4X3GA

Crystal structure of siah1 sina domain in complex with a usp19 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
188
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
rcsb
source organism Homo sapiens
total genus 36
structure length 188
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4x3gA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4x3gA01
2LGKA 3LRQA 1WEWA 2AN6A 4I7DA 2C2LA 2KFTA 4TKPB 2YSMA 3ZVYA 1L0AA 2LXPC 4AYCA 1CZZA 5B77A 1Z6UA 2UZGA 3O37A 1JM7B 5JG6A 1RF3A 3U5OA 4Z8MA 3HTKC 1BORA 2KU3A 3KQIA 4PTBA 1LB5A 4CCGX 2CKLB 4LLBA 2VPGA 2LN0A 2F42A 2MIQA 4YBSA 2VJEB 4FO9A 4MSXA 1CZYA 2K4DA 4F52B 3ASLA 5TRBA 2A25A 2MA6A 2XXNA 2I50A 3GL6A 5J3XA 4I7CA 3ZYQA 3EB5A 4M4EA 3PURA 2YREA 5B78A 4A0CD 5FB0A 2FOPA 3ZPV1 4CA1A 2ECTA 2IDAA 4S3OC 3KV5A 1T1HA 3HU6A 1ZMSA 2K1JA 2KR4A 2M3HA 5H1VA 4WZ0A 5LCWB 4YBMA 4YATA 5LKZA 4R2YA 5C13A 4WA6A 2MT5A 2QIZA 3M62A 4V3LC 5D1MB 3M99A 4ZDTA 2KWJA 5H9MA 1LB4A 2XB1A 2ECJA 4GNDA 2HDPA 4I7BA 1ZBDB 4B86C 1HYIA 4W4UA 4O64A 3SOUA 3L1ZB 2JMDA 3KNVA 4L58A 2PUYA 1WENA 2VPDA 5C11A 5D1LB 2PNXA 4JJQA 2K16A 5KH3A 1YZEA 4K8UA 1F3VB 4BHWA 1FP0A 2YHOA 2MA5A 2L43A 2L75A 5FERA 2LXHC 1G25A 3HQHA 3HQIA 3MQSC 1WEEA 2H0DB 1VD4A 4AVXA 3HQLA 1X4JA 3HCUA 5TDRA 4P5OB 2YT5A 2KWOA 1D0JA 2MNYA 2JMJA 5D1KB 4YC9A 2VP7A 1LDKC 2LGLA 3T7LA 1JM7A 4IC2A 3DQVR 1U6GB 2CSYA 2YHNA 2VNFA 4FJCA 3IVBA 4LADB 2MD8C 4L7XA 4GB0A 3ZJBA 3FL2A 2VJEA 4QF2A 4AUQB 4KG9A 3GV4A 2RI7A 2MD7B 5DINA 2ECNA 2KGIA 4GNGA 2M85A 2BAYA 1WEQA 2Y1MA 4UP5A 3I2DA 5TBNA 2OXQC 1WGMA 3T6RA 2D8SA 3QZVA 5G05B 5EYAF 1WEUA 4YBTA 5TABA 4ZQLA 3HCSA 1FBVA 1MM2A 4LJNA 4WZ2A 3DPLR 1VYXA 1WEMA 2FUUA 4IC3A 1N87A 1X4IA 1LDJB 3MQRA 3SOXA 1K2FA 5B76A 3EB6A 4S3OB 2CT2A 2EA6A 3C6WA 3U5NA 3MHSA 2KGGA 3O70A 1LB6A 5AITA 2FSAA 3SOWA 1HYJA 1D00A 1RMDA 2G43A 2EGPA 5B75A 4PPEA 1WEOA 1FLLA 2YW8A 3O34A 1D0AA 2LGVA 2YQLA 2ECWA 4FIPA 1E4UA 5KH7A 2LDRA 3IVQA 2VJFA 3O35A 5TDWA 4Q6FA 2YYRA 2LGGA 5FB1A 3PHDA 4NN2A 2M6MA 5B79A 3RTRB 4X3GA 2F1WA 2C2VS 5LKXA 1WE9A 4N4FA 2ECVA 3LQIA 3ZTGA 2GKWA 3HSVA 4ZUXU 2YUCA 2ECIA 1D01A 4LK9A 2E6RA 1CA4A 1V87A 4YABA 2LRIC 4GJHA 2FUIA 3NG2A 4A49A 2G45A 3LQJA 2CKLA 4XI1A 3U5MA 2YU4A 3N9NA 2KIZA 5H1UA 4GWNA 3ZNIA 4GHUA 2F1XA 3L1XA 3ZVZB 2DX8A 1MM3A 2LQ6A 2YSJA 4GNEA 1FLKA 3N9QA 2F1ZA 2K17A 2L80A 2Y43A 3VK6A 4AYCB 3MHHA 4R7EA 2FOOA 1DVPA 2Y1NA 2JMIA 2VPEA 2XEUA 3O36A 1KZZA 1WILA 5AIUA 2KREA 4A4BA 2YURA 3L11A 4QF3A 2E6SA 2QJ0A 3U5PA 4YADA 2ZETC 2KWNA 1WEVA 2F6NA 4C9ZA 3HQMA 2NAAA 4FK5A 2G6QA 3HCTA 5LKTA 2M1RA 1X4UA 2YQMA 2CR2A 1WESA 5E1TA 2ECGA 4V3KC 3ZPVE 1WIMA 5H1TA 1QSCA 2MUMA 1CHCA 1Z60A 4B7YC 2KWKA 5DKAA 2VPBA 2FOJA 3SHBA 4A4CA 4O1VA 4BBQA 2F6JA 1IYMA 3IVVA 4R8PK 4UI9B 2KYUA 3N9PA 1Z2QA 3IHPA 3C5KA 3N9LA 2QICA 3V43A 4YSIA 2H0DA 3LQHA 1CA9A 3M63A 4GNFA 2F1YA 3RPGC 2L5UA 5LKUA 2HYED 2MNZA 3PUQA 4GWMA 3O7AA 2L0BA 2CSZA 2JRJA 3RPGB 5FEYA 1XWHA 2VJFB 3N9MA 4N3WA 4AP4A 5G0FA 2EODA 1F62A 2KE1A 3O33A 4UP0A 4YAXA 1WFKA 2RSDA 5B8DA 4WZ3B 3KV6A 5I3LA 1WEPA 1JOCA 4MVTA 5G04B 2LV9A 1VFYA 1YY6A 4LKAA 5KH9A 3N9OA
chains in the Genus database with same CATH superfamily
2LGKA 3LRQA 1WEWA 2AN6A 4I7DA 2C2LA 2KFTA 4TKPB 2YSMA 3ZVYA 1L0AA 2LXPC 4AYCA 1CZZA 5B77A 1Z6UA 2UZGA 3O37A 2IQJA 1JM7B 5JG6A 1RF3A 3U5OA 4Z8MA 3HTKC 3JUEA 1BORA 2KU3A 3KQIA 4PTBA 1LB5A 4CCGX 2CKLB 4LLBA 2VPGA 2LN0A 2F42A 4H9DA 2MIQA 4YBSA 2VJEB 4FO9A 2RR4A 1DCQA 2CRRA 4MSXA 1CZYA 2K4DA 4F52B 2LAUA 3ASLA 5TRBA 2A25A 3FJUB 2MA6A 2XXNA 2I50A 3T9KA 2CSVA 3GL6A 3FAOA 5J3XA 4I7CA 3ZYQA 3EB5A 4M4EA 3PURA 2YREA 5B78A 3H7HA 4A0CD 5FB0A 2FOPA 3ZPV1 4CA1A 2ECTA 2IDAA 4S3OC 2B0OE 3KV5A 1T1HA 3HU6A 1ZMSA 2K1JA 2KR4A 2M3HA 5H1VA 3M7KA 4WZ0A 5LCWB 4YBMA 4YATA 5LKZA 2CONA 4R2YA 5C13A 4WA6A 2MT5A 2QIZA 3M62A 4V3LC 4Z0RA 5D1MB 3M99A 4ZDTA 2KWJA 2KKYA 5H9MA 1LB4A 2XB1A 3Q1DA 2ECJA 4GNDA 2HDPA 5K3QA 4I7BA 1ZBDB 4B86C 1HYIA 4W4UA 4F1PA 4O64A 3SOUA 3L1ZB 2JMDA 3KNVA 4L58A 2PUYA 1WENA 2VPDA 5C11A 5D1LB 2PNXA 4JJQA 2K16A 5KH3A 1YZEA 4K8UA 1F3VB 4BHWA 1FP0A 2YHOA 2MA5A 2L43A 2L75A 5FERA 2LXHC 1G25A 3HQHA 3HQIA 3MQSC 1WEEA 2H0DB 1VD4A 4AVXA 3HQLA 3PLWA 1X4JA 3HCUA 3KDEC 2FFWA 5TDRA 4P5OB 2YT5A 2KWOA 1D0JA 2MNYA 2JMJA 5D1KB 4YC9A 2VP7A 1LDKC 2LGLA 3FANA 3T7LA 1JM7A 4IC2A 3DQVR 1U6GB 2CSYA 2YHNA 2VNFA 4FJCA 3IVBA 4LADB 2MD8C 4L7XA 4GB0A 2XOZA 3ZJBA 3FL2A 2VJEA 4QF2A 4AUQB 4KG9A 3GV4A 2DSMA 2RI7A 5SVIB 2MD7B 5DINA 2ECNA 2KGIA 2FD4A 4GNGA 2M85A 2BAYA 1WEQA 2Y1MA 4UP5A 3I2DA 5TBNA 2OXQC 1WGMA 3T6RA 2D8SA 3QZVA 5G05B 5EYAF 1WEUA 4YBTA 2L7PA 5TABA 4ZQLA 3O47A 3HCSA 1FBVA 1MM2A 4LJNA 4WZ2A 3DPLR 1VYXA 1WEMA 2FUUA 4IC3A 1N87A 1X4IA 1LDJB 3MQRA 3SOXA 1K2FA 5B76A 3EB6A 4S3OB 2CT2A 2EA6A 3C6WA 3U5NA 3MHSA 2KGGA 3O70A 1LB6A 5AITA 2FSAA 3SOWA 1HYJA 5SVXA 1D00A 1RMDA 2G43A 2EGPA 5B75A 4PPEA 2M13A 1WEOA 3MDBC 1FLLA 2YW8A 1D0AA 3O34A 2LGVA 2YQLA 2ECWA 4FIPA 1E4UA 2XOYA 5KH7A 2LDRA 3IVQA 2VJFA 3O35A 5TDWA 4Q6FA 2JM3A 2YYRA 2LGGA 5FB1A 2OWAA 2P57A 3PHDA 4NN2A 2M6MA 5B79A 3LVQE 3DWDA 3RTRB 4X3GA 2F1WA 2C2VS 5LKXA 1WE9A 4N4FA 2ECVA 3LQIA 4O62A 3ZTGA 2GKWA 3HSVA 4ZUXU 2YUCA 2ECIA 1D01A 4LK9A 2E6RA 1CA4A 2JUNA 4Z0OA 3LVRE 1V87A 4YABA 2LRIC 4GJHA 2FUIA 2EGMA 3NG2A 4A49A 2G45A 3LDYA 3LQJA 2CKLA 2E61A 4XI1A 3U5MA 2YU4A 3N9NA 2KIZA 5H1UA 4GWNA 3ZNIA 4GHUA 2F1XA 3L1XA 3ZVZB 5SVYA 2DX8A 1MM3A 2LQ6A 2YSJA 4GNEA 1FLKA 3N9QA 2F1ZA 2K17A 2L80A 2Y43A 3VK6A 4AYCB 3MHHA 4R7EA 3FEHA 2FOOA 1DVPA 2Y1NA 2JMIA 2VPEA 2XEUA 3O36A 1KZZA 1WILA 5AIUA 2KREA 3SUBA 4A4BA 2CRWA 2YURA 3L11A 4QF3A 2E6SA 2QJ0A 3U5PA 4YADA 2ZETC 3LJUX 2KWNA 1WEVA 2F6NA 3E2DA 4C9ZA 3HQMA 2NAAA 4FK5A 2YVRA 2G6QA 3HCTA 5LKTA 2M1RA 1X4UA 2YQMA 2CR2A 1WESA 5E1TA 2ECGA 4V3KC 3ZPVE 1WIMA 5H1TA 2EXUA 1QSCA 2MUMA 1CHCA 1Z60A 4B7YC 2KWKA 5DKAA 4QQ4A 2VPBA 2FOJA 4OGCA 3SHBA 4A4CA 4O1VA 2XP0A 4BBQA 2F6JA 1IYMA 3IVVA 4R8PK 2MKEA 4UI9B 2KYUA 3N9PA 1Z2QA 3IHPA 3C5KA 4OGEA 3N9LA 2QICA 3V43A 4YSIA 2H0DA 3LQHA 1CA9A 3M63A 4GNFA 2F1YA 3RPGC 2D8UA 3FM8C 2L5UA 5LKUA 2HYED 2MNZA 3PUQA 4GWMA 3O7AA 2L0BA 2CSZA 1MBMA 2JRJA 3RPGB 5FEYA 1XWHA 2VJFB 3N9MA 4N3WA 4AP4A 3DDTA 5G0FA 2EODA 1F62A 2KE1A 3O33A 4UP0A 4YAXA 1WFKA 2KKXA 2RSDA 5B8DA 4WZ3B 3KV6A 5I3LA 1WEPA 1JOCA 4MVTA 5SVIA 5G04B 2LV9A 1VFYA 1YY6A 2XOCA 4LKAA 5KH9A 3N9OA 2DJAA
chains in the Genus database with same CATH topology
2LGKA 3LRQA 1WEWA 2AN6A 4I7DA 2C2LA 2KFTA 4TKPB 2YSMA 3ZVYA 1L0AA 2LXPC 4AYCA 1CZZA 5B77A 1Z6UA 2UZGA 3O37A 1JM7B 5JG6A 1RF3A 3U5OA 4Z8MA 3HTKC 1BORA 2KU3A 3KQIA 4PTBA 1LB5A 4CCGX 2CKLB 4LLBA 2VPGA 2LN0A 2F42A 2MIQA 4YBSA 2VJEB 4FO9A 4MSXA 1CZYA 2K4DA 4F52B 3ASLA 5TRBA 2A25A 2MA6A 2XXNA 2I50A 3GL6A 5J3XA 4I7CA 3ZYQA 3EB5A 4M4EA 3PURA 2YREA 5B78A 4A0CD 5FB0A 2FOPA 3ZPV1 4CA1A 2ECTA 2IDAA 4S3OC 3KV5A 1T1HA 3HU6A 1ZMSA 2K1JA 2KR4A 2M3HA 5H1VA 4WZ0A 5LCWB 4YBMA 4YATA 5LKZA 4R2YA 5C13A 4WA6A 2MT5A 2QIZA 3M62A 4V3LC 5D1MB 3M99A 4ZDTA 2KWJA 5H9MA 1LB4A 2XB1A 2ECJA 4GNDA 2HDPA 4I7BA 1ZBDB 4B86C 1HYIA 4W4UA 4O64A 3SOUA 3L1ZB 2JMDA 3KNVA 4L58A 2PUYA 1WENA 2VPDA 5C11A 5D1LB 2PNXA 4JJQA 2K16A 5KH3A 1YZEA 4K8UA 1F3VB 4BHWA 1FP0A 2YHOA 2MA5A 2L43A 2L75A 5FERA 2LXHC 1G25A 3HQHA 3HQIA 3MQSC 1WEEA 2H0DB 1VD4A 4AVXA 3HQLA 1X4JA 3HCUA 5TDRA 4P5OB 2YT5A 2KWOA 1D0JA 2MNYA 2JMJA 5D1KB 4YC9A 2VP7A 1LDKC 2LGLA 3T7LA 1JM7A 4IC2A 3DQVR 1U6GB 2CSYA 2YHNA 2VNFA 4FJCA 3IVBA 4LADB 2MD8C 4L7XA 4GB0A 3ZJBA 3FL2A 2VJEA 4QF2A 4AUQB 4KG9A 3GV4A 2RI7A 2MD7B 5DINA 2ECNA 2KGIA 4GNGA 2M85A 2BAYA 1WEQA 2Y1MA 4UP5A 3I2DA 5TBNA 2OXQC 1WGMA 3T6RA 2D8SA 3QZVA 5G05B 5EYAF 1WEUA 4YBTA 5TABA 4ZQLA 3HCSA 1FBVA 1MM2A 4LJNA 4WZ2A 3DPLR 1VYXA 1WEMA 2FUUA 4IC3A 1N87A 1X4IA 1LDJB 3MQRA 3SOXA 1K2FA 5B76A 3EB6A 4S3OB 2CT2A 2EA6A 3C6WA 3U5NA 3MHSA 2KGGA 3O70A 1LB6A 5AITA 2FSAA 3SOWA 1HYJA 1D00A 1RMDA 2G43A 2EGPA 5B75A 4PPEA 1WEOA 1FLLA 2YW8A 3O34A 1D0AA 2LGVA 2YQLA 2ECWA 4FIPA 1E4UA 5KH7A 2LDRA 3IVQA 2VJFA 3O35A 5TDWA 4Q6FA 2YYRA 2LGGA 5FB1A 3PHDA 4NN2A 2M6MA 5B79A 3RTRB 4X3GA 2F1WA 2C2VS 5LKXA 1WE9A 4N4FA 2ECVA 3LQIA 3ZTGA 2GKWA 3HSVA 4ZUXU 2YUCA 2ECIA 1D01A 4LK9A 2E6RA 1CA4A 1V87A 4YABA 2LRIC 4GJHA 2FUIA 3NG2A 4A49A 2G45A 3LQJA 2CKLA 4XI1A 3U5MA 2YU4A 3N9NA 2KIZA 5H1UA 4GWNA 3ZNIA 4GHUA 2F1XA 3L1XA 3ZVZB 2DX8A 1MM3A 2LQ6A 2YSJA 4GNEA 1FLKA 3N9QA 2F1ZA 2K17A 2L80A 2Y43A 3VK6A 4AYCB 3MHHA 4R7EA 2FOOA 1DVPA 2Y1NA 2JMIA 2VPEA 2XEUA 3O36A 1KZZA 1WILA 5AIUA 2KREA 4A4BA 2YURA 3L11A 4QF3A 2E6SA 2QJ0A 3U5PA 4YADA 2ZETC 2KWNA 1WEVA 2F6NA 4C9ZA 3HQMA 2NAAA 4FK5A 2G6QA 3HCTA 5LKTA 2M1RA 1X4UA 2YQMA 2CR2A 1WESA 5E1TA 2ECGA 4V3KC 3ZPVE 1WIMA 5H1TA 1QSCA 2MUMA 1CHCA 1Z60A 4B7YC 2KWKA 5DKAA 2VPBA 2FOJA 3SHBA 4A4CA 4O1VA 4BBQA 2F6JA 1IYMA 3IVVA 4R8PK 4UI9B 2KYUA 3N9PA 1Z2QA 3IHPA 3C5KA 3N9LA 2QICA 3V43A 4YSIA 2H0DA 3LQHA 1CA9A 3M63A 4GNFA 2F1YA 3RPGC 2L5UA 5LKUA 2HYED 2MNZA 3PUQA 4GWMA 3O7AA 2L0BA 2CSZA 2JRJA 3RPGB 5FEYA 1XWHA 2VJFB 3N9MA 4N3WA 4AP4A 5G0FA 2EODA 1F62A 2KE1A 3O33A 4UP0A 4YAXA 1WFKA 2RSDA 5B8DA 4WZ3B 3KV6A 5I3LA 1WEPA 1JOCA 4MVTA 5G04B 2LV9A 1VFYA 1YY6A 4LKAA 5KH9A 3N9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGK A;  3LRQ A;  1WEW A;  2AN6 A;  4I7D A;  2C2L A;  2KFT A;  4TKP B;  2YSM A;  3ZVY A;  1L0A A;  2LXP C;  4AYC A;  1CZZ A;  5B77 A;  1Z6U A;  2UZG A;  3O37 A;  1JM7 B;  5JG6 A;  1RF3 A;  3U5O A;  4Z8M A;  3HTK C;  1BOR A;  2KU3 A;  3KQI A;  4PTB A;  1LB5 A;  4CCG X;  2CKL B;  4LLB A;  2VPG A;  2LN0 A;  2F42 A;  2MIQ A;  4YBS A;  2VJE B;  4FO9 A;  4MSX A;  1CZY A;  2K4D A;  4F52 B;  3ASL A;  5TRB A;  2A25 A;  2MA6 A;  2XXN A;  2I50 A;  3GL6 A;  5J3X A;  4I7C A;  3ZYQ A;  3EB5 A;  4M4E A;  3PUR A;  2YRE A;  5B78 A;  4A0C D;  5FB0 A;  2FOP A;  3ZPV 1;  4CA1 A;  2ECT A;  2IDA A;  4S3O C;  3KV5 A;  1T1H A;  3HU6 A;  1ZMS A;  2K1J A;  2KR4 A;  2M3H A;  5H1V A;  4WZ0 A;  5LCW B;  4YBM A;  4YAT A;  5LKZ A;  4R2Y A;  5C13 A;  4WA6 A;  2MT5 A;  2QIZ A;  3M62 A;  4V3L C;  5D1M B;  3M99 A;  4ZDT A;  2KWJ A;  5H9M A;  1LB4 A;  2XB1 A;  2ECJ A;  4GND A;  2HDP A;  4I7B A;  1ZBD B;  4B86 C;  1HYI A;  4W4U A;  4O64 A;  3SOU A;  3L1Z B;  2JMD A;  3KNV A;  4L58 A;  2PUY A;  1WEN A;  2VPD A;  5C11 A;  5D1L B;  2PNX A;  4JJQ A;  2K16 A;  5KH3 A;  1YZE A;  4K8U A;  1F3V B;  4BHW A;  1FP0 A;  2YHO A;  2MA5 A;  2L43 A;  2L75 A;  5FER A;  2LXH C;  1G25 A;  3HQH A;  3HQI A;  3MQS C;  1WEE A;  2H0D B;  1VD4 A;  4AVX A;  3HQL A;  1X4J A;  3HCU A;  5TDR A;  4P5O B;  2YT5 A;  2KWO A;  1D0J A;  2MNY A;  2JMJ A;  5D1K B;  4YC9 A;  2VP7 A;  1LDK C;  2LGL A;  3T7L A;  1JM7 A;  4IC2 A;  3DQV R;  1U6G B;  2CSY A;  2YHN A;  2VNF A;  4FJC A;  3IVB A;  4LAD B;  2MD8 C;  4L7X A;  4GB0 A;  3ZJB A;  3FL2 A;  2VJE A;  4QF2 A;  4AUQ B;  4KG9 A;  3GV4 A;  2RI7 A;  2MD7 B;  5DIN A;  2ECN A;  2KGI A;  4GNG A;  2M85 A;  2BAY A;  1WEQ A;  2Y1M A;  4UP5 A;  3I2D A;  5TBN A;  2OXQ C;  1WGM A;  3T6R A;  2D8S A;  3QZV A;  5G05 B;  5EYA F;  1WEU A;  4YBT A;  5TAB A;  4ZQL A;  3HCS A;  1FBV A;  1MM2 A;  4LJN A;  4WZ2 A;  3DPL R;  1VYX A;  1WEM A;  2FUU A;  4IC3 A;  1N87 A;  1X4I A;  1LDJ B;  3MQR A;  3SOX A;  1K2F A;  5B76 A;  3EB6 A;  4S3O B;  2CT2 A;  2EA6 A;  3C6W A;  3U5N A;  3MHS A;  2KGG A;  3O70 A;  1LB6 A;  5AIT A;  2FSA A;  3SOW A;  1HYJ A;  1D00 A;  1RMD A;  2G43 A;  2EGP A;  5B75 A;  4PPE A;  1WEO A;  1FLL A;  2YW8 A;  3O34 A;  1D0A A;  2LGV A;  2YQL A;  2ECW A;  4FIP A;  1E4U A;  5KH7 A;  2LDR A;  3IVQ A;  2VJF A;  3O35 A;  5TDW A;  4Q6F A;  2YYR A;  2LGG A;  5FB1 A;  3PHD A;  4NN2 A;  2M6M A;  5B79 A;  3RTR B;  4X3G A;  2F1W A;  2C2V S;  5LKX A;  1WE9 A;  4N4F A;  2ECV A;  3LQI A;  3ZTG A;  2GKW A;  3HSV A;  4ZUX U;  2YUC A;  2ECI A;  1D01 A;  4LK9 A;  2E6R A;  1CA4 A;  1V87 A;  4YAB A;  2LRI C;  4GJH A;  2FUI A;  3NG2 A;  4A49 A;  2G45 A;  3LQJ A;  2CKL A;  4XI1 A;  3U5M A;  2YU4 A;  3N9N A;  2KIZ A;  5H1U A;  4GWN A;  3ZNI A;  4GHU A;  2F1X A;  3L1X A;  3ZVZ B;  2DX8 A;  1MM3 A;  2LQ6 A;  2YSJ A;  4GNE A;  1FLK A;  3N9Q A;  2F1Z A;  2K17 A;  2L80 A;  2Y43 A;  3VK6 A;  4AYC B;  3MHH A;  4R7E A;  2FOO A;  1DVP A;  2Y1N A;  2JMI A;  2VPE A;  2XEU A;  3O36 A;  1KZZ A;  1WIL A;  5AIU A;  2KRE A;  4A4B A;  2YUR A;  3L11 A;  4QF3 A;  2E6S A;  2QJ0 A;  3U5P A;  4YAD A;  2ZET C;  2KWN A;  1WEV A;  2F6N A;  4C9Z A;  3HQM A;  2NAA A;  4FK5 A;  2G6Q A;  3HCT A;  5LKT A;  2M1R A;  1X4U A;  2YQM A;  2CR2 A;  1WES A;  5E1T A;  2ECG A;  4V3K C;  3ZPV E;  1WIM A;  5H1T A;  1QSC A;  2MUM A;  1CHC A;  1Z60 A;  4B7Y C;  2KWK A;  5DKA A;  2VPB A;  2FOJ A;  3SHB A;  4A4C A;  4O1V A;  4BBQ A;  2F6J A;  1IYM A;  3IVV A;  4R8P K;  4UI9 B;  2KYU A;  3N9P A;  1Z2Q A;  3IHP A;  3C5K A;  3N9L A;  2QIC A;  3V43 A;  4YSI A;  2H0D A;  3LQH A;  1CA9 A;  3M63 A;  4GNF A;  2F1Y A;  3RPG C;  2L5U A;  5LKU A;  2HYE D;  2MNZ A;  3PUQ A;  4GWM A;  3O7A A;  2L0B A;  2CSZ A;  2JRJ A;  3RPG B;  5FEY A;  1XWH A;  2VJF B;  3N9M A;  4N3W A;  4AP4 A;  5G0F A;  2EOD A;  1F62 A;  2KE1 A;  3O33 A;  4UP0 A;  4YAX A;  1WFK A;  2RSD A;  5B8D A;  4WZ3 B;  3KV6 A;  5I3L A;  1WEP A;  1JOC A;  4MVT A;  5G04 B;  2LV9 A;  1VFY A;  1YY6 A;  4LKA A;  5KH9 A;  3N9O A; 
#chains in the Genus database with same CATH topology
 2LGK A;  3LRQ A;  1WEW A;  2AN6 A;  4I7D A;  2C2L A;  2KFT A;  4TKP B;  2YSM A;  3ZVY A;  1L0A A;  2LXP C;  4AYC A;  1CZZ A;  5B77 A;  1Z6U A;  2UZG A;  3O37 A;  2IQJ A;  1JM7 B;  5JG6 A;  1RF3 A;  3U5O A;  4Z8M A;  3HTK C;  3JUE A;  1BOR A;  2KU3 A;  3KQI A;  4PTB A;  1LB5 A;  4CCG X;  2CKL B;  4LLB A;  2VPG A;  2LN0 A;  2F42 A;  4H9D A;  2MIQ A;  4YBS A;  2VJE B;  4FO9 A;  2RR4 A;  1DCQ A;  2CRR A;  4MSX A;  1CZY A;  2K4D A;  4F52 B;  2LAU A;  3ASL A;  5TRB A;  2A25 A;  3FJU B;  2MA6 A;  2XXN A;  2I50 A;  3T9K A;  2CSV A;  3GL6 A;  3FAO A;  5J3X A;  4I7C A;  3ZYQ A;  3EB5 A;  4M4E A;  3PUR A;  2YRE A;  5B78 A;  3H7H A;  4A0C D;  5FB0 A;  2FOP A;  3ZPV 1;  4CA1 A;  2ECT A;  2IDA A;  4S3O C;  2B0O E;  3KV5 A;  1T1H A;  3HU6 A;  1ZMS A;  2K1J A;  2KR4 A;  2M3H A;  5H1V A;  3M7K A;  4WZ0 A;  5LCW B;  4YBM A;  4YAT A;  5LKZ A;  2CON A;  4R2Y A;  5C13 A;  4WA6 A;  2MT5 A;  2QIZ A;  3M62 A;  4V3L C;  4Z0R A;  5D1M B;  3M99 A;  4ZDT A;  2KWJ A;  2KKY A;  5H9M A;  1LB4 A;  2XB1 A;  3Q1D A;  2ECJ A;  4GND A;  2HDP A;  5K3Q A;  4I7B A;  1ZBD B;  4B86 C;  1HYI A;  4W4U A;  4F1P A;  4O64 A;  3SOU A;  3L1Z B;  2JMD A;  3KNV A;  4L58 A;  2PUY A;  1WEN A;  2VPD A;  5C11 A;  5D1L B;  2PNX A;  4JJQ A;  2K16 A;  5KH3 A;  1YZE A;  4K8U A;  1F3V B;  4BHW A;  1FP0 A;  2YHO A;  2MA5 A;  2L43 A;  2L75 A;  5FER A;  2LXH C;  1G25 A;  3HQH A;  3HQI A;  3MQS C;  1WEE A;  2H0D B;  1VD4 A;  4AVX A;  3HQL A;  3PLW A;  1X4J A;  3HCU A;  3KDE C;  2FFW A;  5TDR A;  4P5O B;  2YT5 A;  2KWO A;  1D0J A;  2MNY A;  2JMJ A;  5D1K B;  4YC9 A;  2VP7 A;  1LDK C;  2LGL A;  3FAN A;  3T7L A;  1JM7 A;  4IC2 A;  3DQV R;  1U6G B;  2CSY A;  2YHN A;  2VNF A;  4FJC A;  3IVB A;  4LAD B;  2MD8 C;  4L7X A;  4GB0 A;  2XOZ A;  3ZJB A;  3FL2 A;  2VJE A;  4QF2 A;  4AUQ B;  4KG9 A;  3GV4 A;  2DSM A;  2RI7 A;  5SVI B;  2MD7 B;  5DIN A;  2ECN A;  2KGI A;  2FD4 A;  4GNG A;  2M85 A;  2BAY A;  1WEQ A;  2Y1M A;  4UP5 A;  3I2D A;  5TBN A;  2OXQ C;  1WGM A;  3T6R A;  2D8S A;  3QZV A;  5G05 B;  5EYA F;  1WEU A;  4YBT A;  2L7P A;  5TAB A;  4ZQL A;  3O47 A;  3HCS A;  1FBV A;  1MM2 A;  4LJN A;  4WZ2 A;  3DPL R;  1VYX A;  1WEM A;  2FUU A;  4IC3 A;  1N87 A;  1X4I A;  1LDJ B;  3MQR A;  3SOX A;  1K2F A;  5B76 A;  3EB6 A;  4S3O B;  2CT2 A;  2EA6 A;  3C6W A;  3U5N A;  3MHS A;  2KGG A;  3O70 A;  1LB6 A;  5AIT A;  2FSA A;  3SOW A;  1HYJ A;  5SVX A;  1D00 A;  1RMD A;  2G43 A;  2EGP A;  5B75 A;  4PPE A;  2M13 A;  1WEO A;  3MDB C;  1FLL A;  2YW8 A;  1D0A A;  3O34 A;  2LGV A;  2YQL A;  2ECW A;  4FIP A;  1E4U A;  2XOY A;  5KH7 A;  2LDR A;  3IVQ A;  2VJF A;  3O35 A;  5TDW A;  4Q6F A;  2JM3 A;  2YYR A;  2LGG A;  5FB1 A;  2OWA A;  2P57 A;  3PHD A;  4NN2 A;  2M6M A;  5B79 A;  3LVQ E;  3DWD A;  3RTR B;  4X3G A;  2F1W A;  2C2V S;  5LKX A;  1WE9 A;  4N4F A;  2ECV A;  3LQI A;  4O62 A;  3ZTG A;  2GKW A;  3HSV A;  4ZUX U;  2YUC A;  2ECI A;  1D01 A;  4LK9 A;  2E6R A;  1CA4 A;  2JUN A;  4Z0O A;  3LVR E;  1V87 A;  4YAB A;  2LRI C;  4GJH A;  2FUI A;  2EGM A;  3NG2 A;  4A49 A;  2G45 A;  3LDY A;  3LQJ A;  2CKL A;  2E61 A;  4XI1 A;  3U5M A;  2YU4 A;  3N9N A;  2KIZ A;  5H1U A;  4GWN A;  3ZNI A;  4GHU A;  2F1X A;  3L1X A;  3ZVZ B;  5SVY A;  2DX8 A;  1MM3 A;  2LQ6 A;  2YSJ A;  4GNE A;  1FLK A;  3N9Q A;  2F1Z A;  2K17 A;  2L80 A;  2Y43 A;  3VK6 A;  4AYC B;  3MHH A;  4R7E A;  3FEH A;  2FOO A;  1DVP A;  2Y1N A;  2JMI A;  2VPE A;  2XEU A;  3O36 A;  1KZZ A;  1WIL A;  5AIU A;  2KRE A;  3SUB A;  4A4B A;  2CRW A;  2YUR A;  3L11 A;  4QF3 A;  2E6S A;  2QJ0 A;  3U5P A;  4YAD A;  2ZET C;  3LJU X;  2KWN A;  1WEV A;  2F6N A;  3E2D A;  4C9Z A;  3HQM A;  2NAA A;  4FK5 A;  2YVR A;  2G6Q A;  3HCT A;  5LKT A;  2M1R A;  1X4U A;  2YQM A;  2CR2 A;  1WES A;  5E1T A;  2ECG A;  4V3K C;  3ZPV E;  1WIM A;  5H1T A;  2EXU A;  1QSC A;  2MUM A;  1CHC A;  1Z60 A;  4B7Y C;  2KWK A;  5DKA A;  4QQ4 A;  2VPB A;  2FOJ A;  4OGC A;  3SHB A;  4A4C A;  4O1V A;  2XP0 A;  4BBQ A;  2F6J A;  1IYM A;  3IVV A;  4R8P K;  2MKE A;  4UI9 B;  2KYU A;  3N9P A;  1Z2Q A;  3IHP A;  3C5K A;  4OGE A;  3N9L A;  2QIC A;  3V43 A;  4YSI A;  2H0D A;  3LQH A;  1CA9 A;  3M63 A;  4GNF A;  2F1Y A;  3RPG C;  2D8U A;  3FM8 C;  2L5U A;  5LKU A;  2HYE D;  2MNZ A;  3PUQ A;  4GWM A;  3O7A A;  2L0B A;  2CSZ A;  1MBM A;  2JRJ A;  3RPG B;  5FEY A;  1XWH A;  2VJF B;  3N9M A;  4N3W A;  4AP4 A;  3DDT A;  5G0F A;  2EOD A;  1F62 A;  2KE1 A;  3O33 A;  4UP0 A;  4YAX A;  1WFK A;  2KKX A;  2RSD A;  5B8D A;  4WZ3 B;  3KV6 A;  5I3L A;  1WEP A;  1JOC A;  4MVT A;  5SVI A;  5G04 B;  2LV9 A;  1VFY A;  1YY6 A;  2XOC A;  4LKA A;  5KH9 A;  3N9O A;  2DJA A; 
#chains in the Genus database with same CATH homology
 2LGK A;  3LRQ A;  1WEW A;  2AN6 A;  4I7D A;  2C2L A;  2KFT A;  4TKP B;  2YSM A;  3ZVY A;  1L0A A;  2LXP C;  4AYC A;  1CZZ A;  5B77 A;  1Z6U A;  2UZG A;  3O37 A;  1JM7 B;  5JG6 A;  1RF3 A;  3U5O A;  4Z8M A;  3HTK C;  1BOR A;  2KU3 A;  3KQI A;  4PTB A;  1LB5 A;  4CCG X;  2CKL B;  4LLB A;  2VPG A;  2LN0 A;  2F42 A;  2MIQ A;  4YBS A;  2VJE B;  4FO9 A;  4MSX A;  1CZY A;  2K4D A;  4F52 B;  3ASL A;  5TRB A;  2A25 A;  2MA6 A;  2XXN A;  2I50 A;  3GL6 A;  5J3X A;  4I7C A;  3ZYQ A;  3EB5 A;  4M4E A;  3PUR A;  2YRE A;  5B78 A;  4A0C D;  5FB0 A;  2FOP A;  3ZPV 1;  4CA1 A;  2ECT A;  2IDA A;  4S3O C;  3KV5 A;  1T1H A;  3HU6 A;  1ZMS A;  2K1J A;  2KR4 A;  2M3H A;  5H1V A;  4WZ0 A;  5LCW B;  4YBM A;  4YAT A;  5LKZ A;  4R2Y A;  5C13 A;  4WA6 A;  2MT5 A;  2QIZ A;  3M62 A;  4V3L C;  5D1M B;  3M99 A;  4ZDT A;  2KWJ A;  5H9M A;  1LB4 A;  2XB1 A;  2ECJ A;  4GND A;  2HDP A;  4I7B A;  1ZBD B;  4B86 C;  1HYI A;  4W4U A;  4O64 A;  3SOU A;  3L1Z B;  2JMD A;  3KNV A;  4L58 A;  2PUY A;  1WEN A;  2VPD A;  5C11 A;  5D1L B;  2PNX A;  4JJQ A;  2K16 A;  5KH3 A;  1YZE A;  4K8U A;  1F3V B;  4BHW A;  1FP0 A;  2YHO A;  2MA5 A;  2L43 A;  2L75 A;  5FER A;  2LXH C;  1G25 A;  3HQH A;  3HQI A;  3MQS C;  1WEE A;  2H0D B;  1VD4 A;  4AVX A;  3HQL A;  1X4J A;  3HCU A;  5TDR A;  4P5O B;  2YT5 A;  2KWO A;  1D0J A;  2MNY A;  2JMJ A;  5D1K B;  4YC9 A;  2VP7 A;  1LDK C;  2LGL A;  3T7L A;  1JM7 A;  4IC2 A;  3DQV R;  1U6G B;  2CSY A;  2YHN A;  2VNF A;  4FJC A;  3IVB A;  4LAD B;  2MD8 C;  4L7X A;  4GB0 A;  3ZJB A;  3FL2 A;  2VJE A;  4QF2 A;  4AUQ B;  4KG9 A;  3GV4 A;  2RI7 A;  2MD7 B;  5DIN A;  2ECN A;  2KGI A;  4GNG A;  2M85 A;  2BAY A;  1WEQ A;  2Y1M A;  4UP5 A;  3I2D A;  5TBN A;  2OXQ C;  1WGM A;  3T6R A;  2D8S A;  3QZV A;  5G05 B;  5EYA F;  1WEU A;  4YBT A;  5TAB A;  4ZQL A;  3HCS A;  1FBV A;  1MM2 A;  4LJN A;  4WZ2 A;  3DPL R;  1VYX A;  1WEM A;  2FUU A;  4IC3 A;  1N87 A;  1X4I A;  1LDJ B;  3MQR A;  3SOX A;  1K2F A;  5B76 A;  3EB6 A;  4S3O B;  2CT2 A;  2EA6 A;  3C6W A;  3U5N A;  3MHS A;  2KGG A;  3O70 A;  1LB6 A;  5AIT A;  2FSA A;  3SOW A;  1HYJ A;  1D00 A;  1RMD A;  2G43 A;  2EGP A;  5B75 A;  4PPE A;  1WEO A;  1FLL A;  2YW8 A;  3O34 A;  1D0A A;  2LGV A;  2YQL A;  2ECW A;  4FIP A;  1E4U A;  5KH7 A;  2LDR A;  3IVQ A;  2VJF A;  3O35 A;  5TDW A;  4Q6F A;  2YYR A;  2LGG A;  5FB1 A;  3PHD A;  4NN2 A;  2M6M A;  5B79 A;  3RTR B;  4X3G A;  2F1W A;  2C2V S;  5LKX A;  1WE9 A;  4N4F A;  2ECV A;  3LQI A;  3ZTG A;  2GKW A;  3HSV A;  4ZUX U;  2YUC A;  2ECI A;  1D01 A;  4LK9 A;  2E6R A;  1CA4 A;  1V87 A;  4YAB A;  2LRI C;  4GJH A;  2FUI A;  3NG2 A;  4A49 A;  2G45 A;  3LQJ A;  2CKL A;  4XI1 A;  3U5M A;  2YU4 A;  3N9N A;  2KIZ A;  5H1U A;  4GWN A;  3ZNI A;  4GHU A;  2F1X A;  3L1X A;  3ZVZ B;  2DX8 A;  1MM3 A;  2LQ6 A;  2YSJ A;  4GNE A;  1FLK A;  3N9Q A;  2F1Z A;  2K17 A;  2L80 A;  2Y43 A;  3VK6 A;  4AYC B;  3MHH A;  4R7E A;  2FOO A;  1DVP A;  2Y1N A;  2JMI A;  2VPE A;  2XEU A;  3O36 A;  1KZZ A;  1WIL A;  5AIU A;  2KRE A;  4A4B A;  2YUR A;  3L11 A;  4QF3 A;  2E6S A;  2QJ0 A;  3U5P A;  4YAD A;  2ZET C;  2KWN A;  1WEV A;  2F6N A;  4C9Z A;  3HQM A;  2NAA A;  4FK5 A;  2G6Q A;  3HCT A;  5LKT A;  2M1R A;  1X4U A;  2YQM A;  2CR2 A;  1WES A;  5E1T A;  2ECG A;  4V3K C;  3ZPV E;  1WIM A;  5H1T A;  1QSC A;  2MUM A;  1CHC A;  1Z60 A;  4B7Y C;  2KWK A;  5DKA A;  2VPB A;  2FOJ A;  3SHB A;  4A4C A;  4O1V A;  4BBQ A;  2F6J A;  1IYM A;  3IVV A;  4R8P K;  4UI9 B;  2KYU A;  3N9P A;  1Z2Q A;  3IHP A;  3C5K A;  3N9L A;  2QIC A;  3V43 A;  4YSI A;  2H0D A;  3LQH A;  1CA9 A;  3M63 A;  4GNF A;  2F1Y A;  3RPG C;  2L5U A;  5LKU A;  2HYE D;  2MNZ A;  3PUQ A;  4GWM A;  3O7A A;  2L0B A;  2CSZ A;  2JRJ A;  3RPG B;  5FEY A;  1XWH A;  2VJF B;  3N9M A;  4N3W A;  4AP4 A;  5G0F A;  2EOD A;  1F62 A;  2KE1 A;  3O33 A;  4UP0 A;  4YAX A;  1WFK A;  2RSD A;  5B8D A;  4WZ3 B;  3KV6 A;  5I3L A;  1WEP A;  1JOC A;  4MVT A;  5G04 B;  2LV9 A;  1VFY A;  1YY6 A;  4LKA A;  5KH9 A;  3N9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...