1D00A 2ECNA 3HTKC 4MVTA 2DX8A 2KKYA 3FL2A 4WZ0A 3LJUX 2MD8C 4L58A 2E6SA 2LGGA 2XXNA 4GNDA 1MBMA 4XI1A 2LGVA 1WEUA 3M63A 5TRBA 1FLKA 3HQIA 3LVRE 5KH7A 2KREA 3LDYA 2G6QA 2G45A 3N9QA 4PTBA 4A4CA 5FB1A 3HU6A
chains in the Genus database with same CATH topology
4GJHA 2VPEA 1V87A 2L0BA 5H9MA 4GHUA 4AUQB 3SOWA 2VPBA 4F52B 1MM3A 2FOPA 5FEYA 4BHWA 5C13A 2YT5A 1K2FA 3IVVA 3DQVR 5I3LA 1D0JA 1FBVA 5LKUA 2CKLB 4ZUXU 2LN0A 4TKPB 4PPEA 3HQLA 4CCGX 1X4UA 2YREA 3HCSA 2YSJA 4CA1A 3O35A 2VPDA 3KV6A 4UP0A 1BORA 2K17A 2CKLA 2YUCA 2LDRA 4YBSA 3HCUA 5AIUA 1CA9A 3T6RA 2M85A 2KGIA 4P5OB 3HCTA 3LQHA 3ZVYA 2JMIA 4S3OC 4QF2A 4NN2A 2PUYA 2F1YA 5B76A 2YURA 3VK6A 2QJ0A 1CA4A 4LKAA 2OXQC 4GWNA 2UZGA 3NG2A 3PURA 3MHHA 2KWJA 3LRQA 4MSXA 3LQIA 2MUMA 3U5NA 4ZQLA 2MT5A 3RPGB 4B86C 2C2VS 2K4DA 5B8DA 1LB5A 2JMJA 2YQLA 3PUQA 1DVPA 4WA6A 1WESA 5LKXA 4V3KC 5TBNA 1LDJB 1VFYA 4YATA 4LJNA 3SOXA 1QSCA 2NAAA 2KIZA 5G05B 5FB0A 2E6RA 5H1VA 2YW8A 3N9MA 5KH3A 2KE1A 3N9OA 2MNYA 1ZMSA 4LK9A 2KYUA 1WILA 1WEMA 3EB5A 2IDAA 4ZDTA 5H1TA 3SHBA 4L7XA 3N9NA 4W4UA 2CR2A 1U6GB 3I2DA 1N87A 1D0AA 1Z2QA 1F62A 2ECTA 4WZ3B 1YY6A 3EB6A 3L1ZB 4FO9A 2VJFB 4IC2A 1F3VB 5FERA 5J3XA 1E4UA 5AITA 5LCWB 3O33A 3IHPA 4LLBA 4GB0A 4GNGA 1RF3A 4IC3A 2PNXA 2M1RA 2MA6A 5TDRA 4UP5A 5B77A 2KU3A 2YQMA 2VJFA 2XB1A 4YAXA 2HYED 3L1XA 1LDKC 3ZYQA 2FUUA 3N9LA 1ZBDB 4I7DA 2CSYA 2LGLA 4V3LC 4C9ZA 1WEOA 3O7AA 5LKZA 4A0CD 3DPLR 4AP4A 4B7YC 2CSZA 3HSVA 1IYMA 2CT2A 2ECJA 2KGGA 3T7LA 5KH9A 4AYCB 2YSMA 3C5KA 1CHCA 3C6WA 3PHDA 1FP0A 4YBMA 3MHSA 3GV4A 2L5UA 4S3OB 4Z8MA 1HYIA 2BAYA 2F1XA 5B79A 1Z6UA 4YSIA 2VP7A 2KWKA 5D1LB 3L11A 2K16A 4AVXA 2GKWA 4M4EA 3ZVZB 4AYCA 4KG9A 2ECVA 2A25A 2QIZA 2LGKA 4FJCA 4FIPA 2LXPC 5DKAA 2LXHC 4FK5A 2ZETC 1KZZA 4O1VA 1WEQA 4R8PK 2MD7B 4YABA 2YU4A 4GNFA 3V43A 2C2LA 2VJEB 2MIQA 4N3WA 1YZEA 3M99A 2FSAA 1RMDA 2G43A 2L75A 3ASLA 2F6NA 1WEPA 1WIMA 3MQSC 2Y1NA 3N9PA 1FLLA 1Z60A 2FUIA 2VJEA 4GNEA 1JM7B 5E1TA 5TDWA 5H1UA 2M3HA 4A4BA 2EA6A 1VD4A 3U5MA 1HYJA 2MNZA 2KWOA 1MM2A 2Y43A 2JMDA 2HDPA 1JM7A 5EYAF 2MA5A 2H0DB 3KQIA 3HQHA 5TABA 3KNVA 5C11A 4YC9A 2LRIC 3ZPVE 1T1HA 4R2YA 2FOOA 5LKTA 1JOCA 4N4FA 3QZVA 4UI9B 3RTRB 2F1ZA 1X4IA 2H0DA 5G0FA 5B78A 2LV9A 2ECIA 1G25A 5D1MB 2FOJA 2M6MA 5JG6A 1X4JA 1XWHA 2K1JA 3LQJA 2F1WA 1LB4A 4I7CA 2D8SA 2I50A 2F6JA 1LB6A 3IVBA 4O64A 3ZTGA 4A49A 4QF3A 2AN6A 2ECGA 2YHNA 2F42A 1WEWA 3ZPV1 3HQMA 4K8UA 3GL6A 2JRJA 3ZNIA 1WFKA 2EGPA 1CZYA 1D01A 2YHOA 4R7EA 2VNFA 3SOUA 3O34A 2KFTA 2EODA 2KR4A 3IVQA 3U5PA 4Q6FA 4BBQA 3MQRA 1WEVA 1WE9A 3ZJBA 1WGMA 2LQ6A 3RPGC 5DINA 2KWNA 1VYXA 2XEUA 3O70A 3KV5A 2Y1MA 4WZ2A 4LADB 2L80A 4YADA 5B75A 1CZZA 2ECWA 2QICA 4JJQA 3O37A 2YYRA 4GWMA 2VPGA 5G04B 3M62A 2RI7A 3U5OA 2RSDA 2L43A 4YBTA 4I7BA 1WENA 3O36A 1WEEA 4X3GA 1L0AA 5D1KB 1D00A 2ECNA 3HTKC 4MVTA 2DX8A 3FL2A 4WZ0A 2MD8C 4L58A 2E6SA 2LGGA 2XXNA 4GNDA 4XI1A 2LGVA 1WEUA 3M63A 5TRBA 1FLKA 3HQIA 5KH7A 2KREA 2G6QA 2G45A 3N9QA 4PTBA 4A4CA 5FB1A 3HU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GJH A;  2VPE A;  1V87 A;  2L0B A;  5H9M A;  4GHU A;  4AUQ B;  3SOW A;  2VPB A;  4F52 B;  1MM3 A;  2FOP A;  5FEY A;  4BHW A;  5C13 A;  2YT5 A;  1K2F A;  3IVV A;  3DQV R;  5I3L A;  1D0J A;  1FBV A;  5LKU A;  2CKL B;  4ZUX U;  2LN0 A;  4TKP B;  4PPE A;  3HQL A;  4CCG X;  1X4U A;  2YRE A;  3HCS A;  2YSJ A;  4CA1 A;  3O35 A;  2VPD A;  3KV6 A;  4UP0 A;  1BOR A;  2K17 A;  2CKL A;  2YUC A;  2LDR A;  4YBS A;  3HCU A;  5AIU A;  1CA9 A;  3T6R A;  2M85 A;  2KGI A;  4P5O B;  3HCT A;  3LQH A;  3ZVY A;  2JMI A;  4S3O C;  4QF2 A;  4NN2 A;  2PUY A;  2F1Y A;  5B76 A;  2YUR A;  3VK6 A;  2QJ0 A;  1CA4 A;  4LKA A;  2OXQ C;  4GWN A;  2UZG A;  3NG2 A;  3PUR A;  3MHH A;  2KWJ A;  3LRQ A;  4MSX A;  3LQI A;  2MUM A;  3U5N A;  4ZQL A;  2MT5 A;  3RPG B;  4B86 C;  2C2V S;  2K4D A;  5B8D A;  1LB5 A;  2JMJ A;  2YQL A;  3PUQ A;  1DVP A;  4WA6 A;  1WES A;  5LKX A;  4V3K C;  5TBN A;  1LDJ B;  1VFY A;  4YAT A;  4LJN A;  3SOX A;  1QSC A;  2NAA A;  2KIZ A;  5G05 B;  5FB0 A;  2E6R A;  5H1V A;  2YW8 A;  3N9M A;  5KH3 A;  2KE1 A;  3N9O A;  2MNY A;  1ZMS A;  4LK9 A;  2KYU A;  1WIL A;  1WEM A;  3EB5 A;  2IDA A;  4ZDT A;  5H1T A;  3SHB A;  4L7X A;  3N9N A;  4W4U A;  2CR2 A;  1U6G B;  3I2D A;  1N87 A;  1D0A A;  1Z2Q A;  1F62 A;  2ECT A;  4WZ3 B;  1YY6 A;  3EB6 A;  3L1Z B;  4FO9 A;  2VJF B;  4IC2 A;  1F3V B;  5FER A;  5J3X A;  1E4U A;  5AIT A;  5LCW B;  3O33 A;  3IHP A;  4LLB A;  4GB0 A;  4GNG A;  1RF3 A;  4IC3 A;  2PNX A;  2M1R A;  2MA6 A;  5TDR A;  4UP5 A;  5B77 A;  2KU3 A;  2YQM A;  2VJF A;  2XB1 A;  4YAX A;  2HYE D;  3L1X A;  1LDK C;  3ZYQ A;  2FUU A;  3N9L A;  1ZBD B;  4I7D A;  2CSY A;  2LGL A;  4V3L C;  4C9Z A;  1WEO A;  3O7A A;  5LKZ A;  4A0C D;  3DPL R;  4AP4 A;  4B7Y C;  2CSZ A;  3HSV A;  1IYM A;  2CT2 A;  2ECJ A;  2KGG A;  3T7L A;  5KH9 A;  4AYC B;  2YSM A;  3C5K A;  1CHC A;  3C6W A;  3PHD A;  1FP0 A;  4YBM A;  3MHS A;  3GV4 A;  2L5U A;  4S3O B;  4Z8M A;  1HYI A;  2BAY A;  2F1X A;  5B79 A;  1Z6U A;  4YSI A;  2VP7 A;  2KWK A;  5D1L B;  3L11 A;  2K16 A;  4AVX A;  2GKW A;  4M4E A;  3ZVZ B;  4AYC A;  4KG9 A;  2ECV A;  2A25 A;  2QIZ A;  2LGK A;  4FJC A;  4FIP A;  2LXP C;  5DKA A;  2LXH C;  4FK5 A;  2ZET C;  1KZZ A;  4O1V A;  1WEQ A;  4R8P K;  2MD7 B;  4YAB A;  2YU4 A;  4GNF A;  3V43 A;  2C2L A;  2VJE B;  2MIQ A;  4N3W A;  1YZE A;  3M99 A;  2FSA A;  1RMD A;  2G43 A;  2L75 A;  3ASL A;  2F6N A;  1WEP A;  1WIM A;  3MQS C;  2Y1N A;  3N9P A;  1FLL A;  1Z60 A;  2FUI A;  2VJE A;  4GNE A;  1JM7 B;  5E1T A;  5TDW A;  5H1U A;  2M3H A;  4A4B A;  2EA6 A;  1VD4 A;  3U5M A;  1HYJ A;  2MNZ A;  2KWO A;  1MM2 A;  2Y43 A;  2JMD A;  2HDP A;  1JM7 A;  5EYA F;  2MA5 A;  2H0D B;  3KQI A;  3HQH A;  5TAB A;  3KNV A;  5C11 A;  4YC9 A;  2LRI C;  3ZPV E;  1T1H A;  4R2Y A;  2FOO A;  5LKT A;  1JOC A;  4N4F A;  3QZV A;  4UI9 B;  3RTR B;  2F1Z A;  1X4I A;  2H0D A;  5G0F A;  5B78 A;  2LV9 A;  2ECI A;  1G25 A;  5D1M B;  2FOJ A;  2M6M A;  5JG6 A;  1X4J A;  1XWH A;  2K1J A;  3LQJ A;  2F1W A;  1LB4 A;  4I7C A;  2D8S A;  2I50 A;  2F6J A;  1LB6 A;  3IVB A;  4O64 A;  3ZTG A;  4A49 A;  4QF3 A;  2AN6 A;  2ECG A;  2YHN A;  2F42 A;  1WEW A;  3ZPV 1;  3HQM A;  4K8U A;  3GL6 A;  2JRJ A;  3ZNI A;  1WFK A;  2EGP A;  1CZY A;  1D01 A;  2YHO A;  4R7E A;  2VNF A;  3SOU A;  3O34 A;  2KFT A;  2EOD A;  2KR4 A;  3IVQ A;  3U5P A;  4Q6F A;  4BBQ A;  3MQR A;  1WEV A;  1WE9 A;  3ZJB A;  1WGM A;  2LQ6 A;  3RPG C;  5DIN A;  2KWN A;  1VYX A;  2XEU A;  3O70 A;  3KV5 A;  2Y1M A;  4WZ2 A;  4LAD B;  2L80 A;  4YAD A;  5B75 A;  1CZZ A;  2ECW A;  2QIC A;  4JJQ A;  3O37 A;  2YYR A;  4GWM A;  2VPG A;  5G04 B;  3M62 A;  2RI7 A;  3U5O A;  2RSD A;  2L43 A;  4YBT A;  4I7B A;  1WEN A;  3O36 A;  1WEE A;  4X3G A;  1L0A A;  5D1K B;  1D00 A;  2ECN A;  3HTK C;  4MVT A;  2DX8 A;  3FL2 A;  4WZ0 A;  2MD8 C;  4L58 A;  2E6S A;  2LGG A;  2XXN A;  4GND A;  4XI1 A;  2LGV A;  1WEU A;  3M63 A;  5TRB A;  1FLK A;  3HQI A;  5KH7 A;  2KRE A;  2G6Q A;  2G45 A;  3N9Q A;  4PTB A;  4A4C A;  5FB1 A;  3HU6 A; 
#chains in the Genus database with same CATH topology
 4GJH A;  2VPE A;  1V87 A;  2L0B A;  5H9M A;  4GHU A;  4AUQ B;  3FEH A;  2YVR A;  3SOW A;  2VPB A;  4F52 B;  1MM3 A;  2FOP A;  5FEY A;  4BHW A;  5C13 A;  2YT5 A;  1K2F A;  3IVV A;  3DQV R;  5I3L A;  1D0J A;  1FBV A;  5LKU A;  2M13 A;  2CKL B;  4ZUX U;  2LN0 A;  4TKP B;  4PPE A;  3HQL A;  4CCG X;  1X4U A;  2YRE A;  3HCS A;  4Z0O A;  2YSJ A;  4CA1 A;  3O35 A;  2VPD A;  3KV6 A;  4UP0 A;  1BOR A;  2K17 A;  2CKL A;  2XOY A;  2YUC A;  2LDR A;  4YBS A;  2XP0 A;  3HCU A;  5AIU A;  1CA9 A;  3T6R A;  2M85 A;  2JUN A;  2KGI A;  4P5O B;  2EXU A;  3HCT A;  3LQH A;  3ZVY A;  2JMI A;  4S3O C;  2FFW A;  4QF2 A;  4NN2 A;  2PUY A;  2F1Y A;  5B76 A;  2YUR A;  2KKX A;  3VK6 A;  2QJ0 A;  1CA4 A;  4LKA A;  2CON A;  2OXQ C;  4GWN A;  2UZG A;  3NG2 A;  3PUR A;  3MHH A;  2KWJ A;  3LRQ A;  4MSX A;  3LQI A;  5SVX A;  2MUM A;  3U5N A;  4ZQL A;  2MT5 A;  3RPG B;  3FJU B;  4B86 C;  3LVQ E;  2C2V S;  2K4D A;  5B8D A;  2P57 A;  1LB5 A;  2JMJ A;  2YQL A;  3PUQ A;  1DVP A;  4WA6 A;  1WES A;  5LKX A;  2XOZ A;  4V3K C;  5TBN A;  1LDJ B;  1VFY A;  2JM3 A;  4YAT A;  4LJN A;  3SOX A;  1QSC A;  2NAA A;  2KIZ A;  5G05 B;  5FB0 A;  2E6R A;  5H1V A;  2YW8 A;  3N9M A;  5KH3 A;  2KE1 A;  3N9O A;  2MNY A;  1ZMS A;  4LK9 A;  2KYU A;  1WIL A;  1WEM A;  3EB5 A;  2CRW A;  2IDA A;  4ZDT A;  5H1T A;  3SHB A;  4L7X A;  3N9N A;  4W4U A;  3O47 A;  5K3Q A;  2CR2 A;  1U6G B;  3I2D A;  1N87 A;  1D0A A;  4O62 A;  1Z2Q A;  1F62 A;  2ECT A;  4OGE A;  4WZ3 B;  1YY6 A;  3EB6 A;  3L1Z B;  4FO9 A;  2VJF B;  4IC2 A;  1F3V B;  5FER A;  5J3X A;  1E4U A;  5AIT A;  5LCW B;  2RR4 A;  3O33 A;  3IHP A;  4LLB A;  4GB0 A;  4GNG A;  1RF3 A;  2LAU A;  4IC3 A;  2PNX A;  2M1R A;  2MA6 A;  2EGM A;  1DCQ A;  5TDR A;  4UP5 A;  5B77 A;  2KU3 A;  2YQM A;  2VJF A;  2B0O E;  2XB1 A;  4YAX A;  2HYE D;  3L1X A;  3E2D A;  1LDK C;  3ZYQ A;  2DJA A;  2FUU A;  3N9L A;  1ZBD B;  3Q1D A;  3DWD A;  4I7D A;  2CSY A;  2CRR A;  2LGL A;  4V3L C;  4C9Z A;  1WEO A;  3O7A A;  3T9K A;  5LKZ A;  4A0C D;  2DSM A;  3DPL R;  4AP4 A;  4B7Y C;  2CSZ A;  3HSV A;  1IYM A;  2CT2 A;  2ECJ A;  2KGG A;  3T7L A;  5KH9 A;  4AYC B;  2YSM A;  3C5K A;  1CHC A;  4H9D A;  3C6W A;  3PHD A;  1FP0 A;  4YBM A;  3MHS A;  3SUB A;  3GV4 A;  2L5U A;  4S3O B;  4Z8M A;  1HYI A;  3PLW A;  2BAY A;  2F1X A;  5B79 A;  1Z6U A;  4YSI A;  2VP7 A;  2KWK A;  5D1L B;  3L11 A;  2K16 A;  4AVX A;  2GKW A;  4M4E A;  3ZVZ B;  4AYC A;  4KG9 A;  2ECV A;  2A25 A;  2QIZ A;  2LGK A;  4FJC A;  2D8U A;  2LXP C;  4FIP A;  5DKA A;  2LXH C;  4FK5 A;  2E61 A;  3FM8 C;  2ZET C;  1KZZ A;  4O1V A;  1WEQ A;  4R8P K;  4OGC A;  2MD7 B;  4YAB A;  2YU4 A;  4GNF A;  5SVY A;  3V43 A;  2C2L A;  2VJE B;  2MIQ A;  4N3W A;  1YZE A;  3M99 A;  2FSA A;  1RMD A;  2G43 A;  2L75 A;  3ASL A;  2F6N A;  1WEP A;  1WIM A;  3MQS C;  2Y1N A;  3N9P A;  1FLL A;  1Z60 A;  2FUI A;  2VJE A;  4GNE A;  1JM7 B;  5E1T A;  5TDW A;  5H1U A;  2M3H A;  4A4B A;  2EA6 A;  1VD4 A;  3U5M A;  1HYJ A;  2MNZ A;  2KWO A;  1MM2 A;  2Y43 A;  2JMD A;  2HDP A;  1JM7 A;  5EYA F;  3DDT A;  2MA5 A;  2H0D B;  3KQI A;  3HQH A;  5TAB A;  3KNV A;  5C11 A;  4YC9 A;  2LRI C;  3ZPV E;  1T1H A;  4R2Y A;  2FOO A;  5LKT A;  1JOC A;  4N4F A;  3H7H A;  3QZV A;  4UI9 B;  3RTR B;  2CSV A;  2F1Z A;  1X4I A;  2H0D A;  5G0F A;  5B78 A;  3MDB C;  2LV9 A;  2ECI A;  1G25 A;  5D1M B;  2FOJ A;  2M6M A;  5JG6 A;  1X4J A;  1XWH A;  2K1J A;  3LQJ A;  2F1W A;  1LB4 A;  4I7C A;  2D8S A;  2I50 A;  2F6J A;  5SVI B;  1LB6 A;  3IVB A;  4O64 A;  4Z0R A;  3ZTG A;  4A49 A;  4QF3 A;  2AN6 A;  2ECG A;  2YHN A;  4QQ4 A;  2F42 A;  1WEW A;  3JUE A;  3ZPV 1;  3HQM A;  4K8U A;  3GL6 A;  5SVI A;  2JRJ A;  3ZNI A;  1WFK A;  2EGP A;  2XOC A;  1CZY A;  1D01 A;  2YHO A;  4R7E A;  2VNF A;  3SOU A;  3O34 A;  2KFT A;  2EOD A;  2KR4 A;  3IVQ A;  3FAN A;  3U5P A;  4Q6F A;  2OWA A;  4BBQ A;  3MQR A;  1WEV A;  3M7K A;  1WE9 A;  2L7P A;  3ZJB A;  2MKE A;  1WGM A;  2LQ6 A;  3RPG C;  5DIN A;  2KWN A;  1VYX A;  2XEU A;  4F1P A;  3O70 A;  2IQJ A;  3KV5 A;  3KDE C;  2Y1M A;  4WZ2 A;  4LAD B;  2L80 A;  4YAD A;  5B75 A;  3FAO A;  1CZZ A;  2ECW A;  2FD4 A;  2QIC A;  4JJQ A;  3O37 A;  2YYR A;  4GWM A;  2VPG A;  5G04 B;  3M62 A;  2RI7 A;  3U5O A;  2RSD A;  2L43 A;  4YBT A;  4I7B A;  1WEN A;  3O36 A;  1WEE A;  4X3G A;  1L0A A;  5D1K B;  1D00 A;  2ECN A;  3HTK C;  4MVT A;  2DX8 A;  2KKY A;  3FL2 A;  4WZ0 A;  3LJU X;  2MD8 C;  4L58 A;  2E6S A;  2LGG A;  2XXN A;  4GND A;  1MBM A;  4XI1 A;  2LGV A;  1WEU A;  3M63 A;  5TRB A;  1FLK A;  3HQI A;  3LVR E;  5KH7 A;  2KRE A;  3LDY A;  2G6Q A;  2G45 A;  3N9Q A;  4PTB A;  4A4C A;  5FB1 A;  3HU6 A; 
#chains in the Genus database with same CATH homology
 4GJH A;  2VPE A;  1V87 A;  2L0B A;  5H9M A;  4GHU A;  4AUQ B;  3SOW A;  2VPB A;  4F52 B;  1MM3 A;  2FOP A;  5FEY A;  4BHW A;  5C13 A;  2YT5 A;  1K2F A;  3IVV A;  3DQV R;  5I3L A;  1D0J A;  1FBV A;  5LKU A;  2CKL B;  4ZUX U;  2LN0 A;  4TKP B;  4PPE A;  3HQL A;  4CCG X;  1X4U A;  2YRE A;  3HCS A;  2YSJ A;  4CA1 A;  3O35 A;  2VPD A;  3KV6 A;  4UP0 A;  1BOR A;  2K17 A;  2CKL A;  2YUC A;  2LDR A;  4YBS A;  3HCU A;  5AIU A;  1CA9 A;  3T6R A;  2M85 A;  2KGI A;  4P5O B;  3HCT A;  3LQH A;  3ZVY A;  2JMI A;  4S3O C;  4QF2 A;  4NN2 A;  2PUY A;  2F1Y A;  5B76 A;  2YUR A;  3VK6 A;  2QJ0 A;  1CA4 A;  4LKA A;  2OXQ C;  4GWN A;  2UZG A;  3NG2 A;  3PUR A;  3MHH A;  2KWJ A;  3LRQ A;  4MSX A;  3LQI A;  2MUM A;  3U5N A;  4ZQL A;  2MT5 A;  3RPG B;  4B86 C;  2C2V S;  2K4D A;  5B8D A;  1LB5 A;  2JMJ A;  2YQL A;  3PUQ A;  1DVP A;  4WA6 A;  1WES A;  5LKX A;  4V3K C;  5TBN A;  1LDJ B;  1VFY A;  4YAT A;  4LJN A;  3SOX A;  1QSC A;  2NAA A;  2KIZ A;  5G05 B;  5FB0 A;  2E6R A;  5H1V A;  2YW8 A;  3N9M A;  5KH3 A;  2KE1 A;  3N9O A;  2MNY A;  1ZMS A;  4LK9 A;  2KYU A;  1WIL A;  1WEM A;  3EB5 A;  2IDA A;  4ZDT A;  5H1T A;  3SHB A;  4L7X A;  3N9N A;  4W4U A;  2CR2 A;  1U6G B;  3I2D A;  1N87 A;  1D0A A;  1Z2Q A;  1F62 A;  2ECT A;  4WZ3 B;  1YY6 A;  3EB6 A;  3L1Z B;  4FO9 A;  2VJF B;  4IC2 A;  1F3V B;  5FER A;  5J3X A;  1E4U A;  5AIT A;  5LCW B;  3O33 A;  3IHP A;  4LLB A;  4GB0 A;  4GNG A;  1RF3 A;  4IC3 A;  2PNX A;  2M1R A;  2MA6 A;  5TDR A;  4UP5 A;  5B77 A;  2KU3 A;  2YQM A;  2VJF A;  2XB1 A;  4YAX A;  2HYE D;  3L1X A;  1LDK C;  3ZYQ A;  2FUU A;  3N9L A;  1ZBD B;  4I7D A;  2CSY A;  2LGL A;  4V3L C;  4C9Z A;  1WEO A;  3O7A A;  5LKZ A;  4A0C D;  3DPL R;  4AP4 A;  4B7Y C;  2CSZ A;  3HSV A;  1IYM A;  2CT2 A;  2ECJ A;  2KGG A;  3T7L A;  5KH9 A;  4AYC B;  2YSM A;  3C5K A;  1CHC A;  3C6W A;  3PHD A;  1FP0 A;  4YBM A;  3MHS A;  3GV4 A;  2L5U A;  4S3O B;  4Z8M A;  1HYI A;  2BAY A;  2F1X A;  5B79 A;  1Z6U A;  4YSI A;  2VP7 A;  2KWK A;  5D1L B;  3L11 A;  2K16 A;  4AVX A;  2GKW A;  4M4E A;  3ZVZ B;  4AYC A;  4KG9 A;  2ECV A;  2A25 A;  2QIZ A;  2LGK A;  4FJC A;  4FIP A;  2LXP C;  5DKA A;  2LXH C;  4FK5 A;  2ZET C;  1KZZ A;  4O1V A;  1WEQ A;  4R8P K;  2MD7 B;  4YAB A;  2YU4 A;  4GNF A;  3V43 A;  2C2L A;  2VJE B;  2MIQ A;  4N3W A;  1YZE A;  3M99 A;  2FSA A;  1RMD A;  2G43 A;  2L75 A;  3ASL A;  2F6N A;  1WEP A;  1WIM A;  3MQS C;  2Y1N A;  3N9P A;  1FLL A;  1Z60 A;  2FUI A;  2VJE A;  4GNE A;  1JM7 B;  5E1T A;  5TDW A;  5H1U A;  2M3H A;  4A4B A;  2EA6 A;  1VD4 A;  3U5M A;  1HYJ A;  2MNZ A;  2KWO A;  1MM2 A;  2Y43 A;  2JMD A;  2HDP A;  1JM7 A;  5EYA F;  2MA5 A;  2H0D B;  3KQI A;  3HQH A;  5TAB A;  3KNV A;  5C11 A;  4YC9 A;  2LRI C;  3ZPV E;  1T1H A;  4R2Y A;  2FOO A;  5LKT A;  1JOC A;  4N4F A;  3QZV A;  4UI9 B;  3RTR B;  2F1Z A;  1X4I A;  2H0D A;  5G0F A;  5B78 A;  2LV9 A;  2ECI A;  1G25 A;  5D1M B;  2FOJ A;  2M6M A;  5JG6 A;  1X4J A;  1XWH A;  2K1J A;  3LQJ A;  2F1W A;  1LB4 A;  4I7C A;  2D8S A;  2I50 A;  2F6J A;  1LB6 A;  3IVB A;  4O64 A;  3ZTG A;  4A49 A;  4QF3 A;  2AN6 A;  2ECG A;  2YHN A;  2F42 A;  1WEW A;  3ZPV 1;  3HQM A;  4K8U A;  3GL6 A;  2JRJ A;  3ZNI A;  1WFK A;  2EGP A;  1CZY A;  1D01 A;  2YHO A;  4R7E A;  2VNF A;  3SOU A;  3O34 A;  2KFT A;  2EOD A;  2KR4 A;  3IVQ A;  3U5P A;  4Q6F A;  4BBQ A;  3MQR A;  1WEV A;  1WE9 A;  3ZJB A;  1WGM A;  2LQ6 A;  3RPG C;  5DIN A;  2KWN A;  1VYX A;  2XEU A;  3O70 A;  3KV5 A;  2Y1M A;  4WZ2 A;  4LAD B;  2L80 A;  4YAD A;  5B75 A;  1CZZ A;  2ECW A;  2QIC A;  4JJQ A;  3O37 A;  2YYR A;  4GWM A;  2VPG A;  5G04 B;  3M62 A;  2RI7 A;  3U5O A;  2RSD A;  2L43 A;  4YBT A;  4I7B A;  1WEN A;  3O36 A;  1WEE A;  4X3G A;  1L0A A;  5D1K B;  1D00 A;  2ECN A;  3HTK C;  4MVT A;  2DX8 A;  3FL2 A;  4WZ0 A;  2MD8 C;  4L58 A;  2E6S A;  2LGG A;  2XXN A;  4GND A;  4XI1 A;  2LGV A;  1WEU A;  3M63 A;  5TRB A;  1FLK A;  3HQI A;  5KH7 A;  2KRE A;  2G6Q A;  2G45 A;  3N9Q A;  4PTB A;  4A4C A;  5FB1 A;  3HU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...