4X3GA

Crystal structure of siah1 sina domain in complex with a usp19 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
188
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase SIAH1
total genus 36
structure length 188
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4x3gA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4x3gA01
3ZYQA 2YU4A 3RTRB 2YHOA 4GJHA 1WE9A 3N9NA 3U5MA 1D0JA 4M4EA 4LK9A 2CR2A 2G6QA 3SOXA 2KREA 4FK5A 1HYIA 3IVVA 5KH9A 2ECGA 5DKAA 5LKXA 1JOCA 4N3WA 2K17A 2ECWA 1CZYA 4I7BA 4AUQB 1RF3A 5LKTA 4F52B 2C2VS 2F6JA 2VJEB 1ZMSA 4O1VA 1LB4A 2YW8A 2MUMA 2FSAA 1WEMA 4P5OB 2QJ0A 2JMDA 2VNFA 2OXQC 3N9LA 2G45A 1WESA 2QIZA 2LRIC 4V3KC 1LDKC 2KU3A 3I2DA 1WILA 2K16A 4A49A 2D8SA 2E6SA 3KQIA 2PNXA 4WZ0A 3MHSA 2ECNA 5B75A 3DPLR 3N9MA 3IHPA 4I7CA 4YSIA 1LB5A 3C5KA 2M1RA 3ZPV1 4AP4A 5FB1A 5FEYA 3HQMA 4A4BA 1WEVA 2KWOA 2YREA 5B76A 5B8DA 4KG9A 4LADB 2RSDA 2F42A 2FUUA 5B77A 5H1VA 4YBSA 2MA6A 3U5OA 2L75A 3GV4A 5D1MB 2F1WA 4CCGX 1X4IA 3PHDA 2LGVA 5G05B 3SOWA 3N9OA 1VYXA 3MHHA 4QF2A 2M85A 2VPEA 3IVQA 2KWJA 2ZETC 1N87A 2YSMA 3RPGB 2CSYA 2YT5A 3SOUA 4BHWA 3LRQA 2F1ZA 4AYCB 2XB1A 2VJFA 3HQLA 3ZJBA 3N9QA 1CZZA 1X4UA 2EODA 2VPBA 5D1KB 4GWNA 2KIZA 3V43A 2LGLA 2MD7B 5AIUA 3ZTGA 2Y1MA 1WFKA 3ZPVE 3L1XA 4GNGA 2ECIA 1KZZA 1F62A 3QZVA 1FBVA 3PUQA 4S3OC 5DINA 2JMIA 1WEWA 2FUIA 1WEOA 1VD4A 2M6MA 3N9PA 4YABA 4ZUXU 2LQ6A 4C9ZA 2H0DB 2RI7A 4Q6FA 3EB6A 3M99A 1L0AA 3LQHA 2AN6A 2ECJA 2YHNA 4YAXA 5FB0A 2MNZA 4GWMA 5H1UA 2YQLA 5E1TA 2UZGA 1QSCA 4R7EA 2F1XA 2LGGA 1D00A 4L7XA 1Z60A 3HCTA 2JRJA 4MVTA 4PPEA 2KFTA 5H1TA 2L80A 1CA9A 3U5PA 2G43A 4I7DA 1RMDA 4LLBA 2KYUA 5TABA 3GL6A 1LDJB 2E6RA 2BAYA 2A25A 2MA5A 3DQVR 4GNEA 3M63A 4UP0A 5B78A 2IDAA 3L1ZB 3HCUA 1WEPA 2HYED 1LB6A 2LV9A 2H0DA 2DX8A 2ECVA 1CHCA 1BORA 3VK6A 4AYCA 3PURA 3ZVZB 2KGIA 4JJQA 4YADA 3L11A 4A4CA 1Z2QA 2PUYA 4UI9B 4S3OB 2MD8C 1YZEA 4GNFA 3O37A 2LGKA 3O35A 4GB0A 4CA1A 5C13A 1JM7A 4UP5A 2LXHC 5FERA 3O7AA 2VPDA 3ASLA 3FL2A 4XI1A 1JM7B 2XEUA 2EGPA 2YQMA 5EYAF 4YATA 1WIMA 3KV6A 2LDRA 2YUCA 2F6NA 3KV5A 4AVXA 2CT2A 2L5UA 1F3VB 5KH3A 1CA4A 4BBQA 4X3GA 5G04B 1D01A 1FLLA 1D0AA 4YBMA 5TRBA 2XXNA 3HCSA 4R2YA 3MQRA 2LN0A 4O64A 2NAAA 5AITA 4FJCA 4GNDA 1FLKA 3O36A 3NG2A 4IC2A 3HSVA 2I50A 1G25A 2CSZA 4K8UA 4IC3A 4Z8MA 2JMJA 2MIQA 3O70A 2MT5A 1T1HA 4W4UA 1X4JA 2CKLA 2FOJA 5J3XA 3HQHA 1WEQA 2FOPA 3ZNIA 4LKAA 1K2FA 4R8PK 1FP0A 5KH7A 2YYRA 4FIPA 2EA6A 2GKWA 3EB5A 5TDRA 5D1LB 1MM2A 4YBTA 5LKZA 2Y1NA 5B79A 2L43A 3RPGC 2KWKA 1YY6A 1V87A 2KE1A 4B86C 4A0CD 2LXPC 2KGGA 3O34A 2MNYA 3O33A 5G0FA 2ECTA 4FO9A 5JG6A 4B7YC 2KWNA 3HQIA 4LJNA 2Y43A 1Z6UA 2C2LA 2M3HA 2HDPA 3ZVYA 1WGMA 2YURA 2QICA 5LCWB 2VPGA 1WEEA 1MM3A 2L0BA 1XWHA 3HU6A 1VFYA 3C6WA 1WENA 3M62A 4YC9A 5C11A 4TKPB 4NN2A 1ZBDB 4V3LC 2CKLB 1U6GB 4N4FA 2K4DA 4WA6A 1DVPA 3KNVA 3IVBA 4ZQLA 2VJFB 4GHUA 4ZDTA 2YSJA 5I3LA 1HYJA 4PTBA 4WZ2A 3HTKC 1E4UA 3LQJA 3SHBA 3T6RA 3T7LA 2K1JA 1WEUA 2FOOA 2VP7A 4WZ3B 5TDWA 4QF3A 2F1YA 5LKUA 3U5NA 1IYMA 4L58A 5TBNA 3LQIA 2KR4A 3MQSC 2VJEA 4MSXA 5H9MA
chains in the Genus database with same CATH superfamily
3ZYQA 2YU4A 3RTRB 2YHOA 4OGEA 4GJHA 1WE9A 3N9NA 3U5MA 1D0JA 4M4EA 4LK9A 2CR2A 2G6QA 2CSVA 3SOXA 2KREA 4FK5A 1HYIA 3IVVA 5KH9A 2ECGA 5DKAA 5LKXA 1JOCA 4N3WA 2K17A 2ECWA 1CZYA 4OGCA 4I7BA 4AUQB 1RF3A 5LKTA 4F52B 2C2VS 2F6JA 2VJEB 1ZMSA 1MBMA 4O1VA 1LB4A 2YW8A 2MUMA 2FSAA 1WEMA 4P5OB 2QJ0A 2JMDA 4F1PA 3Q1DA 2VNFA 2OXQC 3N9LA 2G45A 1WESA 2QIZA 2LRIC 4V3KC 1LDKC 2KU3A 3FEHA 3I2DA 1WILA 2K16A 4A49A 2D8SA 2E6SA 3KQIA 2PNXA 4WZ0A 3MHSA 2ECNA 5B75A 2XOYA 3DPLR 2CRRA 3N9MA 3IHPA 4I7CA 4YSIA 5SVYA 1LB5A 3C5KA 2M1RA 3ZPV1 4AP4A 5FB1A 3FJUB 5FEYA 3HQMA 4A4BA 1WEVA 2KWOA 2YREA 5B76A 5B8DA 2XOCA 4KG9A 4LADB 2RSDA 2F42A 2FUUA 5B77A 5H1VA 4YBSA 3LVRE 2MA6A 4Z0RA 2L75A 3U5OA 3GV4A 3PLWA 5D1MB 5SVIB 2F1WA 2KKYA 4CCGX 1X4IA 2L7PA 3PHDA 2LGVA 2CRWA 5G05B 3SOWA 3N9OA 3LJUX 1VYXA 3MHHA 4QF2A 2M85A 2VPEA 3IVQA 2KWJA 2M13A 2ZETC 1N87A 2YSMA 3RPGB 2CSYA 2YT5A 3SOUA 4BHWA 3LRQA 2F1ZA 2DSMA 2XB1A 4AYCB 2VJFA 3HQLA 3ZJBA 2MKEA 3N9QA 1CZZA 1X4UA 2EODA 2VPBA 5D1KB 4GWNA 2KIZA 3V43A 2LGLA 2MD7B 5AIUA 3ZTGA 2Y1MA 3DDTA 1WFKA 3ZPVE 3L1XA 4GNGA 2EGMA 2ECIA 1KZZA 1F62A 3JUEA 3QZVA 1FBVA 3PUQA 4S3OC 5DINA 2JMIA 1WEWA 2FFWA 2FUIA 1WEOA 1VD4A 2M6MA 3N9PA 4YABA 2OWAA 4ZUXU 2LQ6A 4C9ZA 2H0DB 2RI7A 4Q6FA 3EB6A 3M99A 1L0AA 3LQHA 2AN6A 2ECJA 2YHNA 4YAXA 5FB0A 2MNZA 4GWMA 5H1UA 2YQLA 5E1TA 2UZGA 1QSCA 4R7EA 2D8UA 2F1XA 3DWDA 2LGGA 3E2DA 1D00A 4L7XA 1Z60A 3HCTA 2JRJA 4MVTA 4PPEA 2KFTA 5H1TA 2L80A 1CA9A 2RR4A 3U5PA 2G43A 3SUBA 4I7DA 1RMDA 2IQJA 1DCQA 2XOZA 4LLBA 2EXUA 2KYUA 5TABA 3GL6A 1LDJB 2E6RA 2BAYA 2A25A 2MA5A 3DQVR 4GNEA 4Z0OA 3M63A 4UP0A 5B78A 2IDAA 3L1ZB 3HCUA 1WEPA 2HYED 1LB6A 2LV9A 2H0DA 2DX8A 2ECVA 1CHCA 1BORA 2P57A 3VK6A 4AYCA 3PURA 3FAOA 3ZVZB 2KGIA 4JJQA 4YADA 3L11A 3LDYA 4A4CA 1Z2QA 2PUYA 4UI9B 4S3OB 2MD8C 1YZEA 3FANA 4GNFA 3O37A 2LGKA 3O35A 4GB0A 4CA1A 5C13A 1JM7A 4UP5A 2B0OE 2LXHC 5FERA 3O7AA 2VPDA 3ASLA 3FL2A 5SVXA 4XI1A 2KKXA 1JM7B 2XEUA 2EGPA 2YQMA 5EYAF 4YATA 3T9KA 1WIMA 3KV6A 2LDRA 2YUCA 2F6NA 2CONA 3KV5A 4AVXA 2CT2A 2L5UA 1F3VB 5KH3A 1CA4A 4BBQA 4X3GA 5G04B 1D01A 1FLLA 1D0AA 3KDEC 4YBMA 5TRBA 3O47A 2XXNA 3HCSA 4R2YA 3MQRA 2LN0A 4O64A 2NAAA 5AITA 4FJCA 4GNDA 1FLKA 3O36A 3NG2A 4IC2A 3HSVA 3M7KA 2I50A 1G25A 2CSZA 4K8UA 4IC3A 4Z8MA 2JMJA 2MIQA 3O70A 2MT5A 1T1HA 4W4UA 1X4JA 2CKLA 2FOJA 2YVRA 5J3XA 3HQHA 1WEQA 2FOPA 3ZNIA 2JM3A 4LKAA 1K2FA 5K3QA 4R8PK 2E61A 4QQ4A 1FP0A 5KH7A 2YYRA 4FIPA 2DJAA 2EA6A 2GKWA 3EB5A 5TDRA 5D1LB 1MM2A 3FM8C 4YBTA 5LKZA 2Y1NA 5B79A 2L43A 3RPGC 2KWKA 1YY6A 3LVQE 1V87A 2KE1A 4B86C 4A0CD 2LXPC 2KGGA 3O34A 2MNYA 3O33A 5G0FA 2ECTA 4FO9A 5JG6A 4B7YC 2KWNA 3HQIA 4LJNA 2Y43A 4H9DA 1Z6UA 2C2LA 2M3HA 2HDPA 3ZVYA 1WGMA 2YURA 2LAUA 2QICA 5LCWB 3H7HA 2VPGA 1WEEA 1MM3A 2L0BA 2FD4A 1XWHA 3HU6A 1VFYA 3C6WA 1WENA 3M62A 4YC9A 5C11A 4TKPB 4NN2A 1ZBDB 4V3LC 2CKLB 1U6GB 4N4FA 2K4DA 4WA6A 1DVPA 5SVIA 3KNVA 2JUNA 3IVBA 4ZQLA 2VJFB 4GHUA 4ZDTA 2YSJA 5I3LA 1HYJA 2XP0A 4PTBA 3MDBC 4WZ2A 3HTKC 1E4UA 3LQJA 3SHBA 3T6RA 3T7LA 2K1JA 1WEUA 2FOOA 2VP7A 4WZ3B 5TDWA 4QF3A 2F1YA 5LKUA 3U5NA 1IYMA 4L58A 5TBNA 3LQIA 2KR4A 3MQSC 2VJEA 4MSXA 4O62A 5H9MA
chains in the Genus database with same CATH topology
3ZYQA 2YU4A 3RTRB 2YHOA 4GJHA 1WE9A 3N9NA 3U5MA 1D0JA 4M4EA 4LK9A 2CR2A 2G6QA 3SOXA 2KREA 4FK5A 1HYIA 3IVVA 5KH9A 2ECGA 5DKAA 5LKXA 1JOCA 4N3WA 2K17A 2ECWA 1CZYA 4I7BA 4AUQB 1RF3A 5LKTA 4F52B 2C2VS 2F6JA 2VJEB 1ZMSA 4O1VA 1LB4A 2YW8A 2MUMA 2FSAA 1WEMA 4P5OB 2QJ0A 2JMDA 2VNFA 2OXQC 3N9LA 2G45A 1WESA 2QIZA 2LRIC 4V3KC 1LDKC 2KU3A 3I2DA 1WILA 2K16A 4A49A 2D8SA 2E6SA 3KQIA 2PNXA 4WZ0A 3MHSA 2ECNA 5B75A 3DPLR 3N9MA 3IHPA 4I7CA 4YSIA 1LB5A 3C5KA 2M1RA 3ZPV1 4AP4A 5FB1A 5FEYA 3HQMA 4A4BA 1WEVA 2KWOA 2YREA 5B76A 5B8DA 4KG9A 4LADB 2RSDA 2F42A 2FUUA 5B77A 5H1VA 4YBSA 2MA6A 3U5OA 2L75A 3GV4A 5D1MB 2F1WA 4CCGX 1X4IA 3PHDA 2LGVA 5G05B 3SOWA 3N9OA 1VYXA 3MHHA 4QF2A 2M85A 2VPEA 3IVQA 2KWJA 2ZETC 1N87A 2YSMA 3RPGB 2CSYA 2YT5A 3SOUA 4BHWA 3LRQA 2F1ZA 4AYCB 2XB1A 2VJFA 3HQLA 3ZJBA 3N9QA 1CZZA 1X4UA 2EODA 2VPBA 5D1KB 4GWNA 2KIZA 3V43A 2LGLA 2MD7B 5AIUA 3ZTGA 2Y1MA 1WFKA 3ZPVE 3L1XA 4GNGA 2ECIA 1KZZA 1F62A 3QZVA 1FBVA 3PUQA 4S3OC 5DINA 2JMIA 1WEWA 2FUIA 1WEOA 1VD4A 2M6MA 3N9PA 4YABA 4ZUXU 2LQ6A 4C9ZA 2H0DB 2RI7A 4Q6FA 3EB6A 3M99A 1L0AA 3LQHA 2AN6A 2ECJA 2YHNA 4YAXA 5FB0A 2MNZA 4GWMA 5H1UA 2YQLA 5E1TA 2UZGA 1QSCA 4R7EA 2F1XA 2LGGA 1D00A 4L7XA 1Z60A 3HCTA 2JRJA 4MVTA 4PPEA 2KFTA 5H1TA 2L80A 1CA9A 3U5PA 2G43A 4I7DA 1RMDA 4LLBA 2KYUA 5TABA 3GL6A 1LDJB 2E6RA 2BAYA 2A25A 2MA5A 3DQVR 4GNEA 3M63A 4UP0A 5B78A 2IDAA 3L1ZB 3HCUA 1WEPA 2HYED 1LB6A 2LV9A 2H0DA 2DX8A 2ECVA 1CHCA 1BORA 3VK6A 4AYCA 3PURA 3ZVZB 2KGIA 4JJQA 4YADA 3L11A 4A4CA 1Z2QA 2PUYA 4UI9B 4S3OB 2MD8C 1YZEA 4GNFA 3O37A 2LGKA 3O35A 4GB0A 4CA1A 5C13A 1JM7A 4UP5A 2LXHC 5FERA 3O7AA 2VPDA 3ASLA 3FL2A 4XI1A 1JM7B 2XEUA 2EGPA 2YQMA 5EYAF 4YATA 1WIMA 3KV6A 2LDRA 2YUCA 2F6NA 3KV5A 4AVXA 2CT2A 2L5UA 1F3VB 5KH3A 1CA4A 4BBQA 4X3GA 5G04B 1D01A 1FLLA 1D0AA 4YBMA 5TRBA 2XXNA 3HCSA 4R2YA 3MQRA 2LN0A 4O64A 2NAAA 5AITA 4FJCA 4GNDA 1FLKA 3O36A 3NG2A 4IC2A 3HSVA 2I50A 1G25A 2CSZA 4K8UA 4IC3A 4Z8MA 2JMJA 2MIQA 3O70A 2MT5A 1T1HA 4W4UA 1X4JA 2CKLA 2FOJA 5J3XA 3HQHA 1WEQA 2FOPA 3ZNIA 4LKAA 1K2FA 4R8PK 1FP0A 5KH7A 2YYRA 4FIPA 2EA6A 2GKWA 3EB5A 5TDRA 5D1LB 1MM2A 4YBTA 5LKZA 2Y1NA 5B79A 2L43A 3RPGC 2KWKA 1YY6A 1V87A 2KE1A 4B86C 4A0CD 2LXPC 2KGGA 3O34A 2MNYA 3O33A 5G0FA 2ECTA 4FO9A 5JG6A 4B7YC 2KWNA 3HQIA 4LJNA 2Y43A 1Z6UA 2C2LA 2M3HA 2HDPA 3ZVYA 1WGMA 2YURA 2QICA 5LCWB 2VPGA 1WEEA 1MM3A 2L0BA 1XWHA 3HU6A 1VFYA 3C6WA 1WENA 3M62A 4YC9A 5C11A 4TKPB 4NN2A 1ZBDB 4V3LC 2CKLB 1U6GB 4N4FA 2K4DA 4WA6A 1DVPA 3KNVA 3IVBA 4ZQLA 2VJFB 4GHUA 4ZDTA 2YSJA 5I3LA 1HYJA 4PTBA 4WZ2A 3HTKC 1E4UA 3LQJA 3SHBA 3T6RA 3T7LA 2K1JA 1WEUA 2FOOA 2VP7A 4WZ3B 5TDWA 4QF3A 2F1YA 5LKUA 3U5NA 1IYMA 4L58A 5TBNA 3LQIA 2KR4A 3MQSC 2VJEA 4MSXA 5H9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYQ A;  2YU4 A;  3RTR B;  2YHO A;  4GJH A;  1WE9 A;  3N9N A;  3U5M A;  1D0J A;  4M4E A;  4LK9 A;  2CR2 A;  2G6Q A;  3SOX A;  2KRE A;  4FK5 A;  1HYI A;  3IVV A;  5KH9 A;  2ECG A;  5DKA A;  5LKX A;  1JOC A;  4N3W A;  2K17 A;  2ECW A;  1CZY A;  4I7B A;  4AUQ B;  1RF3 A;  5LKT A;  4F52 B;  2C2V S;  2F6J A;  2VJE B;  1ZMS A;  4O1V A;  1LB4 A;  2YW8 A;  2MUM A;  2FSA A;  1WEM A;  4P5O B;  2QJ0 A;  2JMD A;  2VNF A;  2OXQ C;  3N9L A;  2G45 A;  1WES A;  2QIZ A;  2LRI C;  4V3K C;  1LDK C;  2KU3 A;  3I2D A;  1WIL A;  2K16 A;  4A49 A;  2D8S A;  2E6S A;  3KQI A;  2PNX A;  4WZ0 A;  3MHS A;  2ECN A;  5B75 A;  3DPL R;  3N9M A;  3IHP A;  4I7C A;  4YSI A;  1LB5 A;  3C5K A;  2M1R A;  3ZPV 1;  4AP4 A;  5FB1 A;  5FEY A;  3HQM A;  4A4B A;  1WEV A;  2KWO A;  2YRE A;  5B76 A;  5B8D A;  4KG9 A;  4LAD B;  2RSD A;  2F42 A;  2FUU A;  5B77 A;  5H1V A;  4YBS A;  2MA6 A;  3U5O A;  2L75 A;  3GV4 A;  5D1M B;  2F1W A;  4CCG X;  1X4I A;  3PHD A;  2LGV A;  5G05 B;  3SOW A;  3N9O A;  1VYX A;  3MHH A;  4QF2 A;  2M85 A;  2VPE A;  3IVQ A;  2KWJ A;  2ZET C;  1N87 A;  2YSM A;  3RPG B;  2CSY A;  2YT5 A;  3SOU A;  4BHW A;  3LRQ A;  2F1Z A;  4AYC B;  2XB1 A;  2VJF A;  3HQL A;  3ZJB A;  3N9Q A;  1CZZ A;  1X4U A;  2EOD A;  2VPB A;  5D1K B;  4GWN A;  2KIZ A;  3V43 A;  2LGL A;  2MD7 B;  5AIU A;  3ZTG A;  2Y1M A;  1WFK A;  3ZPV E;  3L1X A;  4GNG A;  2ECI A;  1KZZ A;  1F62 A;  3QZV A;  1FBV A;  3PUQ A;  4S3O C;  5DIN A;  2JMI A;  1WEW A;  2FUI A;  1WEO A;  1VD4 A;  2M6M A;  3N9P A;  4YAB A;  4ZUX U;  2LQ6 A;  4C9Z A;  2H0D B;  2RI7 A;  4Q6F A;  3EB6 A;  3M99 A;  1L0A A;  3LQH A;  2AN6 A;  2ECJ A;  2YHN A;  4YAX A;  5FB0 A;  2MNZ A;  4GWM A;  5H1U A;  2YQL A;  5E1T A;  2UZG A;  1QSC A;  4R7E A;  2F1X A;  2LGG A;  1D00 A;  4L7X A;  1Z60 A;  3HCT A;  2JRJ A;  4MVT A;  4PPE A;  2KFT A;  5H1T A;  2L80 A;  1CA9 A;  3U5P A;  2G43 A;  4I7D A;  1RMD A;  4LLB A;  2KYU A;  5TAB A;  3GL6 A;  1LDJ B;  2E6R A;  2BAY A;  2A25 A;  2MA5 A;  3DQV R;  4GNE A;  3M63 A;  4UP0 A;  5B78 A;  2IDA A;  3L1Z B;  3HCU A;  1WEP A;  2HYE D;  1LB6 A;  2LV9 A;  2H0D A;  2DX8 A;  2ECV A;  1CHC A;  1BOR A;  3VK6 A;  4AYC A;  3PUR A;  3ZVZ B;  2KGI A;  4JJQ A;  4YAD A;  3L11 A;  4A4C A;  1Z2Q A;  2PUY A;  4UI9 B;  4S3O B;  2MD8 C;  1YZE A;  4GNF A;  3O37 A;  2LGK A;  3O35 A;  4GB0 A;  4CA1 A;  5C13 A;  1JM7 A;  4UP5 A;  2LXH C;  5FER A;  3O7A A;  2VPD A;  3ASL A;  3FL2 A;  4XI1 A;  1JM7 B;  2XEU A;  2EGP A;  2YQM A;  5EYA F;  4YAT A;  1WIM A;  3KV6 A;  2LDR A;  2YUC A;  2F6N A;  3KV5 A;  4AVX A;  2CT2 A;  2L5U A;  1F3V B;  5KH3 A;  1CA4 A;  4BBQ A;  4X3G A;  5G04 B;  1D01 A;  1FLL A;  1D0A A;  4YBM A;  5TRB A;  2XXN A;  3HCS A;  4R2Y A;  3MQR A;  2LN0 A;  4O64 A;  2NAA A;  5AIT A;  4FJC A;  4GND A;  1FLK A;  3O36 A;  3NG2 A;  4IC2 A;  3HSV A;  2I50 A;  1G25 A;  2CSZ A;  4K8U A;  4IC3 A;  4Z8M A;  2JMJ A;  2MIQ A;  3O70 A;  2MT5 A;  1T1H A;  4W4U A;  1X4J A;  2CKL A;  2FOJ A;  5J3X A;  3HQH A;  1WEQ A;  2FOP A;  3ZNI A;  4LKA A;  1K2F A;  4R8P K;  1FP0 A;  5KH7 A;  2YYR A;  4FIP A;  2EA6 A;  2GKW A;  3EB5 A;  5TDR A;  5D1L B;  1MM2 A;  4YBT A;  5LKZ A;  2Y1N A;  5B79 A;  2L43 A;  3RPG C;  2KWK A;  1YY6 A;  1V87 A;  2KE1 A;  4B86 C;  4A0C D;  2LXP C;  2KGG A;  3O34 A;  2MNY A;  3O33 A;  5G0F A;  2ECT A;  4FO9 A;  5JG6 A;  4B7Y C;  2KWN A;  3HQI A;  4LJN A;  2Y43 A;  1Z6U A;  2C2L A;  2M3H A;  2HDP A;  3ZVY A;  1WGM A;  2YUR A;  2QIC A;  5LCW B;  2VPG A;  1WEE A;  1MM3 A;  2L0B A;  1XWH A;  3HU6 A;  1VFY A;  3C6W A;  1WEN A;  3M62 A;  4YC9 A;  5C11 A;  4TKP B;  4NN2 A;  1ZBD B;  4V3L C;  2CKL B;  1U6G B;  4N4F A;  2K4D A;  4WA6 A;  1DVP A;  3KNV A;  3IVB A;  4ZQL A;  2VJF B;  4GHU A;  4ZDT A;  2YSJ A;  5I3L A;  1HYJ A;  4PTB A;  4WZ2 A;  3HTK C;  1E4U A;  3LQJ A;  3SHB A;  3T6R A;  3T7L A;  2K1J A;  1WEU A;  2FOO A;  2VP7 A;  4WZ3 B;  5TDW A;  4QF3 A;  2F1Y A;  5LKU A;  3U5N A;  1IYM A;  4L58 A;  5TBN A;  3LQI A;  2KR4 A;  3MQS C;  2VJE A;  4MSX A;  5H9M A; 
#chains in the Genus database with same CATH topology
 3ZYQ A;  2YU4 A;  3RTR B;  2YHO A;  4OGE A;  4GJH A;  1WE9 A;  3N9N A;  3U5M A;  1D0J A;  4M4E A;  4LK9 A;  2CR2 A;  2G6Q A;  2CSV A;  3SOX A;  2KRE A;  4FK5 A;  1HYI A;  3IVV A;  5KH9 A;  2ECG A;  5DKA A;  5LKX A;  1JOC A;  4N3W A;  2K17 A;  2ECW A;  1CZY A;  4OGC A;  4I7B A;  4AUQ B;  1RF3 A;  5LKT A;  4F52 B;  2C2V S;  2F6J A;  2VJE B;  1ZMS A;  1MBM A;  4O1V A;  1LB4 A;  2YW8 A;  2MUM A;  2FSA A;  1WEM A;  4P5O B;  2QJ0 A;  2JMD A;  4F1P A;  3Q1D A;  2VNF A;  2OXQ C;  3N9L A;  2G45 A;  1WES A;  2QIZ A;  2LRI C;  4V3K C;  1LDK C;  2KU3 A;  3FEH A;  3I2D A;  1WIL A;  2K16 A;  4A49 A;  2D8S A;  2E6S A;  3KQI A;  2PNX A;  4WZ0 A;  3MHS A;  2ECN A;  5B75 A;  2XOY A;  3DPL R;  2CRR A;  3N9M A;  3IHP A;  4I7C A;  4YSI A;  5SVY A;  1LB5 A;  3C5K A;  2M1R A;  3ZPV 1;  4AP4 A;  5FB1 A;  3FJU B;  5FEY A;  3HQM A;  4A4B A;  1WEV A;  2KWO A;  2YRE A;  5B76 A;  5B8D A;  2XOC A;  4KG9 A;  4LAD B;  2RSD A;  2F42 A;  2FUU A;  5B77 A;  5H1V A;  4YBS A;  3LVR E;  2MA6 A;  4Z0R A;  2L75 A;  3U5O A;  3GV4 A;  3PLW A;  5D1M B;  5SVI B;  2F1W A;  2KKY A;  4CCG X;  1X4I A;  2L7P A;  3PHD A;  2LGV A;  2CRW A;  5G05 B;  3SOW A;  3N9O A;  3LJU X;  1VYX A;  3MHH A;  4QF2 A;  2M85 A;  2VPE A;  3IVQ A;  2KWJ A;  2M13 A;  2ZET C;  1N87 A;  2YSM A;  3RPG B;  2CSY A;  2YT5 A;  3SOU A;  4BHW A;  3LRQ A;  2F1Z A;  2DSM A;  2XB1 A;  4AYC B;  2VJF A;  3HQL A;  3ZJB A;  2MKE A;  3N9Q A;  1CZZ A;  1X4U A;  2EOD A;  2VPB A;  5D1K B;  4GWN A;  2KIZ A;  3V43 A;  2LGL A;  2MD7 B;  5AIU A;  3ZTG A;  2Y1M A;  3DDT A;  1WFK A;  3ZPV E;  3L1X A;  4GNG A;  2EGM A;  2ECI A;  1KZZ A;  1F62 A;  3JUE A;  3QZV A;  1FBV A;  3PUQ A;  4S3O C;  5DIN A;  2JMI A;  1WEW A;  2FFW A;  2FUI A;  1WEO A;  1VD4 A;  2M6M A;  3N9P A;  4YAB A;  2OWA A;  4ZUX U;  2LQ6 A;  4C9Z A;  2H0D B;  2RI7 A;  4Q6F A;  3EB6 A;  3M99 A;  1L0A A;  3LQH A;  2AN6 A;  2ECJ A;  2YHN A;  4YAX A;  5FB0 A;  2MNZ A;  4GWM A;  5H1U A;  2YQL A;  5E1T A;  2UZG A;  1QSC A;  4R7E A;  2D8U A;  2F1X A;  3DWD A;  2LGG A;  3E2D A;  1D00 A;  4L7X A;  1Z60 A;  3HCT A;  2JRJ A;  4MVT A;  4PPE A;  2KFT A;  5H1T A;  2L80 A;  1CA9 A;  2RR4 A;  3U5P A;  2G43 A;  3SUB A;  4I7D A;  1RMD A;  2IQJ A;  1DCQ A;  2XOZ A;  4LLB A;  2EXU A;  2KYU A;  5TAB A;  3GL6 A;  1LDJ B;  2E6R A;  2BAY A;  2A25 A;  2MA5 A;  3DQV R;  4GNE A;  4Z0O A;  3M63 A;  4UP0 A;  5B78 A;  2IDA A;  3L1Z B;  3HCU A;  1WEP A;  2HYE D;  1LB6 A;  2LV9 A;  2H0D A;  2DX8 A;  2ECV A;  1CHC A;  1BOR A;  2P57 A;  3VK6 A;  4AYC A;  3PUR A;  3FAO A;  3ZVZ B;  2KGI A;  4JJQ A;  4YAD A;  3L11 A;  3LDY A;  4A4C A;  1Z2Q A;  2PUY A;  4UI9 B;  4S3O B;  2MD8 C;  1YZE A;  3FAN A;  4GNF A;  3O37 A;  2LGK A;  3O35 A;  4GB0 A;  4CA1 A;  5C13 A;  1JM7 A;  4UP5 A;  2B0O E;  2LXH C;  5FER A;  3O7A A;  2VPD A;  3ASL A;  3FL2 A;  5SVX A;  4XI1 A;  2KKX A;  1JM7 B;  2XEU A;  2EGP A;  2YQM A;  5EYA F;  4YAT A;  3T9K A;  1WIM A;  3KV6 A;  2LDR A;  2YUC A;  2F6N A;  2CON A;  3KV5 A;  4AVX A;  2CT2 A;  2L5U A;  1F3V B;  5KH3 A;  1CA4 A;  4BBQ A;  4X3G A;  5G04 B;  1D01 A;  1FLL A;  1D0A A;  3KDE C;  4YBM A;  5TRB A;  3O47 A;  2XXN A;  3HCS A;  4R2Y A;  3MQR A;  2LN0 A;  4O64 A;  2NAA A;  5AIT A;  4FJC A;  4GND A;  1FLK A;  3O36 A;  3NG2 A;  4IC2 A;  3HSV A;  3M7K A;  2I50 A;  1G25 A;  2CSZ A;  4K8U A;  4IC3 A;  4Z8M A;  2JMJ A;  2MIQ A;  3O70 A;  2MT5 A;  1T1H A;  4W4U A;  1X4J A;  2CKL A;  2FOJ A;  2YVR A;  5J3X A;  3HQH A;  1WEQ A;  2FOP A;  3ZNI A;  2JM3 A;  4LKA A;  1K2F A;  5K3Q A;  4R8P K;  2E61 A;  4QQ4 A;  1FP0 A;  5KH7 A;  2YYR A;  4FIP A;  2DJA A;  2EA6 A;  2GKW A;  3EB5 A;  5TDR A;  5D1L B;  1MM2 A;  3FM8 C;  4YBT A;  5LKZ A;  2Y1N A;  5B79 A;  2L43 A;  3RPG C;  2KWK A;  1YY6 A;  3LVQ E;  1V87 A;  2KE1 A;  4B86 C;  4A0C D;  2LXP C;  2KGG A;  3O34 A;  2MNY A;  3O33 A;  5G0F A;  2ECT A;  4FO9 A;  5JG6 A;  4B7Y C;  2KWN A;  3HQI A;  4LJN A;  2Y43 A;  4H9D A;  1Z6U A;  2C2L A;  2M3H A;  2HDP A;  3ZVY A;  1WGM A;  2YUR A;  2LAU A;  2QIC A;  5LCW B;  3H7H A;  2VPG A;  1WEE A;  1MM3 A;  2L0B A;  2FD4 A;  1XWH A;  3HU6 A;  1VFY A;  3C6W A;  1WEN A;  3M62 A;  4YC9 A;  5C11 A;  4TKP B;  4NN2 A;  1ZBD B;  4V3L C;  2CKL B;  1U6G B;  4N4F A;  2K4D A;  4WA6 A;  1DVP A;  5SVI A;  3KNV A;  2JUN A;  3IVB A;  4ZQL A;  2VJF B;  4GHU A;  4ZDT A;  2YSJ A;  5I3L A;  1HYJ A;  2XP0 A;  4PTB A;  3MDB C;  4WZ2 A;  3HTK C;  1E4U A;  3LQJ A;  3SHB A;  3T6R A;  3T7L A;  2K1J A;  1WEU A;  2FOO A;  2VP7 A;  4WZ3 B;  5TDW A;  4QF3 A;  2F1Y A;  5LKU A;  3U5N A;  1IYM A;  4L58 A;  5TBN A;  3LQI A;  2KR4 A;  3MQS C;  2VJE A;  4MSX A;  4O62 A;  5H9M A; 
#chains in the Genus database with same CATH homology
 3ZYQ A;  2YU4 A;  3RTR B;  2YHO A;  4GJH A;  1WE9 A;  3N9N A;  3U5M A;  1D0J A;  4M4E A;  4LK9 A;  2CR2 A;  2G6Q A;  3SOX A;  2KRE A;  4FK5 A;  1HYI A;  3IVV A;  5KH9 A;  2ECG A;  5DKA A;  5LKX A;  1JOC A;  4N3W A;  2K17 A;  2ECW A;  1CZY A;  4I7B A;  4AUQ B;  1RF3 A;  5LKT A;  4F52 B;  2C2V S;  2F6J A;  2VJE B;  1ZMS A;  4O1V A;  1LB4 A;  2YW8 A;  2MUM A;  2FSA A;  1WEM A;  4P5O B;  2QJ0 A;  2JMD A;  2VNF A;  2OXQ C;  3N9L A;  2G45 A;  1WES A;  2QIZ A;  2LRI C;  4V3K C;  1LDK C;  2KU3 A;  3I2D A;  1WIL A;  2K16 A;  4A49 A;  2D8S A;  2E6S A;  3KQI A;  2PNX A;  4WZ0 A;  3MHS A;  2ECN A;  5B75 A;  3DPL R;  3N9M A;  3IHP A;  4I7C A;  4YSI A;  1LB5 A;  3C5K A;  2M1R A;  3ZPV 1;  4AP4 A;  5FB1 A;  5FEY A;  3HQM A;  4A4B A;  1WEV A;  2KWO A;  2YRE A;  5B76 A;  5B8D A;  4KG9 A;  4LAD B;  2RSD A;  2F42 A;  2FUU A;  5B77 A;  5H1V A;  4YBS A;  2MA6 A;  3U5O A;  2L75 A;  3GV4 A;  5D1M B;  2F1W A;  4CCG X;  1X4I A;  3PHD A;  2LGV A;  5G05 B;  3SOW A;  3N9O A;  1VYX A;  3MHH A;  4QF2 A;  2M85 A;  2VPE A;  3IVQ A;  2KWJ A;  2ZET C;  1N87 A;  2YSM A;  3RPG B;  2CSY A;  2YT5 A;  3SOU A;  4BHW A;  3LRQ A;  2F1Z A;  4AYC B;  2XB1 A;  2VJF A;  3HQL A;  3ZJB A;  3N9Q A;  1CZZ A;  1X4U A;  2EOD A;  2VPB A;  5D1K B;  4GWN A;  2KIZ A;  3V43 A;  2LGL A;  2MD7 B;  5AIU A;  3ZTG A;  2Y1M A;  1WFK A;  3ZPV E;  3L1X A;  4GNG A;  2ECI A;  1KZZ A;  1F62 A;  3QZV A;  1FBV A;  3PUQ A;  4S3O C;  5DIN A;  2JMI A;  1WEW A;  2FUI A;  1WEO A;  1VD4 A;  2M6M A;  3N9P A;  4YAB A;  4ZUX U;  2LQ6 A;  4C9Z A;  2H0D B;  2RI7 A;  4Q6F A;  3EB6 A;  3M99 A;  1L0A A;  3LQH A;  2AN6 A;  2ECJ A;  2YHN A;  4YAX A;  5FB0 A;  2MNZ A;  4GWM A;  5H1U A;  2YQL A;  5E1T A;  2UZG A;  1QSC A;  4R7E A;  2F1X A;  2LGG A;  1D00 A;  4L7X A;  1Z60 A;  3HCT A;  2JRJ A;  4MVT A;  4PPE A;  2KFT A;  5H1T A;  2L80 A;  1CA9 A;  3U5P A;  2G43 A;  4I7D A;  1RMD A;  4LLB A;  2KYU A;  5TAB A;  3GL6 A;  1LDJ B;  2E6R A;  2BAY A;  2A25 A;  2MA5 A;  3DQV R;  4GNE A;  3M63 A;  4UP0 A;  5B78 A;  2IDA A;  3L1Z B;  3HCU A;  1WEP A;  2HYE D;  1LB6 A;  2LV9 A;  2H0D A;  2DX8 A;  2ECV A;  1CHC A;  1BOR A;  3VK6 A;  4AYC A;  3PUR A;  3ZVZ B;  2KGI A;  4JJQ A;  4YAD A;  3L11 A;  4A4C A;  1Z2Q A;  2PUY A;  4UI9 B;  4S3O B;  2MD8 C;  1YZE A;  4GNF A;  3O37 A;  2LGK A;  3O35 A;  4GB0 A;  4CA1 A;  5C13 A;  1JM7 A;  4UP5 A;  2LXH C;  5FER A;  3O7A A;  2VPD A;  3ASL A;  3FL2 A;  4XI1 A;  1JM7 B;  2XEU A;  2EGP A;  2YQM A;  5EYA F;  4YAT A;  1WIM A;  3KV6 A;  2LDR A;  2YUC A;  2F6N A;  3KV5 A;  4AVX A;  2CT2 A;  2L5U A;  1F3V B;  5KH3 A;  1CA4 A;  4BBQ A;  4X3G A;  5G04 B;  1D01 A;  1FLL A;  1D0A A;  4YBM A;  5TRB A;  2XXN A;  3HCS A;  4R2Y A;  3MQR A;  2LN0 A;  4O64 A;  2NAA A;  5AIT A;  4FJC A;  4GND A;  1FLK A;  3O36 A;  3NG2 A;  4IC2 A;  3HSV A;  2I50 A;  1G25 A;  2CSZ A;  4K8U A;  4IC3 A;  4Z8M A;  2JMJ A;  2MIQ A;  3O70 A;  2MT5 A;  1T1H A;  4W4U A;  1X4J A;  2CKL A;  2FOJ A;  5J3X A;  3HQH A;  1WEQ A;  2FOP A;  3ZNI A;  4LKA A;  1K2F A;  4R8P K;  1FP0 A;  5KH7 A;  2YYR A;  4FIP A;  2EA6 A;  2GKW A;  3EB5 A;  5TDR A;  5D1L B;  1MM2 A;  4YBT A;  5LKZ A;  2Y1N A;  5B79 A;  2L43 A;  3RPG C;  2KWK A;  1YY6 A;  1V87 A;  2KE1 A;  4B86 C;  4A0C D;  2LXP C;  2KGG A;  3O34 A;  2MNY A;  3O33 A;  5G0F A;  2ECT A;  4FO9 A;  5JG6 A;  4B7Y C;  2KWN A;  3HQI A;  4LJN A;  2Y43 A;  1Z6U A;  2C2L A;  2M3H A;  2HDP A;  3ZVY A;  1WGM A;  2YUR A;  2QIC A;  5LCW B;  2VPG A;  1WEE A;  1MM3 A;  2L0B A;  1XWH A;  3HU6 A;  1VFY A;  3C6W A;  1WEN A;  3M62 A;  4YC9 A;  5C11 A;  4TKP B;  4NN2 A;  1ZBD B;  4V3L C;  2CKL B;  1U6G B;  4N4F A;  2K4D A;  4WA6 A;  1DVP A;  3KNV A;  3IVB A;  4ZQL A;  2VJF B;  4GHU A;  4ZDT A;  2YSJ A;  5I3L A;  1HYJ A;  4PTB A;  4WZ2 A;  3HTK C;  1E4U A;  3LQJ A;  3SHB A;  3T6R A;  3T7L A;  2K1J A;  1WEU A;  2FOO A;  2VP7 A;  4WZ3 B;  5TDW A;  4QF3 A;  2F1Y A;  5LKU A;  3U5N A;  1IYM A;  4L58 A;  5TBN A;  3LQI A;  2KR4 A;  3MQS C;  2VJE A;  4MSX A;  5H9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...