4X3GA

Crystal structure of siah1 sina domain in complex with a usp19 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
188
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase SIAH1
total genus 36
structure length 188
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4x3gA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4x3gA01
5H1UA 3HQIA 5AIUA 1WEPA 2LXHC 3IVBA 2LQ6A 3HCSA 2RSDA 2XB1A 2CT2A 5E1TA 1CA4A 3MQSC 3U5NA 2VJFB 3KV5A 1L0AA 2M1RA 1X4UA 4JJQA 2KYUA 4Z8MA 4W4UA 2KFTA 3SHBA 2ECVA 4V3KC 1D0JA 2ECJA 3N9PA 2K17A 4P5OB 4N3WA 4BBQA 1KZZA 1YY6A 1LDKC 4FIPA 2EGPA 3HCTA 2KU3A 3LQHA 3V43A 4I7BA 5DKAA 4S3OC 4A49A 4WZ3B 1Z60A 1YZEA 1FBVA 1V87A 1T1HA 3T7LA 1JM7A 5D1LB 1FLLA 1JOCA 1WEMA 2K1JA 2YREA 4UI9B 3GL6A 2IDAA 3O35A 2OXQC 5KH9A 2PUYA 4CA1A 2M3HA 2C2LA 3KNVA 1WEVA 1HYJA 2M85A 2KWKA 3KV6A 3LQJA 2K16A 2Y1MA 2XEUA 3ZVYA 3MHHA 3ZTGA 3MQRA 2ECTA 4GWNA 3DPLR 2EODA 4I7DA 1WE9A 5AITA 5I3LA 2MA5A 2VJFA 2L43A 5KH7A 2MA6A 2QICA 4AYCA 4YSIA 2VJEA 3DQVR 4LLBA 3L1ZB 2MNYA 2VNFA 3O33A 5DINA 1Z6UA 2DX8A 4TKPB 4O1VA 2FOPA 1CZZA 1ZMSA 2MD8C 5TBNA 5KH3A 4Q6FA 2JMIA 4QF2A 1D0AA 5G05B 4FJCA 3SOWA 2VPDA 3M99A 5D1KB 2ECGA 2LGLA 2AN6A 3SOUA 3O7AA 3ZNIA 4YBTA 4PTBA 3I2DA 3VK6A 1MM2A 3MHSA 5B77A 4M4EA 2Y43A 2GKWA 2E6RA 4YATA 2CR2A 4YADA 2F42A 2MUMA 2KWNA 3IHPA 1X4JA 4GWMA 2YHNA 3HCUA 1WIMA 1F3VB 2MIQA 3ZYQA 2I50A 2UZGA 3ASLA 2FOOA 2YSJA 2Y1NA 4IC3A 4UP5A 1WEQA 5FB0A 3ZVZB 3QZVA 2L5UA 4GHUA 4LADB 4GNDA 2H0DA 2YURA 2F1YA 4B86C 5B78A 2F1WA 2C2VS 3HU6A 4MSXA 1E4UA 4CCGX 2A25A 4GJHA 5H1TA 4ZDTA 5C13A 4WZ0A 2VPGA 4BHWA 3KQIA 2QJ0A 2EA6A 3C5KA 5C11A 4R8PK 3LRQA 3PHDA 2FUUA 5D1MB 1WGMA 3ZPVE 1N87A 4NN2A 3NG2A 1QSCA 2D8SA 2H0DB 2PNXA 2FUIA 3ZPV1 2LDRA 5LKXA 5B8DA 2ECWA 1G25A 2CSZA 3HQHA 1XWHA 1WEUA 1VYXA 5B76A 2CKLB 3HQMA 1VD4A 2MNZA 4L7XA 2YU4A 5FB1A 3EB5A 2G45A 2ECIA 1LB6A 3ZJBA 1K2FA 4GNFA 4I7CA 3SOXA 4A4CA 4K8UA 4R7EA 4YBMA 2F1XA 2YQLA 3IVVA 4XI1A 2G43A 4GNGA 4YABA 4A0CD 2MD7B 2YQMA 1MM3A 2JMJA 2YUCA 3L11A 3U5MA 5FERA 2KWOA 2L80A 4N4FA 5H1VA 3O36A 2K4DA 2YYRA 5LKUA 1WFKA 2L0BA 3PURA 2L75A 3O37A 5TABA 3N9OA 4AYCB 4WZ2A 4LJNA 4C9ZA 2M6MA 2RI7A 1D01A 4FK5A 2YT5A 3HSVA 2LRIC 1F62A 1IYMA 4A4BA 3N9NA 2JMDA 1FP0A 4LK9A 1LDJB 4S3OB 5G0FA 1CZYA 3N9LA 5LCWB 3GV4A 2LGVA 3C6WA 1ZBDB 1WEEA 2BAYA 4X3GA 4WA6A 2KWJA 1JM7B 3HQLA 2KIZA 4O64A 4UP0A 5LKTA 1WENA 2F6JA 2HDPA 1WEOA 2NAAA 1U6GB 3O34A 2VPEA 1X4IA 5H9MA 1BORA 4GB0A 3RTRB 2KREA 3N9QA 3HTKC 2E6SA 4YAXA 1RMDA 4V3LC 1WILA 4R2YA 1FLKA 2QIZA 2LGGA 2F6NA 2LGKA 5TDRA 4B7YC 2F1ZA 4PPEA 1WESA 4MVTA 2KGIA 2CSYA 5TRBA 4QF3A 3RPGC 4YBSA 2YSMA 3U5PA 4F52B 1VFYA 4FO9A 5JG6A 2LV9A 2G6QA 1RF3A 5J3XA 2JRJA 5EYAF 5LKZA 3IVQA 1HYIA 5G04B 2ECNA 2LXPC 1DVPA 2VP7A 1D00A 2CKLA 3EB6A 5TDWA 1LB5A 5FEYA 3M63A 2LN0A 3O70A 4L58A 4AUQB 4GNEA 4LKAA 2KGGA 2YHOA 1CA9A 2XXNA 5B75A 5B79A 4AVXA 2KR4A 1LB4A 2VJEB 2FSAA 3M62A 1CHCA 3PUQA 3FL2A 1WEWA 2KE1A 2ZETC 3LQIA 3N9MA 4KG9A 4IC2A 2VPBA 3L1XA 3RPGB 4YC9A 1Z2QA 2YW8A 4AP4A 2MT5A 2HYED 4ZQLA 3U5OA 3T6RA 4ZUXU 2FOJA
chains in the Genus database with same CATH superfamily
5H1UA 3HQIA 5SVXA 5AIUA 1WEPA 2LXHC 3IVBA 2LQ6A 2CONA 3HCSA 2RSDA 2XB1A 2CT2A 5E1TA 1CA4A 3FAOA 3MQSC 3U5NA 2VJFB 3KV5A 5SVYA 1L0AA 2M1RA 1X4UA 4JJQA 3KDEC 2KYUA 4Z8MA 4W4UA 2KFTA 3DWDA 3SHBA 2ECVA 4V3KC 1D0JA 3M7KA 2ECJA 2XOYA 3N9PA 2K17A 2XP0A 4P5OB 4N3WA 4BBQA 1KZZA 2IQJA 1YY6A 1LDKC 3E2DA 4FIPA 2EGPA 3HCTA 2KU3A 3LQHA 3FM8C 4O62A 3V43A 4I7BA 5DKAA 4S3OC 4A49A 4WZ3B 1Z60A 1YZEA 2YVRA 1FBVA 1V87A 1MBMA 1T1HA 3T7LA 1JM7A 5D1LB 1FLLA 1JOCA 1WEMA 2K1JA 2B0OE 2YREA 4UI9B 3GL6A 2IDAA 3O35A 2OXQC 4Z0RA 5KH9A 2PUYA 4CA1A 2M3HA 2C2LA 3KNVA 1WEVA 1HYJA 2M85A 2KWKA 3KV6A 3LQJA 2K16A 2Y1MA 3LDYA 2XEUA 3ZVYA 2LAUA 3MHHA 3ZTGA 3MQRA 2ECTA 4GWNA 5K3QA 3DPLR 2EODA 4I7DA 1WE9A 5AITA 5I3LA 2MA5A 2VJFA 2L43A 5KH7A 2MA6A 2QICA 4AYCA 4YSIA 2VJEA 3DQVR 4LLBA 3L1ZB 2MNYA 2VNFA 3O33A 5DINA 1Z6UA 2DX8A 4TKPB 4O1VA 2FOPA 1CZZA 1ZMSA 2MD8C 2FFWA 5TBNA 5KH3A 4Q6FA 2JMIA 4QF2A 1D0AA 5G05B 3FANA 4FJCA 3SOWA 2VPDA 3M99A 5D1KB 2ECGA 2LGLA 2AN6A 2OWAA 3SOUA 3O7AA 3ZNIA 4YBTA 4PTBA 3I2DA 3VK6A 1MM2A 3MHSA 5B77A 4M4EA 2Y43A 2GKWA 2E6RA 4YATA 2CR2A 3Q1DA 4YADA 2F42A 2MUMA 2KWNA 3IHPA 2RR4A 1X4JA 4GWMA 2YHNA 3HCUA 1WIMA 3FEHA 1F3VB 2MIQA 3ZYQA 2EXUA 2I50A 2UZGA 3ASLA 2FOOA 2YSJA 2Y1NA 4IC3A 4UP5A 2JUNA 1WEQA 5FB0A 3ZVZB 3QZVA 2L5UA 4GHUA 4LADB 4GNDA 2H0DA 2YURA 2F1YA 4B86C 5B78A 2F1WA 2C2VS 3HU6A 4MSXA 1E4UA 2L7PA 4CCGX 5SVIB 2A25A 4GJHA 5H1TA 4ZDTA 5C13A 4WZ0A 2VPGA 4BHWA 3KQIA 2QJ0A 2EA6A 3C5KA 5C11A 4R8PK 3LRQA 1DCQA 3PHDA 2FUUA 5D1MB 1WGMA 3ZPVE 1N87A 4NN2A 3NG2A 1QSCA 2D8SA 2H0DB 2PNXA 2FUIA 3ZPV1 2LDRA 4OGCA 5LKXA 5B8DA 2DJAA 2E61A 2ECWA 1G25A 2CSZA 3HQHA 1XWHA 1WEUA 1VYXA 5B76A 2CKLB 3HQMA 1VD4A 2MNZA 4L7XA 2YU4A 5FB1A 3MDBC 3EB5A 2G45A 2ECIA 1LB6A 2FD4A 3ZJBA 1K2FA 4GNFA 4I7CA 3SOXA 4A4CA 4K8UA 4R7EA 4YBMA 2F1XA 2YQLA 3IVVA 4XI1A 2G43A 4GNGA 3T9KA 4YABA 4A0CD 2MD7B 2YQMA 4H9DA 1MM3A 2JMJA 2YUCA 3L11A 3U5MA 5FERA 2EGMA 2KWOA 2L80A 3O47A 4N4FA 5H1VA 3LJUX 3O36A 3PLWA 2K4DA 2YYRA 5LKUA 1WFKA 2XOCA 2L0BA 3PURA 2L75A 3O37A 5TABA 3N9OA 4AYCB 4WZ2A 4LJNA 2D8UA 4C9ZA 2M6MA 2RI7A 1D01A 4FK5A 2YT5A 3HSVA 2LRIC 3SUBA 1F62A 1IYMA 4A4BA 3N9NA 2JMDA 2M13A 1FP0A 4LK9A 1LDJB 4S3OB 5G0FA 1CZYA 3N9LA 5LCWB 3DDTA 3FJUB 2KKYA 3GV4A 2LGVA 3C6WA 1ZBDB 1WEEA 2BAYA 4X3GA 4WA6A 2KWJA 1JM7B 3HQLA 2KIZA 4O64A 4UP0A 5LKTA 3LVRE 1WENA 2F6JA 2HDPA 1WEOA 5SVIA 2NAAA 1U6GB 3O34A 2VPEA 1X4IA 5H9MA 4GB0A 1BORA 2CRRA 3RTRB 2KREA 3N9QA 3HTKC 2E6SA 4YAXA 1RMDA 4V3LC 1WILA 4R2YA 2P57A 1FLKA 2QIZA 2LGGA 2F6NA 2LGKA 5TDRA 4B7YC 2F1ZA 4PPEA 1WESA 4MVTA 2CRWA 2KGIA 2CSYA 5TRBA 4QF3A 3RPGC 4YBSA 2YSMA 4Z0OA 2CSVA 3U5PA 4F52B 1VFYA 4FO9A 5JG6A 2XOZA 2LV9A 2G6QA 1RF3A 5J3XA 2JRJA 5EYAF 5LKZA 3IVQA 1HYIA 5G04B 2ECNA 2LXPC 1DVPA 2VP7A 1D00A 4OGEA 2CKLA 3EB6A 5TDWA 1LB5A 5FEYA 3M63A 2LN0A 3O70A 4L58A 3H7HA 4AUQB 4QQ4A 4GNEA 4LKAA 2KGGA 2YHOA 1CA9A 2XXNA 2KKXA 3JUEA 3LVQE 5B75A 5B79A 4AVXA 2KR4A 1LB4A 2VJEB 2DSMA 2FSAA 3M62A 1CHCA 3PUQA 3FL2A 1WEWA 2KE1A 2ZETC 3LQIA 3N9MA 4KG9A 4IC2A 2VPBA 3L1XA 3RPGB 4YC9A 1Z2QA 2YW8A 4AP4A 2MT5A 2HYED 4ZQLA 3U5OA 3T6RA 4ZUXU 2FOJA 4F1PA 2MKEA 2JM3A
chains in the Genus database with same CATH topology
5H1UA 3HQIA 5AIUA 1WEPA 2LXHC 3IVBA 2LQ6A 3HCSA 2RSDA 2XB1A 2CT2A 5E1TA 1CA4A 3MQSC 3U5NA 2VJFB 3KV5A 1L0AA 2M1RA 1X4UA 4JJQA 2KYUA 4Z8MA 4W4UA 2KFTA 3SHBA 2ECVA 4V3KC 1D0JA 2ECJA 3N9PA 2K17A 4P5OB 4N3WA 4BBQA 1KZZA 1YY6A 1LDKC 4FIPA 2EGPA 3HCTA 2KU3A 3LQHA 3V43A 4I7BA 5DKAA 4S3OC 4A49A 4WZ3B 1Z60A 1YZEA 1FBVA 1V87A 1T1HA 3T7LA 1JM7A 5D1LB 1FLLA 1JOCA 1WEMA 2K1JA 2YREA 4UI9B 3GL6A 2IDAA 3O35A 2OXQC 5KH9A 2PUYA 4CA1A 2M3HA 2C2LA 3KNVA 1WEVA 1HYJA 2M85A 2KWKA 3KV6A 3LQJA 2K16A 2Y1MA 2XEUA 3ZVYA 3MHHA 3ZTGA 3MQRA 2ECTA 4GWNA 3DPLR 2EODA 4I7DA 1WE9A 5AITA 5I3LA 2MA5A 2VJFA 2L43A 5KH7A 2MA6A 2QICA 4AYCA 4YSIA 2VJEA 3DQVR 4LLBA 3L1ZB 2MNYA 2VNFA 3O33A 5DINA 1Z6UA 2DX8A 4TKPB 4O1VA 2FOPA 1CZZA 1ZMSA 2MD8C 5TBNA 5KH3A 4Q6FA 2JMIA 4QF2A 1D0AA 5G05B 4FJCA 3SOWA 2VPDA 3M99A 5D1KB 2ECGA 2LGLA 2AN6A 3SOUA 3O7AA 3ZNIA 4YBTA 4PTBA 3I2DA 3VK6A 1MM2A 3MHSA 5B77A 4M4EA 2Y43A 2GKWA 2E6RA 4YATA 2CR2A 4YADA 2F42A 2MUMA 2KWNA 3IHPA 1X4JA 4GWMA 2YHNA 3HCUA 1WIMA 1F3VB 2MIQA 3ZYQA 2I50A 2UZGA 3ASLA 2FOOA 2YSJA 2Y1NA 4IC3A 4UP5A 1WEQA 5FB0A 3ZVZB 3QZVA 2L5UA 4GHUA 4LADB 4GNDA 2H0DA 2YURA 2F1YA 4B86C 5B78A 2F1WA 2C2VS 3HU6A 4MSXA 1E4UA 4CCGX 2A25A 4GJHA 5H1TA 4ZDTA 5C13A 4WZ0A 2VPGA 4BHWA 3KQIA 2QJ0A 2EA6A 3C5KA 5C11A 4R8PK 3LRQA 3PHDA 2FUUA 5D1MB 1WGMA 3ZPVE 1N87A 4NN2A 3NG2A 1QSCA 2D8SA 2H0DB 2PNXA 2FUIA 3ZPV1 2LDRA 5LKXA 5B8DA 2ECWA 1G25A 2CSZA 3HQHA 1XWHA 1WEUA 1VYXA 5B76A 2CKLB 3HQMA 1VD4A 2MNZA 4L7XA 2YU4A 5FB1A 3EB5A 2G45A 2ECIA 1LB6A 3ZJBA 1K2FA 4GNFA 4I7CA 3SOXA 4A4CA 4K8UA 4R7EA 4YBMA 2F1XA 2YQLA 3IVVA 4XI1A 2G43A 4GNGA 4YABA 4A0CD 2MD7B 2YQMA 1MM3A 2JMJA 2YUCA 3L11A 3U5MA 5FERA 2KWOA 2L80A 4N4FA 5H1VA 3O36A 2K4DA 2YYRA 5LKUA 1WFKA 2L0BA 3PURA 2L75A 3O37A 5TABA 3N9OA 4AYCB 4WZ2A 4LJNA 4C9ZA 2M6MA 2RI7A 1D01A 4FK5A 2YT5A 3HSVA 2LRIC 1F62A 1IYMA 4A4BA 3N9NA 2JMDA 1FP0A 4LK9A 1LDJB 4S3OB 5G0FA 1CZYA 3N9LA 5LCWB 3GV4A 2LGVA 3C6WA 1ZBDB 1WEEA 2BAYA 4X3GA 4WA6A 2KWJA 1JM7B 3HQLA 2KIZA 4O64A 4UP0A 5LKTA 1WENA 2F6JA 2HDPA 1WEOA 2NAAA 1U6GB 3O34A 2VPEA 1X4IA 5H9MA 1BORA 4GB0A 3RTRB 2KREA 3N9QA 3HTKC 2E6SA 4YAXA 1RMDA 4V3LC 1WILA 4R2YA 1FLKA 2QIZA 2LGGA 2F6NA 2LGKA 5TDRA 4B7YC 2F1ZA 4PPEA 1WESA 4MVTA 2KGIA 2CSYA 5TRBA 4QF3A 3RPGC 4YBSA 2YSMA 3U5PA 4F52B 1VFYA 4FO9A 5JG6A 2LV9A 2G6QA 1RF3A 5J3XA 2JRJA 5EYAF 5LKZA 3IVQA 1HYIA 5G04B 2ECNA 2LXPC 1DVPA 2VP7A 1D00A 2CKLA 3EB6A 5TDWA 1LB5A 5FEYA 3M63A 2LN0A 3O70A 4L58A 4AUQB 4GNEA 4LKAA 2KGGA 2YHOA 1CA9A 2XXNA 5B75A 5B79A 4AVXA 2KR4A 1LB4A 2VJEB 2FSAA 3M62A 1CHCA 3PUQA 3FL2A 1WEWA 2KE1A 2ZETC 3LQIA 3N9MA 4KG9A 4IC2A 2VPBA 3L1XA 3RPGB 4YC9A 1Z2QA 2YW8A 4AP4A 2MT5A 2HYED 4ZQLA 3U5OA 3T6RA 4ZUXU 2FOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1U A;  3HQI A;  5AIU A;  1WEP A;  2LXH C;  3IVB A;  2LQ6 A;  3HCS A;  2RSD A;  2XB1 A;  2CT2 A;  5E1T A;  1CA4 A;  3MQS C;  3U5N A;  2VJF B;  3KV5 A;  1L0A A;  2M1R A;  1X4U A;  4JJQ A;  2KYU A;  4Z8M A;  4W4U A;  2KFT A;  3SHB A;  2ECV A;  4V3K C;  1D0J A;  2ECJ A;  3N9P A;  2K17 A;  4P5O B;  4N3W A;  4BBQ A;  1KZZ A;  1YY6 A;  1LDK C;  4FIP A;  2EGP A;  3HCT A;  2KU3 A;  3LQH A;  3V43 A;  4I7B A;  5DKA A;  4S3O C;  4A49 A;  4WZ3 B;  1Z60 A;  1YZE A;  1FBV A;  1V87 A;  1T1H A;  3T7L A;  1JM7 A;  5D1L B;  1FLL A;  1JOC A;  1WEM A;  2K1J A;  2YRE A;  4UI9 B;  3GL6 A;  2IDA A;  3O35 A;  2OXQ C;  5KH9 A;  2PUY A;  4CA1 A;  2M3H A;  2C2L A;  3KNV A;  1WEV A;  1HYJ A;  2M85 A;  2KWK A;  3KV6 A;  3LQJ A;  2K16 A;  2Y1M A;  2XEU A;  3ZVY A;  3MHH A;  3ZTG A;  3MQR A;  2ECT A;  4GWN A;  3DPL R;  2EOD A;  4I7D A;  1WE9 A;  5AIT A;  5I3L A;  2MA5 A;  2VJF A;  2L43 A;  5KH7 A;  2MA6 A;  2QIC A;  4AYC A;  4YSI A;  2VJE A;  3DQV R;  4LLB A;  3L1Z B;  2MNY A;  2VNF A;  3O33 A;  5DIN A;  1Z6U A;  2DX8 A;  4TKP B;  4O1V A;  2FOP A;  1CZZ A;  1ZMS A;  2MD8 C;  5TBN A;  5KH3 A;  4Q6F A;  2JMI A;  4QF2 A;  1D0A A;  5G05 B;  4FJC A;  3SOW A;  2VPD A;  3M99 A;  5D1K B;  2ECG A;  2LGL A;  2AN6 A;  3SOU A;  3O7A A;  3ZNI A;  4YBT A;  4PTB A;  3I2D A;  3VK6 A;  1MM2 A;  3MHS A;  5B77 A;  4M4E A;  2Y43 A;  2GKW A;  2E6R A;  4YAT A;  2CR2 A;  4YAD A;  2F42 A;  2MUM A;  2KWN A;  3IHP A;  1X4J A;  4GWM A;  2YHN A;  3HCU A;  1WIM A;  1F3V B;  2MIQ A;  3ZYQ A;  2I50 A;  2UZG A;  3ASL A;  2FOO A;  2YSJ A;  2Y1N A;  4IC3 A;  4UP5 A;  1WEQ A;  5FB0 A;  3ZVZ B;  3QZV A;  2L5U A;  4GHU A;  4LAD B;  4GND A;  2H0D A;  2YUR A;  2F1Y A;  4B86 C;  5B78 A;  2F1W A;  2C2V S;  3HU6 A;  4MSX A;  1E4U A;  4CCG X;  2A25 A;  4GJH A;  5H1T A;  4ZDT A;  5C13 A;  4WZ0 A;  2VPG A;  4BHW A;  3KQI A;  2QJ0 A;  2EA6 A;  3C5K A;  5C11 A;  4R8P K;  3LRQ A;  3PHD A;  2FUU A;  5D1M B;  1WGM A;  3ZPV E;  1N87 A;  4NN2 A;  3NG2 A;  1QSC A;  2D8S A;  2H0D B;  2PNX A;  2FUI A;  3ZPV 1;  2LDR A;  5LKX A;  5B8D A;  2ECW A;  1G25 A;  2CSZ A;  3HQH A;  1XWH A;  1WEU A;  1VYX A;  5B76 A;  2CKL B;  3HQM A;  1VD4 A;  2MNZ A;  4L7X A;  2YU4 A;  5FB1 A;  3EB5 A;  2G45 A;  2ECI A;  1LB6 A;  3ZJB A;  1K2F A;  4GNF A;  4I7C A;  3SOX A;  4A4C A;  4K8U A;  4R7E A;  4YBM A;  2F1X A;  2YQL A;  3IVV A;  4XI1 A;  2G43 A;  4GNG A;  4YAB A;  4A0C D;  2MD7 B;  2YQM A;  1MM3 A;  2JMJ A;  2YUC A;  3L11 A;  3U5M A;  5FER A;  2KWO A;  2L80 A;  4N4F A;  5H1V A;  3O36 A;  2K4D A;  2YYR A;  5LKU A;  1WFK A;  2L0B A;  3PUR A;  2L75 A;  3O37 A;  5TAB A;  3N9O A;  4AYC B;  4WZ2 A;  4LJN A;  4C9Z A;  2M6M A;  2RI7 A;  1D01 A;  4FK5 A;  2YT5 A;  3HSV A;  2LRI C;  1F62 A;  1IYM A;  4A4B A;  3N9N A;  2JMD A;  1FP0 A;  4LK9 A;  1LDJ B;  4S3O B;  5G0F A;  1CZY A;  3N9L A;  5LCW B;  3GV4 A;  2LGV A;  3C6W A;  1ZBD B;  1WEE A;  2BAY A;  4X3G A;  4WA6 A;  2KWJ A;  1JM7 B;  3HQL A;  2KIZ A;  4O64 A;  4UP0 A;  5LKT A;  1WEN A;  2F6J A;  2HDP A;  1WEO A;  2NAA A;  1U6G B;  3O34 A;  2VPE A;  1X4I A;  5H9M A;  1BOR A;  4GB0 A;  3RTR B;  2KRE A;  3N9Q A;  3HTK C;  2E6S A;  4YAX A;  1RMD A;  4V3L C;  1WIL A;  4R2Y A;  1FLK A;  2QIZ A;  2LGG A;  2F6N A;  2LGK A;  5TDR A;  4B7Y C;  2F1Z A;  4PPE A;  1WES A;  4MVT A;  2KGI A;  2CSY A;  5TRB A;  4QF3 A;  3RPG C;  4YBS A;  2YSM A;  3U5P A;  4F52 B;  1VFY A;  4FO9 A;  5JG6 A;  2LV9 A;  2G6Q A;  1RF3 A;  5J3X A;  2JRJ A;  5EYA F;  5LKZ A;  3IVQ A;  1HYI A;  5G04 B;  2ECN A;  2LXP C;  1DVP A;  2VP7 A;  1D00 A;  2CKL A;  3EB6 A;  5TDW A;  1LB5 A;  5FEY A;  3M63 A;  2LN0 A;  3O70 A;  4L58 A;  4AUQ B;  4GNE A;  4LKA A;  2KGG A;  2YHO A;  1CA9 A;  2XXN A;  5B75 A;  5B79 A;  4AVX A;  2KR4 A;  1LB4 A;  2VJE B;  2FSA A;  3M62 A;  1CHC A;  3PUQ A;  3FL2 A;  1WEW A;  2KE1 A;  2ZET C;  3LQI A;  3N9M A;  4KG9 A;  4IC2 A;  2VPB A;  3L1X A;  3RPG B;  4YC9 A;  1Z2Q A;  2YW8 A;  4AP4 A;  2MT5 A;  2HYE D;  4ZQL A;  3U5O A;  3T6R A;  4ZUX U;  2FOJ A; 
#chains in the Genus database with same CATH topology
 5H1U A;  3HQI A;  5SVX A;  5AIU A;  1WEP A;  2LXH C;  3IVB A;  2LQ6 A;  2CON A;  3HCS A;  2RSD A;  2XB1 A;  2CT2 A;  5E1T A;  1CA4 A;  3FAO A;  3MQS C;  3U5N A;  2VJF B;  3KV5 A;  5SVY A;  1L0A A;  2M1R A;  1X4U A;  4JJQ A;  3KDE C;  2KYU A;  4Z8M A;  4W4U A;  2KFT A;  3DWD A;  3SHB A;  2ECV A;  4V3K C;  1D0J A;  3M7K A;  2ECJ A;  2XOY A;  3N9P A;  2K17 A;  2XP0 A;  4P5O B;  4N3W A;  4BBQ A;  1KZZ A;  2IQJ A;  1YY6 A;  1LDK C;  3E2D A;  4FIP A;  2EGP A;  3HCT A;  2KU3 A;  3LQH A;  3FM8 C;  4O62 A;  3V43 A;  4I7B A;  5DKA A;  4S3O C;  4A49 A;  4WZ3 B;  1Z60 A;  1YZE A;  2YVR A;  1FBV A;  1V87 A;  1MBM A;  1T1H A;  3T7L A;  1JM7 A;  5D1L B;  1FLL A;  1JOC A;  1WEM A;  2K1J A;  2B0O E;  2YRE A;  4UI9 B;  3GL6 A;  2IDA A;  3O35 A;  2OXQ C;  4Z0R A;  5KH9 A;  2PUY A;  4CA1 A;  2M3H A;  2C2L A;  3KNV A;  1WEV A;  1HYJ A;  2M85 A;  2KWK A;  3KV6 A;  3LQJ A;  2K16 A;  2Y1M A;  3LDY A;  2XEU A;  3ZVY A;  2LAU A;  3MHH A;  3ZTG A;  3MQR A;  2ECT A;  4GWN A;  5K3Q A;  3DPL R;  2EOD A;  4I7D A;  1WE9 A;  5AIT A;  5I3L A;  2MA5 A;  2VJF A;  2L43 A;  5KH7 A;  2MA6 A;  2QIC A;  4AYC A;  4YSI A;  2VJE A;  3DQV R;  4LLB A;  3L1Z B;  2MNY A;  2VNF A;  3O33 A;  5DIN A;  1Z6U A;  2DX8 A;  4TKP B;  4O1V A;  2FOP A;  1CZZ A;  1ZMS A;  2MD8 C;  2FFW A;  5TBN A;  5KH3 A;  4Q6F A;  2JMI A;  4QF2 A;  1D0A A;  5G05 B;  3FAN A;  4FJC A;  3SOW A;  2VPD A;  3M99 A;  5D1K B;  2ECG A;  2LGL A;  2AN6 A;  2OWA A;  3SOU A;  3O7A A;  3ZNI A;  4YBT A;  4PTB A;  3I2D A;  3VK6 A;  1MM2 A;  3MHS A;  5B77 A;  4M4E A;  2Y43 A;  2GKW A;  2E6R A;  4YAT A;  2CR2 A;  3Q1D A;  4YAD A;  2F42 A;  2MUM A;  2KWN A;  3IHP A;  2RR4 A;  1X4J A;  4GWM A;  2YHN A;  3HCU A;  1WIM A;  3FEH A;  1F3V B;  2MIQ A;  3ZYQ A;  2EXU A;  2I50 A;  2UZG A;  3ASL A;  2FOO A;  2YSJ A;  2Y1N A;  4IC3 A;  4UP5 A;  2JUN A;  1WEQ A;  5FB0 A;  3ZVZ B;  3QZV A;  2L5U A;  4GHU A;  4LAD B;  4GND A;  2H0D A;  2YUR A;  2F1Y A;  4B86 C;  5B78 A;  2F1W A;  2C2V S;  3HU6 A;  4MSX A;  1E4U A;  2L7P A;  4CCG X;  5SVI B;  2A25 A;  4GJH A;  5H1T A;  4ZDT A;  5C13 A;  4WZ0 A;  2VPG A;  4BHW A;  3KQI A;  2QJ0 A;  2EA6 A;  3C5K A;  5C11 A;  4R8P K;  3LRQ A;  1DCQ A;  3PHD A;  2FUU A;  5D1M B;  1WGM A;  3ZPV E;  1N87 A;  4NN2 A;  3NG2 A;  1QSC A;  2D8S A;  2H0D B;  2PNX A;  2FUI A;  3ZPV 1;  2LDR A;  4OGC A;  5LKX A;  5B8D A;  2DJA A;  2E61 A;  2ECW A;  1G25 A;  2CSZ A;  3HQH A;  1XWH A;  1WEU A;  1VYX A;  5B76 A;  2CKL B;  3HQM A;  1VD4 A;  2MNZ A;  4L7X A;  2YU4 A;  5FB1 A;  3MDB C;  3EB5 A;  2G45 A;  2ECI A;  1LB6 A;  2FD4 A;  3ZJB A;  1K2F A;  4GNF A;  4I7C A;  3SOX A;  4A4C A;  4K8U A;  4R7E A;  4YBM A;  2F1X A;  2YQL A;  3IVV A;  4XI1 A;  2G43 A;  4GNG A;  3T9K A;  4YAB A;  4A0C D;  2MD7 B;  2YQM A;  4H9D A;  1MM3 A;  2JMJ A;  2YUC A;  3L11 A;  3U5M A;  5FER A;  2EGM A;  2KWO A;  2L80 A;  3O47 A;  4N4F A;  5H1V A;  3LJU X;  3O36 A;  3PLW A;  2K4D A;  2YYR A;  5LKU A;  1WFK A;  2XOC A;  2L0B A;  3PUR A;  2L75 A;  3O37 A;  5TAB A;  3N9O A;  4AYC B;  4WZ2 A;  4LJN A;  2D8U A;  4C9Z A;  2M6M A;  2RI7 A;  1D01 A;  4FK5 A;  2YT5 A;  3HSV A;  2LRI C;  3SUB A;  1F62 A;  1IYM A;  4A4B A;  3N9N A;  2JMD A;  2M13 A;  1FP0 A;  4LK9 A;  1LDJ B;  4S3O B;  5G0F A;  1CZY A;  3N9L A;  5LCW B;  3DDT A;  3FJU B;  2KKY A;  3GV4 A;  2LGV A;  3C6W A;  1ZBD B;  1WEE A;  2BAY A;  4X3G A;  4WA6 A;  2KWJ A;  1JM7 B;  3HQL A;  2KIZ A;  4O64 A;  4UP0 A;  5LKT A;  3LVR E;  1WEN A;  2F6J A;  2HDP A;  1WEO A;  5SVI A;  2NAA A;  1U6G B;  3O34 A;  2VPE A;  1X4I A;  5H9M A;  4GB0 A;  1BOR A;  2CRR A;  3RTR B;  2KRE A;  3N9Q A;  3HTK C;  2E6S A;  4YAX A;  1RMD A;  4V3L C;  1WIL A;  4R2Y A;  2P57 A;  1FLK A;  2QIZ A;  2LGG A;  2F6N A;  2LGK A;  5TDR A;  4B7Y C;  2F1Z A;  4PPE A;  1WES A;  4MVT A;  2CRW A;  2KGI A;  2CSY A;  5TRB A;  4QF3 A;  3RPG C;  4YBS A;  2YSM A;  4Z0O A;  2CSV A;  3U5P A;  4F52 B;  1VFY A;  4FO9 A;  5JG6 A;  2XOZ A;  2LV9 A;  2G6Q A;  1RF3 A;  5J3X A;  2JRJ A;  5EYA F;  5LKZ A;  3IVQ A;  1HYI A;  5G04 B;  2ECN A;  2LXP C;  1DVP A;  2VP7 A;  1D00 A;  4OGE A;  2CKL A;  3EB6 A;  5TDW A;  1LB5 A;  5FEY A;  3M63 A;  2LN0 A;  3O70 A;  4L58 A;  3H7H A;  4AUQ B;  4QQ4 A;  4GNE A;  4LKA A;  2KGG A;  2YHO A;  1CA9 A;  2XXN A;  2KKX A;  3JUE A;  3LVQ E;  5B75 A;  5B79 A;  4AVX A;  2KR4 A;  1LB4 A;  2VJE B;  2DSM A;  2FSA A;  3M62 A;  1CHC A;  3PUQ A;  3FL2 A;  1WEW A;  2KE1 A;  2ZET C;  3LQI A;  3N9M A;  4KG9 A;  4IC2 A;  2VPB A;  3L1X A;  3RPG B;  4YC9 A;  1Z2Q A;  2YW8 A;  4AP4 A;  2MT5 A;  2HYE D;  4ZQL A;  3U5O A;  3T6R A;  4ZUX U;  2FOJ A;  4F1P A;  2MKE A;  2JM3 A; 
#chains in the Genus database with same CATH homology
 5H1U A;  3HQI A;  5AIU A;  1WEP A;  2LXH C;  3IVB A;  2LQ6 A;  3HCS A;  2RSD A;  2XB1 A;  2CT2 A;  5E1T A;  1CA4 A;  3MQS C;  3U5N A;  2VJF B;  3KV5 A;  1L0A A;  2M1R A;  1X4U A;  4JJQ A;  2KYU A;  4Z8M A;  4W4U A;  2KFT A;  3SHB A;  2ECV A;  4V3K C;  1D0J A;  2ECJ A;  3N9P A;  2K17 A;  4P5O B;  4N3W A;  4BBQ A;  1KZZ A;  1YY6 A;  1LDK C;  4FIP A;  2EGP A;  3HCT A;  2KU3 A;  3LQH A;  3V43 A;  4I7B A;  5DKA A;  4S3O C;  4A49 A;  4WZ3 B;  1Z60 A;  1YZE A;  1FBV A;  1V87 A;  1T1H A;  3T7L A;  1JM7 A;  5D1L B;  1FLL A;  1JOC A;  1WEM A;  2K1J A;  2YRE A;  4UI9 B;  3GL6 A;  2IDA A;  3O35 A;  2OXQ C;  5KH9 A;  2PUY A;  4CA1 A;  2M3H A;  2C2L A;  3KNV A;  1WEV A;  1HYJ A;  2M85 A;  2KWK A;  3KV6 A;  3LQJ A;  2K16 A;  2Y1M A;  2XEU A;  3ZVY A;  3MHH A;  3ZTG A;  3MQR A;  2ECT A;  4GWN A;  3DPL R;  2EOD A;  4I7D A;  1WE9 A;  5AIT A;  5I3L A;  2MA5 A;  2VJF A;  2L43 A;  5KH7 A;  2MA6 A;  2QIC A;  4AYC A;  4YSI A;  2VJE A;  3DQV R;  4LLB A;  3L1Z B;  2MNY A;  2VNF A;  3O33 A;  5DIN A;  1Z6U A;  2DX8 A;  4TKP B;  4O1V A;  2FOP A;  1CZZ A;  1ZMS A;  2MD8 C;  5TBN A;  5KH3 A;  4Q6F A;  2JMI A;  4QF2 A;  1D0A A;  5G05 B;  4FJC A;  3SOW A;  2VPD A;  3M99 A;  5D1K B;  2ECG A;  2LGL A;  2AN6 A;  3SOU A;  3O7A A;  3ZNI A;  4YBT A;  4PTB A;  3I2D A;  3VK6 A;  1MM2 A;  3MHS A;  5B77 A;  4M4E A;  2Y43 A;  2GKW A;  2E6R A;  4YAT A;  2CR2 A;  4YAD A;  2F42 A;  2MUM A;  2KWN A;  3IHP A;  1X4J A;  4GWM A;  2YHN A;  3HCU A;  1WIM A;  1F3V B;  2MIQ A;  3ZYQ A;  2I50 A;  2UZG A;  3ASL A;  2FOO A;  2YSJ A;  2Y1N A;  4IC3 A;  4UP5 A;  1WEQ A;  5FB0 A;  3ZVZ B;  3QZV A;  2L5U A;  4GHU A;  4LAD B;  4GND A;  2H0D A;  2YUR A;  2F1Y A;  4B86 C;  5B78 A;  2F1W A;  2C2V S;  3HU6 A;  4MSX A;  1E4U A;  4CCG X;  2A25 A;  4GJH A;  5H1T A;  4ZDT A;  5C13 A;  4WZ0 A;  2VPG A;  4BHW A;  3KQI A;  2QJ0 A;  2EA6 A;  3C5K A;  5C11 A;  4R8P K;  3LRQ A;  3PHD A;  2FUU A;  5D1M B;  1WGM A;  3ZPV E;  1N87 A;  4NN2 A;  3NG2 A;  1QSC A;  2D8S A;  2H0D B;  2PNX A;  2FUI A;  3ZPV 1;  2LDR A;  5LKX A;  5B8D A;  2ECW A;  1G25 A;  2CSZ A;  3HQH A;  1XWH A;  1WEU A;  1VYX A;  5B76 A;  2CKL B;  3HQM A;  1VD4 A;  2MNZ A;  4L7X A;  2YU4 A;  5FB1 A;  3EB5 A;  2G45 A;  2ECI A;  1LB6 A;  3ZJB A;  1K2F A;  4GNF A;  4I7C A;  3SOX A;  4A4C A;  4K8U A;  4R7E A;  4YBM A;  2F1X A;  2YQL A;  3IVV A;  4XI1 A;  2G43 A;  4GNG A;  4YAB A;  4A0C D;  2MD7 B;  2YQM A;  1MM3 A;  2JMJ A;  2YUC A;  3L11 A;  3U5M A;  5FER A;  2KWO A;  2L80 A;  4N4F A;  5H1V A;  3O36 A;  2K4D A;  2YYR A;  5LKU A;  1WFK A;  2L0B A;  3PUR A;  2L75 A;  3O37 A;  5TAB A;  3N9O A;  4AYC B;  4WZ2 A;  4LJN A;  4C9Z A;  2M6M A;  2RI7 A;  1D01 A;  4FK5 A;  2YT5 A;  3HSV A;  2LRI C;  1F62 A;  1IYM A;  4A4B A;  3N9N A;  2JMD A;  1FP0 A;  4LK9 A;  1LDJ B;  4S3O B;  5G0F A;  1CZY A;  3N9L A;  5LCW B;  3GV4 A;  2LGV A;  3C6W A;  1ZBD B;  1WEE A;  2BAY A;  4X3G A;  4WA6 A;  2KWJ A;  1JM7 B;  3HQL A;  2KIZ A;  4O64 A;  4UP0 A;  5LKT A;  1WEN A;  2F6J A;  2HDP A;  1WEO A;  2NAA A;  1U6G B;  3O34 A;  2VPE A;  1X4I A;  5H9M A;  1BOR A;  4GB0 A;  3RTR B;  2KRE A;  3N9Q A;  3HTK C;  2E6S A;  4YAX A;  1RMD A;  4V3L C;  1WIL A;  4R2Y A;  1FLK A;  2QIZ A;  2LGG A;  2F6N A;  2LGK A;  5TDR A;  4B7Y C;  2F1Z A;  4PPE A;  1WES A;  4MVT A;  2KGI A;  2CSY A;  5TRB A;  4QF3 A;  3RPG C;  4YBS A;  2YSM A;  3U5P A;  4F52 B;  1VFY A;  4FO9 A;  5JG6 A;  2LV9 A;  2G6Q A;  1RF3 A;  5J3X A;  2JRJ A;  5EYA F;  5LKZ A;  3IVQ A;  1HYI A;  5G04 B;  2ECN A;  2LXP C;  1DVP A;  2VP7 A;  1D00 A;  2CKL A;  3EB6 A;  5TDW A;  1LB5 A;  5FEY A;  3M63 A;  2LN0 A;  3O70 A;  4L58 A;  4AUQ B;  4GNE A;  4LKA A;  2KGG A;  2YHO A;  1CA9 A;  2XXN A;  5B75 A;  5B79 A;  4AVX A;  2KR4 A;  1LB4 A;  2VJE B;  2FSA A;  3M62 A;  1CHC A;  3PUQ A;  3FL2 A;  1WEW A;  2KE1 A;  2ZET C;  3LQI A;  3N9M A;  4KG9 A;  4IC2 A;  2VPB A;  3L1X A;  3RPG B;  4YC9 A;  1Z2Q A;  2YW8 A;  4AP4 A;  2MT5 A;  2HYE D;  4ZQL A;  3U5O A;  3T6R A;  4ZUX U;  2FOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...