4X3GA

Crystal structure of siah1 sina domain in complex with a usp19 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
188
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 36
structure length 188
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4x3gA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4x3gA01
5C11A 4A4CA 2FSAA 4YABA 2L0BA 2CSYA 2QICA 4B7YC 2G6QA 4S3OB 5TDWA 1JM7B 4LJNA 2KE1A 4I7BA 5LKTA 5G04B 2A25A 3IVBA 3EB5A 2VNFA 4K8UA 2Y43A 5TABA 1L0AA 2VPGA 2F1ZA 3M63A 4YATA 1JM7A 2M3HA 1LDKC 4M4EA 3PUQA 4YAXA 4I7DA 2KWKA 4GJHA 1FBVA 1JOCA 3O33A 4V3KC 4YADA 1CA4A 5H1UA 2E6RA 2HDPA 4NN2A 2VJEB 1FLKA 3HCSA 3HSVA 2LXHC 1RMDA 2VJFB 1CHCA 4JJQA 2ECTA 2VJEA 1D0JA 4MVTA 3ZPV1 5DINA 3KNVA 2YHOA 2K1JA 4A0CD 2G45A 4LKAA 2DX8A 4GWNA 2AN6A 2KFTA 3GL6A 1D0AA 2YREA 1CZZA 2FOOA 2ZETC 3O35A 3N9QA 1CA9A 2RI7A 3ASLA 4MSXA 3ZPVE 3U5MA 1HYJA 4W4UA 2K16A 2XXNA 3HQIA 3LQIA 4AVXA 3ZNIA 5KH9A 3L11A 2VPEA 4FK5A 1LB4A 4QF3A 2QIZA 4YBSA 2QJ0A 3HQHA 4TKPB 4IC3A 1VYXA 4WZ0A 4XI1A 4N3WA 5FB1A 1F62A 4WA6A 3IVVA 4UI9B 2FOPA 2KIZA 1LB6A 1YZEA 3O37A 3O36A 1KZZA 2Y1NA 3LQHA 4GHUA 2XB1A 2KWJA 2KWNA 2F1XA 2F42A 3QZVA 2GKWA 3SHBA 3HCUA 1WEOA 1WIMA 2CSZA 3KV5A 2C2VS 2M85A 4FO9A 1T1HA 2EA6A 1XWHA 2MD8C 4LLBA 5D1LB 1ZMSA 3L1XA 1WEWA 4A49A 3I2DA 2KR4A 5B75A 4P5OB 4R7EA 2F6NA 5G0FA 4FJCA 2LN0A 2FUIA 2FOJA 1WE9A 2K17A 5E1TA 2YQLA 2MIQA 2KYUA 3KV6A 3ZVZB 2KU3A 2LGLA 3T7LA 1Z6UA 2YUCA 4GNDA 1IYMA 2LDRA 5C13A 4YC9A 5TDRA 5LCWB 4YBMA 2FUUA 5TRBA 2OXQC 3N9LA 2BAYA 3HQLA 1BORA 2MNZA 1D00A 4A4BA 3M99A 1WEVA 2CKLB 5TBNA 3MQSC 2YSJA 5J3XA 4QF2A 2JRJA 4ZUXU 3KQIA 3PHDA 1DVPA 4GWMA 2CKLA 3HTKC 4KG9A 4AP4A 4AYCB 5I3LA 3N9OA 2EGPA 2YU4A 2YHNA 4AUQB 2MD7B 4GNFA 3ZVYA 2VP7A 4AYCA 1MM2A 1X4IA 2L75A 5D1MB 1YY6A 1WEUA 2MNYA 5KH3A 1X4JA 2D8SA 3O70A 3ZJBA 4S3OC 2ECJA 2LGVA 4ZDTA 2RSDA 2JMDA 2KGGA 1K2FA 4F52B 4GB0A 2F1YA 3C6WA 1X4UA 2MUMA 5EYAF 1FLLA 1N87A 3M62A 3SOUA 2ECWA 5LKZA 4I7CA 1WEPA 5KH7A 4L58A 2YQMA 4FIPA 2LGGA 2YW8A 3HU6A 4V3LC 2YYRA 4L7XA 2L43A 3DPLR 1E4UA 2LRIC 1RF3A 2MA6A 4PPEA 3RPGC 2M1RA 2MT5A 1HYIA 5FB0A 1Z60A 3NG2A 1D01A 1LDJB 4Z8MA 3PURA 1F3VB 3ZYQA 3ZTGA 3U5NA 2KREA 3N9PA 5D1KB 5H1VA 1ZBDB 2YSMA 3L1ZB 2YURA 2CR2A 4WZ2A 3HCTA 1Z2QA 4YSIA 2VPBA 1WEEA 4IC2A 1WEMA 3EB6A 1G25A 4B86C 3HQMA 5LKXA 1WENA 3U5PA 5AITA 2K4DA 4YBTA 1U6GB 4BBQA 4WZ3B 2F1WA 4PTBA 5FERA 3SOWA 3O34A 5H9MA 3T6RA 1V87A 1FP0A 3VK6A 3O7AA 3DQVR 5B77A 3SOXA 2HYED 2ECVA 3MHHA 2JMJA 2CT2A 4X3GA 2LQ6A 5B8DA 5AIUA 3RPGB 2JMIA 3GV4A 1CZYA 2C2LA 2H0DB 5DKAA 4R2YA 4R8PK 5JG6A 2LGKA 1WEQA 3IVQA 2H0DA 2UZGA 1VD4A 3C5KA 2L5UA 2VJFA 4LK9A 2ECNA 1WGMA 2L80A 1WILA 2ECGA 4BHWA 2LV9A 2E6SA 4ZQLA 2EODA 4GNGA 5H1TA 4GNEA 3LRQA 4O64A 2Y1MA 4UP0A 3LQJA 3N9MA 2IDAA 3U5OA 2NAAA 2KWOA 5B78A 4CCGX 4C9ZA 1VFYA 5LKUA 1QSCA 2YT5A 1LB5A 3IHPA 4N4FA 3N9NA 5G05B 2PNXA 5B79A 2KGIA 2LXPC 2F6JA 3V43A 4O1VA 2G43A 3FL2A 4LADB 5B76A 2VPDA 2MA5A 4UP5A 1MM3A 2I50A 3MQRA 3MHSA 2XEUA 3RTRB 1WFKA 2ECIA 2M6MA 5FEYA 4Q6FA 2PUYA 4CA1A 1WESA
chains in the Genus database with same CATH superfamily
5C11A 4A4CA 2FSAA 4YABA 2L0BA 2CSYA 2QICA 4B7YC 2G6QA 4S3OB 5TDWA 1JM7B 4LJNA 5K3QA 2KE1A 4I7BA 5LKTA 5G04B 2A25A 3IVBA 3EB5A 2VNFA 4K8UA 2Y43A 5TABA 1L0AA 2VPGA 2F1ZA 3M63A 4YATA 1JM7A 2M3HA 2JUNA 1LDKC 2YVRA 4M4EA 3PUQA 3DWDA 4YAXA 4I7DA 2KWKA 4GJHA 1FBVA 1JOCA 3O33A 4V3KC 4YADA 2E61A 1CA4A 5H1UA 2E6RA 2HDPA 4NN2A 3O47A 2VJEB 1FLKA 3HCSA 3HSVA 2LXHC 1RMDA 2VJFB 1CHCA 4JJQA 2ECTA 2VJEA 1D0JA 2P57A 4MVTA 3ZPV1 5DINA 3KNVA 2YHOA 2K1JA 4A0CD 2G45A 3LVQE 4LKAA 2DX8A 1DCQA 2XOZA 4GWNA 2CSVA 2AN6A 2KFTA 3E2DA 3GL6A 1D0AA 2YREA 1CZZA 2FOOA 2ZETC 3O35A 3N9QA 1CA9A 2RI7A 3ASLA 4MSXA 4QQ4A 3ZPVE 3U5MA 1HYJA 4W4UA 2K16A 2XXNA 3HQIA 3LQIA 4AVXA 2FFWA 3ZNIA 5KH9A 3L11A 2VPEA 4FK5A 3Q1DA 1LB4A 4O62A 4QF3A 2QIZA 4YBSA 3LJUX 2QJ0A 3HQHA 4TKPB 4IC3A 1VYXA 4WZ0A 4XI1A 3FEHA 4N3WA 5FB1A 1F62A 4WA6A 3IVVA 4UI9B 2FOPA 2KIZA 1LB6A 1YZEA 1MBMA 3O37A 3O36A 1KZZA 3T9KA 2Y1NA 3LQHA 4GHUA 2XB1A 2KWJA 2KWNA 4F1PA 3H7HA 2F1XA 2F42A 3QZVA 2GKWA 3SHBA 3HCUA 2XP0A 1WEOA 1WIMA 2CSZA 3KV5A 5SVXA 2C2VS 2M85A 4FO9A 2XOCA 1T1HA 2EA6A 1XWHA 2MD8C 4LLBA 5D1LB 1ZMSA 3L1XA 1WEWA 4A49A 3I2DA 2KR4A 5B75A 4P5OB 4R7EA 2OWAA 3LVRE 2F6NA 5G0FA 5SVIB 2KKYA 4FJCA 2LN0A 2FUIA 2FOJA 1WE9A 2K17A 5E1TA 2YQLA 2MIQA 2KYUA 3KV6A 3ZVZB 5SVIA 2KU3A 2LGLA 3T7LA 4OGEA 1Z6UA 2YUCA 4GNDA 1IYMA 2LDRA 5C13A 4YC9A 5TDRA 5LCWB 4YBMA 2FUUA 5TRBA 2OXQC 3N9LA 2BAYA 3HQLA 1BORA 2MNZA 1D00A 4A4BA 3M99A 1WEVA 2CKLB 5TBNA 3MQSC 2YSJA 5J3XA 4QF2A 2JRJA 4ZUXU 3KQIA 3PHDA 1DVPA 4GWMA 2CKLA 3HTKC 4KG9A 4AP4A 4AYCB 5I3LA 3FJUB 3N9OA 2EGPA 2YU4A 2JM3A 2YHNA 4AUQB 2MD7B 4GNFA 3ZVYA 2VP7A 4AYCA 1MM2A 1X4IA 2L75A 5D1MB 1YY6A 1WEUA 2MNYA 5KH3A 1X4JA 2D8SA 3O70A 3ZJBA 4S3OC 2DSMA 2ECJA 2LGVA 4ZDTA 2RSDA 2JMDA 2KGGA 1K2FA 4F52B 4GB0A 2F1YA 3C6WA 1X4UA 2MUMA 5EYAF 1FLLA 1N87A 2M13A 3M62A 3SOUA 2ECWA 5LKZA 4I7CA 1WEPA 5KH7A 4L58A 2MKEA 2YQMA 4FIPA 2LGGA 2YW8A 3HU6A 4V3LC 2YYRA 4L7XA 2L43A 3DPLR 1E4UA 2LRIC 1RF3A 2FD4A 2MA6A 4PPEA 3RPGC 2L7PA 2M1RA 2MT5A 1HYIA 5FB0A 1Z60A 3NG2A 1D01A 3MDBC 1LDJB 4Z8MA 3PURA 1F3VB 3ZYQA 3ZTGA 3U5NA 2KREA 2DJAA 3N9PA 5D1KB 2CRWA 5H1VA 3LDYA 3FAOA 1ZBDB 2YSMA 3L1ZB 2YURA 2CR2A 4WZ2A 3HCTA 1Z2QA 4YSIA 2VPBA 1WEEA 4IC2A 1WEMA 3FM8C 3EB6A 2IQJA 1G25A 4B86C 3HQMA 3FANA 2CRRA 5SVYA 5LKXA 1WENA 3U5PA 5AITA 2K4DA 2D8UA 4YBTA 1U6GB 4BBQA 4WZ3B 2F1WA 4PTBA 5FERA 3SOWA 3O34A 5H9MA 3T6RA 1V87A 1FP0A 3KDEC 3VK6A 3O7AA 2EXUA 3DQVR 5B77A 4OGCA 3SOXA 2HYED 2ECVA 3MHHA 2JMJA 2CT2A 4X3GA 2LQ6A 5B8DA 5AIUA 3RPGB 2JMIA 3GV4A 1CZYA 2C2LA 2H0DB 5DKAA 4R2YA 4R8PK 5JG6A 2LGKA 1WEQA 3DDTA 3IVQA 2H0DA 2UZGA 1VD4A 3C5KA 2L5UA 2LAUA 4Z0OA 2VJFA 4LK9A 2ECNA 1WGMA 2L80A 1WILA 2ECGA 4BHWA 2LV9A 2E6SA 4ZQLA 2EGMA 2EODA 2B0OE 4GNGA 2CONA 2XOYA 4Z0RA 5H1TA 4GNEA 3LRQA 4O64A 2Y1MA 4UP0A 3LQJA 3N9MA 2IDAA 3U5OA 2NAAA 2KWOA 5B78A 4CCGX 4C9ZA 1VFYA 5LKUA 1QSCA 2YT5A 1LB5A 3IHPA 4N4FA 3N9NA 5G05B 2PNXA 5B79A 2KGIA 2LXPC 2F6JA 4H9DA 2RR4A 3M7KA 3V43A 4O1VA 2G43A 3FL2A 4LADB 5B76A 2VPDA 2MA5A 4UP5A 1MM3A 2I50A 3MQRA 3MHSA 2XEUA 3RTRB 1WFKA 2ECIA 3JUEA 2M6MA 5FEYA 4Q6FA 2PUYA 4CA1A 3PLWA 1WESA 2KKXA 3SUBA
chains in the Genus database with same CATH topology
5C11A 4A4CA 2FSAA 4YABA 2L0BA 2CSYA 2QICA 4B7YC 2G6QA 4S3OB 5TDWA 1JM7B 4LJNA 2KE1A 4I7BA 5LKTA 5G04B 2A25A 3IVBA 3EB5A 2VNFA 4K8UA 2Y43A 5TABA 1L0AA 2VPGA 2F1ZA 3M63A 4YATA 1JM7A 2M3HA 1LDKC 4M4EA 3PUQA 4YAXA 4I7DA 2KWKA 4GJHA 1FBVA 1JOCA 3O33A 4V3KC 4YADA 1CA4A 5H1UA 2E6RA 2HDPA 4NN2A 2VJEB 1FLKA 3HCSA 3HSVA 2LXHC 1RMDA 2VJFB 1CHCA 4JJQA 2ECTA 2VJEA 1D0JA 4MVTA 3ZPV1 5DINA 3KNVA 2YHOA 2K1JA 4A0CD 2G45A 4LKAA 2DX8A 4GWNA 2AN6A 2KFTA 3GL6A 1D0AA 2YREA 1CZZA 2FOOA 2ZETC 3O35A 3N9QA 1CA9A 2RI7A 3ASLA 4MSXA 3ZPVE 3U5MA 1HYJA 4W4UA 2K16A 2XXNA 3HQIA 3LQIA 4AVXA 3ZNIA 5KH9A 3L11A 2VPEA 4FK5A 1LB4A 4QF3A 2QIZA 4YBSA 2QJ0A 3HQHA 4TKPB 4IC3A 1VYXA 4WZ0A 4XI1A 4N3WA 5FB1A 1F62A 4WA6A 3IVVA 4UI9B 2FOPA 2KIZA 1LB6A 1YZEA 3O37A 3O36A 1KZZA 2Y1NA 3LQHA 4GHUA 2XB1A 2KWJA 2KWNA 2F1XA 2F42A 3QZVA 2GKWA 3SHBA 3HCUA 1WEOA 1WIMA 2CSZA 3KV5A 2C2VS 2M85A 4FO9A 1T1HA 2EA6A 1XWHA 2MD8C 4LLBA 5D1LB 1ZMSA 3L1XA 1WEWA 4A49A 3I2DA 2KR4A 5B75A 4P5OB 4R7EA 2F6NA 5G0FA 4FJCA 2LN0A 2FUIA 2FOJA 1WE9A 2K17A 5E1TA 2YQLA 2MIQA 2KYUA 3KV6A 3ZVZB 2KU3A 2LGLA 3T7LA 1Z6UA 2YUCA 4GNDA 1IYMA 2LDRA 5C13A 4YC9A 5TDRA 5LCWB 4YBMA 2FUUA 5TRBA 2OXQC 3N9LA 2BAYA 3HQLA 1BORA 2MNZA 1D00A 4A4BA 3M99A 1WEVA 2CKLB 5TBNA 3MQSC 2YSJA 5J3XA 4QF2A 2JRJA 4ZUXU 3KQIA 3PHDA 1DVPA 4GWMA 2CKLA 3HTKC 4KG9A 4AP4A 4AYCB 5I3LA 3N9OA 2EGPA 2YU4A 2YHNA 4AUQB 2MD7B 4GNFA 3ZVYA 2VP7A 4AYCA 1MM2A 1X4IA 2L75A 5D1MB 1YY6A 1WEUA 2MNYA 5KH3A 1X4JA 2D8SA 3O70A 3ZJBA 4S3OC 2ECJA 2LGVA 4ZDTA 2RSDA 2JMDA 2KGGA 1K2FA 4F52B 4GB0A 2F1YA 3C6WA 1X4UA 2MUMA 5EYAF 1FLLA 1N87A 3M62A 3SOUA 2ECWA 5LKZA 4I7CA 1WEPA 5KH7A 4L58A 2YQMA 4FIPA 2LGGA 2YW8A 3HU6A 4V3LC 2YYRA 4L7XA 2L43A 3DPLR 1E4UA 2LRIC 1RF3A 2MA6A 4PPEA 3RPGC 2M1RA 2MT5A 1HYIA 5FB0A 1Z60A 3NG2A 1D01A 1LDJB 4Z8MA 3PURA 1F3VB 3ZYQA 3ZTGA 3U5NA 2KREA 3N9PA 5D1KB 5H1VA 1ZBDB 2YSMA 3L1ZB 2YURA 2CR2A 4WZ2A 3HCTA 1Z2QA 4YSIA 2VPBA 1WEEA 4IC2A 1WEMA 3EB6A 1G25A 4B86C 3HQMA 5LKXA 1WENA 3U5PA 5AITA 2K4DA 4YBTA 1U6GB 4BBQA 4WZ3B 2F1WA 4PTBA 5FERA 3SOWA 3O34A 5H9MA 3T6RA 1V87A 1FP0A 3VK6A 3O7AA 3DQVR 5B77A 3SOXA 2HYED 2ECVA 3MHHA 2JMJA 2CT2A 4X3GA 2LQ6A 5B8DA 5AIUA 3RPGB 2JMIA 3GV4A 1CZYA 2C2LA 2H0DB 5DKAA 4R2YA 4R8PK 5JG6A 2LGKA 1WEQA 3IVQA 2H0DA 2UZGA 1VD4A 3C5KA 2L5UA 2VJFA 4LK9A 2ECNA 1WGMA 2L80A 1WILA 2ECGA 4BHWA 2LV9A 2E6SA 4ZQLA 2EODA 4GNGA 5H1TA 4GNEA 3LRQA 4O64A 2Y1MA 4UP0A 3LQJA 3N9MA 2IDAA 3U5OA 2NAAA 2KWOA 5B78A 4CCGX 4C9ZA 1VFYA 5LKUA 1QSCA 2YT5A 1LB5A 3IHPA 4N4FA 3N9NA 5G05B 2PNXA 5B79A 2KGIA 2LXPC 2F6JA 3V43A 4O1VA 2G43A 3FL2A 4LADB 5B76A 2VPDA 2MA5A 4UP5A 1MM3A 2I50A 3MQRA 3MHSA 2XEUA 3RTRB 1WFKA 2ECIA 2M6MA 5FEYA 4Q6FA 2PUYA 4CA1A 1WESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C11 A;  4A4C A;  2FSA A;  4YAB A;  2L0B A;  2CSY A;  2QIC A;  4B7Y C;  2G6Q A;  4S3O B;  5TDW A;  1JM7 B;  4LJN A;  2KE1 A;  4I7B A;  5LKT A;  5G04 B;  2A25 A;  3IVB A;  3EB5 A;  2VNF A;  4K8U A;  2Y43 A;  5TAB A;  1L0A A;  2VPG A;  2F1Z A;  3M63 A;  4YAT A;  1JM7 A;  2M3H A;  1LDK C;  4M4E A;  3PUQ A;  4YAX A;  4I7D A;  2KWK A;  4GJH A;  1FBV A;  1JOC A;  3O33 A;  4V3K C;  4YAD A;  1CA4 A;  5H1U A;  2E6R A;  2HDP A;  4NN2 A;  2VJE B;  1FLK A;  3HCS A;  3HSV A;  2LXH C;  1RMD A;  2VJF B;  1CHC A;  4JJQ A;  2ECT A;  2VJE A;  1D0J A;  4MVT A;  3ZPV 1;  5DIN A;  3KNV A;  2YHO A;  2K1J A;  4A0C D;  2G45 A;  4LKA A;  2DX8 A;  4GWN A;  2AN6 A;  2KFT A;  3GL6 A;  1D0A A;  2YRE A;  1CZZ A;  2FOO A;  2ZET C;  3O35 A;  3N9Q A;  1CA9 A;  2RI7 A;  3ASL A;  4MSX A;  3ZPV E;  3U5M A;  1HYJ A;  4W4U A;  2K16 A;  2XXN A;  3HQI A;  3LQI A;  4AVX A;  3ZNI A;  5KH9 A;  3L11 A;  2VPE A;  4FK5 A;  1LB4 A;  4QF3 A;  2QIZ A;  4YBS A;  2QJ0 A;  3HQH A;  4TKP B;  4IC3 A;  1VYX A;  4WZ0 A;  4XI1 A;  4N3W A;  5FB1 A;  1F62 A;  4WA6 A;  3IVV A;  4UI9 B;  2FOP A;  2KIZ A;  1LB6 A;  1YZE A;  3O37 A;  3O36 A;  1KZZ A;  2Y1N A;  3LQH A;  4GHU A;  2XB1 A;  2KWJ A;  2KWN A;  2F1X A;  2F42 A;  3QZV A;  2GKW A;  3SHB A;  3HCU A;  1WEO A;  1WIM A;  2CSZ A;  3KV5 A;  2C2V S;  2M85 A;  4FO9 A;  1T1H A;  2EA6 A;  1XWH A;  2MD8 C;  4LLB A;  5D1L B;  1ZMS A;  3L1X A;  1WEW A;  4A49 A;  3I2D A;  2KR4 A;  5B75 A;  4P5O B;  4R7E A;  2F6N A;  5G0F A;  4FJC A;  2LN0 A;  2FUI A;  2FOJ A;  1WE9 A;  2K17 A;  5E1T A;  2YQL A;  2MIQ A;  2KYU A;  3KV6 A;  3ZVZ B;  2KU3 A;  2LGL A;  3T7L A;  1Z6U A;  2YUC A;  4GND A;  1IYM A;  2LDR A;  5C13 A;  4YC9 A;  5TDR A;  5LCW B;  4YBM A;  2FUU A;  5TRB A;  2OXQ C;  3N9L A;  2BAY A;  3HQL A;  1BOR A;  2MNZ A;  1D00 A;  4A4B A;  3M99 A;  1WEV A;  2CKL B;  5TBN A;  3MQS C;  2YSJ A;  5J3X A;  4QF2 A;  2JRJ A;  4ZUX U;  3KQI A;  3PHD A;  1DVP A;  4GWM A;  2CKL A;  3HTK C;  4KG9 A;  4AP4 A;  4AYC B;  5I3L A;  3N9O A;  2EGP A;  2YU4 A;  2YHN A;  4AUQ B;  2MD7 B;  4GNF A;  3ZVY A;  2VP7 A;  4AYC A;  1MM2 A;  1X4I A;  2L75 A;  5D1M B;  1YY6 A;  1WEU A;  2MNY A;  5KH3 A;  1X4J A;  2D8S A;  3O70 A;  3ZJB A;  4S3O C;  2ECJ A;  2LGV A;  4ZDT A;  2RSD A;  2JMD A;  2KGG A;  1K2F A;  4F52 B;  4GB0 A;  2F1Y A;  3C6W A;  1X4U A;  2MUM A;  5EYA F;  1FLL A;  1N87 A;  3M62 A;  3SOU A;  2ECW A;  5LKZ A;  4I7C A;  1WEP A;  5KH7 A;  4L58 A;  2YQM A;  4FIP A;  2LGG A;  2YW8 A;  3HU6 A;  4V3L C;  2YYR A;  4L7X A;  2L43 A;  3DPL R;  1E4U A;  2LRI C;  1RF3 A;  2MA6 A;  4PPE A;  3RPG C;  2M1R A;  2MT5 A;  1HYI A;  5FB0 A;  1Z60 A;  3NG2 A;  1D01 A;  1LDJ B;  4Z8M A;  3PUR A;  1F3V B;  3ZYQ A;  3ZTG A;  3U5N A;  2KRE A;  3N9P A;  5D1K B;  5H1V A;  1ZBD B;  2YSM A;  3L1Z B;  2YUR A;  2CR2 A;  4WZ2 A;  3HCT A;  1Z2Q A;  4YSI A;  2VPB A;  1WEE A;  4IC2 A;  1WEM A;  3EB6 A;  1G25 A;  4B86 C;  3HQM A;  5LKX A;  1WEN A;  3U5P A;  5AIT A;  2K4D A;  4YBT A;  1U6G B;  4BBQ A;  4WZ3 B;  2F1W A;  4PTB A;  5FER A;  3SOW A;  3O34 A;  5H9M A;  3T6R A;  1V87 A;  1FP0 A;  3VK6 A;  3O7A A;  3DQV R;  5B77 A;  3SOX A;  2HYE D;  2ECV A;  3MHH A;  2JMJ A;  2CT2 A;  4X3G A;  2LQ6 A;  5B8D A;  5AIU A;  3RPG B;  2JMI A;  3GV4 A;  1CZY A;  2C2L A;  2H0D B;  5DKA A;  4R2Y A;  4R8P K;  5JG6 A;  2LGK A;  1WEQ A;  3IVQ A;  2H0D A;  2UZG A;  1VD4 A;  3C5K A;  2L5U A;  2VJF A;  4LK9 A;  2ECN A;  1WGM A;  2L80 A;  1WIL A;  2ECG A;  4BHW A;  2LV9 A;  2E6S A;  4ZQL A;  2EOD A;  4GNG A;  5H1T A;  4GNE A;  3LRQ A;  4O64 A;  2Y1M A;  4UP0 A;  3LQJ A;  3N9M A;  2IDA A;  3U5O A;  2NAA A;  2KWO A;  5B78 A;  4CCG X;  4C9Z A;  1VFY A;  5LKU A;  1QSC A;  2YT5 A;  1LB5 A;  3IHP A;  4N4F A;  3N9N A;  5G05 B;  2PNX A;  5B79 A;  2KGI A;  2LXP C;  2F6J A;  3V43 A;  4O1V A;  2G43 A;  3FL2 A;  4LAD B;  5B76 A;  2VPD A;  2MA5 A;  4UP5 A;  1MM3 A;  2I50 A;  3MQR A;  3MHS A;  2XEU A;  3RTR B;  1WFK A;  2ECI A;  2M6M A;  5FEY A;  4Q6F A;  2PUY A;  4CA1 A;  1WES A; 
#chains in the Genus database with same CATH topology
 5C11 A;  4A4C A;  2FSA A;  4YAB A;  2L0B A;  2CSY A;  2QIC A;  4B7Y C;  2G6Q A;  4S3O B;  5TDW A;  1JM7 B;  4LJN A;  5K3Q A;  2KE1 A;  4I7B A;  5LKT A;  5G04 B;  2A25 A;  3IVB A;  3EB5 A;  2VNF A;  4K8U A;  2Y43 A;  5TAB A;  1L0A A;  2VPG A;  2F1Z A;  3M63 A;  4YAT A;  1JM7 A;  2M3H A;  2JUN A;  1LDK C;  2YVR A;  4M4E A;  3PUQ A;  3DWD A;  4YAX A;  4I7D A;  2KWK A;  4GJH A;  1FBV A;  1JOC A;  3O33 A;  4V3K C;  4YAD A;  2E61 A;  1CA4 A;  5H1U A;  2E6R A;  2HDP A;  4NN2 A;  3O47 A;  2VJE B;  1FLK A;  3HCS A;  3HSV A;  2LXH C;  1RMD A;  2VJF B;  1CHC A;  4JJQ A;  2ECT A;  2VJE A;  1D0J A;  2P57 A;  4MVT A;  3ZPV 1;  5DIN A;  3KNV A;  2YHO A;  2K1J A;  4A0C D;  2G45 A;  3LVQ E;  4LKA A;  2DX8 A;  1DCQ A;  2XOZ A;  4GWN A;  2CSV A;  2AN6 A;  2KFT A;  3E2D A;  3GL6 A;  1D0A A;  2YRE A;  1CZZ A;  2FOO A;  2ZET C;  3O35 A;  3N9Q A;  1CA9 A;  2RI7 A;  3ASL A;  4MSX A;  4QQ4 A;  3ZPV E;  3U5M A;  1HYJ A;  4W4U A;  2K16 A;  2XXN A;  3HQI A;  3LQI A;  4AVX A;  2FFW A;  3ZNI A;  5KH9 A;  3L11 A;  2VPE A;  4FK5 A;  3Q1D A;  1LB4 A;  4O62 A;  4QF3 A;  2QIZ A;  4YBS A;  3LJU X;  2QJ0 A;  3HQH A;  4TKP B;  4IC3 A;  1VYX A;  4WZ0 A;  4XI1 A;  3FEH A;  4N3W A;  5FB1 A;  1F62 A;  4WA6 A;  3IVV A;  4UI9 B;  2FOP A;  2KIZ A;  1LB6 A;  1YZE A;  1MBM A;  3O37 A;  3O36 A;  1KZZ A;  3T9K A;  2Y1N A;  3LQH A;  4GHU A;  2XB1 A;  2KWJ A;  2KWN A;  4F1P A;  3H7H A;  2F1X A;  2F42 A;  3QZV A;  2GKW A;  3SHB A;  3HCU A;  2XP0 A;  1WEO A;  1WIM A;  2CSZ A;  3KV5 A;  5SVX A;  2C2V S;  2M85 A;  4FO9 A;  2XOC A;  1T1H A;  2EA6 A;  1XWH A;  2MD8 C;  4LLB A;  5D1L B;  1ZMS A;  3L1X A;  1WEW A;  4A49 A;  3I2D A;  2KR4 A;  5B75 A;  4P5O B;  4R7E A;  2OWA A;  3LVR E;  2F6N A;  5G0F A;  5SVI B;  2KKY A;  4FJC A;  2LN0 A;  2FUI A;  2FOJ A;  1WE9 A;  2K17 A;  5E1T A;  2YQL A;  2MIQ A;  2KYU A;  3KV6 A;  3ZVZ B;  5SVI A;  2KU3 A;  2LGL A;  3T7L A;  4OGE A;  1Z6U A;  2YUC A;  4GND A;  1IYM A;  2LDR A;  5C13 A;  4YC9 A;  5TDR A;  5LCW B;  4YBM A;  2FUU A;  5TRB A;  2OXQ C;  3N9L A;  2BAY A;  3HQL A;  1BOR A;  2MNZ A;  1D00 A;  4A4B A;  3M99 A;  1WEV A;  2CKL B;  5TBN A;  3MQS C;  2YSJ A;  5J3X A;  4QF2 A;  2JRJ A;  4ZUX U;  3KQI A;  3PHD A;  1DVP A;  4GWM A;  2CKL A;  3HTK C;  4KG9 A;  4AP4 A;  4AYC B;  5I3L A;  3FJU B;  3N9O A;  2EGP A;  2YU4 A;  2JM3 A;  2YHN A;  4AUQ B;  2MD7 B;  4GNF A;  3ZVY A;  2VP7 A;  4AYC A;  1MM2 A;  1X4I A;  2L75 A;  5D1M B;  1YY6 A;  1WEU A;  2MNY A;  5KH3 A;  1X4J A;  2D8S A;  3O70 A;  3ZJB A;  4S3O C;  2DSM A;  2ECJ A;  2LGV A;  4ZDT A;  2RSD A;  2JMD A;  2KGG A;  1K2F A;  4F52 B;  4GB0 A;  2F1Y A;  3C6W A;  1X4U A;  2MUM A;  5EYA F;  1FLL A;  1N87 A;  2M13 A;  3M62 A;  3SOU A;  2ECW A;  5LKZ A;  4I7C A;  1WEP A;  5KH7 A;  4L58 A;  2MKE A;  2YQM A;  4FIP A;  2LGG A;  2YW8 A;  3HU6 A;  4V3L C;  2YYR A;  4L7X A;  2L43 A;  3DPL R;  1E4U A;  2LRI C;  1RF3 A;  2FD4 A;  2MA6 A;  4PPE A;  3RPG C;  2L7P A;  2M1R A;  2MT5 A;  1HYI A;  5FB0 A;  1Z60 A;  3NG2 A;  1D01 A;  3MDB C;  1LDJ B;  4Z8M A;  3PUR A;  1F3V B;  3ZYQ A;  3ZTG A;  3U5N A;  2KRE A;  2DJA A;  3N9P A;  5D1K B;  2CRW A;  5H1V A;  3LDY A;  3FAO A;  1ZBD B;  2YSM A;  3L1Z B;  2YUR A;  2CR2 A;  4WZ2 A;  3HCT A;  1Z2Q A;  4YSI A;  2VPB A;  1WEE A;  4IC2 A;  1WEM A;  3FM8 C;  3EB6 A;  2IQJ A;  1G25 A;  4B86 C;  3HQM A;  3FAN A;  2CRR A;  5SVY A;  5LKX A;  1WEN A;  3U5P A;  5AIT A;  2K4D A;  2D8U A;  4YBT A;  1U6G B;  4BBQ A;  4WZ3 B;  2F1W A;  4PTB A;  5FER A;  3SOW A;  3O34 A;  5H9M A;  3T6R A;  1V87 A;  1FP0 A;  3KDE C;  3VK6 A;  3O7A A;  2EXU A;  3DQV R;  5B77 A;  4OGC A;  3SOX A;  2HYE D;  2ECV A;  3MHH A;  2JMJ A;  2CT2 A;  4X3G A;  2LQ6 A;  5B8D A;  5AIU A;  3RPG B;  2JMI A;  3GV4 A;  1CZY A;  2C2L A;  2H0D B;  5DKA A;  4R2Y A;  4R8P K;  5JG6 A;  2LGK A;  1WEQ A;  3DDT A;  3IVQ A;  2H0D A;  2UZG A;  1VD4 A;  3C5K A;  2L5U A;  2LAU A;  4Z0O A;  2VJF A;  4LK9 A;  2ECN A;  1WGM A;  2L80 A;  1WIL A;  2ECG A;  4BHW A;  2LV9 A;  2E6S A;  4ZQL A;  2EGM A;  2EOD A;  2B0O E;  4GNG A;  2CON A;  2XOY A;  4Z0R A;  5H1T A;  4GNE A;  3LRQ A;  4O64 A;  2Y1M A;  4UP0 A;  3LQJ A;  3N9M A;  2IDA A;  3U5O A;  2NAA A;  2KWO A;  5B78 A;  4CCG X;  4C9Z A;  1VFY A;  5LKU A;  1QSC A;  2YT5 A;  1LB5 A;  3IHP A;  4N4F A;  3N9N A;  5G05 B;  2PNX A;  5B79 A;  2KGI A;  2LXP C;  2F6J A;  4H9D A;  2RR4 A;  3M7K A;  3V43 A;  4O1V A;  2G43 A;  3FL2 A;  4LAD B;  5B76 A;  2VPD A;  2MA5 A;  4UP5 A;  1MM3 A;  2I50 A;  3MQR A;  3MHS A;  2XEU A;  3RTR B;  1WFK A;  2ECI A;  3JUE A;  2M6M A;  5FEY A;  4Q6F A;  2PUY A;  4CA1 A;  3PLW A;  1WES A;  2KKX A;  3SUB A; 
#chains in the Genus database with same CATH homology
 5C11 A;  4A4C A;  2FSA A;  4YAB A;  2L0B A;  2CSY A;  2QIC A;  4B7Y C;  2G6Q A;  4S3O B;  5TDW A;  1JM7 B;  4LJN A;  2KE1 A;  4I7B A;  5LKT A;  5G04 B;  2A25 A;  3IVB A;  3EB5 A;  2VNF A;  4K8U A;  2Y43 A;  5TAB A;  1L0A A;  2VPG A;  2F1Z A;  3M63 A;  4YAT A;  1JM7 A;  2M3H A;  1LDK C;  4M4E A;  3PUQ A;  4YAX A;  4I7D A;  2KWK A;  4GJH A;  1FBV A;  1JOC A;  3O33 A;  4V3K C;  4YAD A;  1CA4 A;  5H1U A;  2E6R A;  2HDP A;  4NN2 A;  2VJE B;  1FLK A;  3HCS A;  3HSV A;  2LXH C;  1RMD A;  2VJF B;  1CHC A;  4JJQ A;  2ECT A;  2VJE A;  1D0J A;  4MVT A;  3ZPV 1;  5DIN A;  3KNV A;  2YHO A;  2K1J A;  4A0C D;  2G45 A;  4LKA A;  2DX8 A;  4GWN A;  2AN6 A;  2KFT A;  3GL6 A;  1D0A A;  2YRE A;  1CZZ A;  2FOO A;  2ZET C;  3O35 A;  3N9Q A;  1CA9 A;  2RI7 A;  3ASL A;  4MSX A;  3ZPV E;  3U5M A;  1HYJ A;  4W4U A;  2K16 A;  2XXN A;  3HQI A;  3LQI A;  4AVX A;  3ZNI A;  5KH9 A;  3L11 A;  2VPE A;  4FK5 A;  1LB4 A;  4QF3 A;  2QIZ A;  4YBS A;  2QJ0 A;  3HQH A;  4TKP B;  4IC3 A;  1VYX A;  4WZ0 A;  4XI1 A;  4N3W A;  5FB1 A;  1F62 A;  4WA6 A;  3IVV A;  4UI9 B;  2FOP A;  2KIZ A;  1LB6 A;  1YZE A;  3O37 A;  3O36 A;  1KZZ A;  2Y1N A;  3LQH A;  4GHU A;  2XB1 A;  2KWJ A;  2KWN A;  2F1X A;  2F42 A;  3QZV A;  2GKW A;  3SHB A;  3HCU A;  1WEO A;  1WIM A;  2CSZ A;  3KV5 A;  2C2V S;  2M85 A;  4FO9 A;  1T1H A;  2EA6 A;  1XWH A;  2MD8 C;  4LLB A;  5D1L B;  1ZMS A;  3L1X A;  1WEW A;  4A49 A;  3I2D A;  2KR4 A;  5B75 A;  4P5O B;  4R7E A;  2F6N A;  5G0F A;  4FJC A;  2LN0 A;  2FUI A;  2FOJ A;  1WE9 A;  2K17 A;  5E1T A;  2YQL A;  2MIQ A;  2KYU A;  3KV6 A;  3ZVZ B;  2KU3 A;  2LGL A;  3T7L A;  1Z6U A;  2YUC A;  4GND A;  1IYM A;  2LDR A;  5C13 A;  4YC9 A;  5TDR A;  5LCW B;  4YBM A;  2FUU A;  5TRB A;  2OXQ C;  3N9L A;  2BAY A;  3HQL A;  1BOR A;  2MNZ A;  1D00 A;  4A4B A;  3M99 A;  1WEV A;  2CKL B;  5TBN A;  3MQS C;  2YSJ A;  5J3X A;  4QF2 A;  2JRJ A;  4ZUX U;  3KQI A;  3PHD A;  1DVP A;  4GWM A;  2CKL A;  3HTK C;  4KG9 A;  4AP4 A;  4AYC B;  5I3L A;  3N9O A;  2EGP A;  2YU4 A;  2YHN A;  4AUQ B;  2MD7 B;  4GNF A;  3ZVY A;  2VP7 A;  4AYC A;  1MM2 A;  1X4I A;  2L75 A;  5D1M B;  1YY6 A;  1WEU A;  2MNY A;  5KH3 A;  1X4J A;  2D8S A;  3O70 A;  3ZJB A;  4S3O C;  2ECJ A;  2LGV A;  4ZDT A;  2RSD A;  2JMD A;  2KGG A;  1K2F A;  4F52 B;  4GB0 A;  2F1Y A;  3C6W A;  1X4U A;  2MUM A;  5EYA F;  1FLL A;  1N87 A;  3M62 A;  3SOU A;  2ECW A;  5LKZ A;  4I7C A;  1WEP A;  5KH7 A;  4L58 A;  2YQM A;  4FIP A;  2LGG A;  2YW8 A;  3HU6 A;  4V3L C;  2YYR A;  4L7X A;  2L43 A;  3DPL R;  1E4U A;  2LRI C;  1RF3 A;  2MA6 A;  4PPE A;  3RPG C;  2M1R A;  2MT5 A;  1HYI A;  5FB0 A;  1Z60 A;  3NG2 A;  1D01 A;  1LDJ B;  4Z8M A;  3PUR A;  1F3V B;  3ZYQ A;  3ZTG A;  3U5N A;  2KRE A;  3N9P A;  5D1K B;  5H1V A;  1ZBD B;  2YSM A;  3L1Z B;  2YUR A;  2CR2 A;  4WZ2 A;  3HCT A;  1Z2Q A;  4YSI A;  2VPB A;  1WEE A;  4IC2 A;  1WEM A;  3EB6 A;  1G25 A;  4B86 C;  3HQM A;  5LKX A;  1WEN A;  3U5P A;  5AIT A;  2K4D A;  4YBT A;  1U6G B;  4BBQ A;  4WZ3 B;  2F1W A;  4PTB A;  5FER A;  3SOW A;  3O34 A;  5H9M A;  3T6R A;  1V87 A;  1FP0 A;  3VK6 A;  3O7A A;  3DQV R;  5B77 A;  3SOX A;  2HYE D;  2ECV A;  3MHH A;  2JMJ A;  2CT2 A;  4X3G A;  2LQ6 A;  5B8D A;  5AIU A;  3RPG B;  2JMI A;  3GV4 A;  1CZY A;  2C2L A;  2H0D B;  5DKA A;  4R2Y A;  4R8P K;  5JG6 A;  2LGK A;  1WEQ A;  3IVQ A;  2H0D A;  2UZG A;  1VD4 A;  3C5K A;  2L5U A;  2VJF A;  4LK9 A;  2ECN A;  1WGM A;  2L80 A;  1WIL A;  2ECG A;  4BHW A;  2LV9 A;  2E6S A;  4ZQL A;  2EOD A;  4GNG A;  5H1T A;  4GNE A;  3LRQ A;  4O64 A;  2Y1M A;  4UP0 A;  3LQJ A;  3N9M A;  2IDA A;  3U5O A;  2NAA A;  2KWO A;  5B78 A;  4CCG X;  4C9Z A;  1VFY A;  5LKU A;  1QSC A;  2YT5 A;  1LB5 A;  3IHP A;  4N4F A;  3N9N A;  5G05 B;  2PNX A;  5B79 A;  2KGI A;  2LXP C;  2F6J A;  3V43 A;  4O1V A;  2G43 A;  3FL2 A;  4LAD B;  5B76 A;  2VPD A;  2MA5 A;  4UP5 A;  1MM3 A;  2I50 A;  3MQR A;  3MHS A;  2XEU A;  3RTR B;  1WFK A;  2ECI A;  2M6M A;  5FEY A;  4Q6F A;  2PUY A;  4CA1 A;  1WES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...