4I7BA

Siah1 bound to synthetic peptide (ace)klrpv(aba)mvrptvr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
189
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 189
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7bA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7bA01
2MD8C 1WEOA 5B8DA 4GNDA 3N9LA 4WA6A 4PPEA 1CA9A 2ECIA 3M63A 1CZYA 1L0AA 5H1UA 2KYUA 2VPGA 3O36A 4X3GA 2RI7A 2F1WA 2YUCA 5E1TA 4YAXA 2D8SA 4AVXA 4GNEA 1WEWA 2VJEA 2VJFA 4YADA 2MT5A 3ZJBA 1D0JA 2LV9A 2ECJA 2KWKA 2M6MA 2AN6A 4YATA 2XXNA 3LQHA 1JM7A 4I7BA 4LK9A 1JOCA 2L75A 2KREA 1IYMA 2VJEB 2VJFB 5J3XA 4GJHA 3SHBA 4B7YC 1WEUA 4GB0A 2LDRA 3T6RA 3I2DA 3O70A 2PNXA 3KV5A 2M85A 4UP5A 2CT2A 1JM7B 1WE9A 3PHDA 5AIUA 4FJCA 1VFYA 4QF2A 5KH9A 4AP4A 5AITA 1WEEA 3RTRB 2L43A 1T1HA 3PUQA 4S3OB 2MNZA 1LB6A 4W4UA 4I7DA 2Y1NA 2YQMA 4Q6FA 3ZYQA 4BHWA 4O1VA 3ZNIA 2QIZA 4R7EA 2H0DA 4YBTA 5FERA 2F1YA 1XWHA 4A0CD 2KWOA 3HCTA 2ECGA 1CHCA 4ZDTA 5D1MB 4GWMA 2FSAA 4V3KC 2ECNA 4YC9A 3ZPVE 3EB5A 2LXHC 1Z6UA 2OXQC 2LRIC 3ZVYA 2VP7A 2H0DB 1KZZA 4R8PK 1VD4A 3SOXA 2MD7B 1WENA 1WESA 4I7CA 2YT5A 3O33A 3SOUA 4LKAA 5D1LB 1K2FA 4YABA 5D1KB 3IHPA 2XB1A 3N9PA 2JRJA 4L58A 3O35A 4GNGA 2LQ6A 1LDJB 1WEVA 4AYCA 2CSYA 2L0BA 5LKUA 4GNFA 2VPBA 2HYED 3ZTGA 5TDWA 4FO9A 2EGPA 2YHOA 4L7XA 2FUUA 2FOPA 1N87A 2CKLA 2K16A 2CSZA 2MA6A 1WGMA 2LXPC 5TBNA 2ECVA 4R2YA 4AYCB 3LQIA 4IC2A 5B78A 4K8UA 2YSJA 3O37A 3O34A 2KGGA 2KU3A 4WZ2A 2MIQA 3MQSC 3HQMA 3N9QA 2G6QA 2K17A 4LLBA 2FOOA 2G45A 3HQIA 2K4DA 3HCSA 1WIMA 5G04B 2YURA 2JMJA 1DVPA 3HQLA 5JG6A 2QJ0A 1WILA 4CA1A 1WEQA 2L5UA 1MM3A 4ZUXU 4WZ0A 4LJNA 1Z2QA 2MA5A 3KV6A 1HYJA 2F42A 3RPGC 5B77A 3MQRA 3HU6A 4YSIA 1F62A 4XI1A 5DINA 5EYAF 3N9OA 3RPGB 4KG9A 5LKXA 4N3WA 2YREA 1F3VB 2GKWA 2M1RA 1FP0A 3HQHA 3GV4A 3M62A 4A49A 2F6JA 2JMDA 4PTBA 1ZMSA 2YU4A 3U5PA 1QSCA 1MM2A 2VNFA 5TRBA 3U5MA 4CCGX 2PUYA 4AUQB 2EODA 5FEYA 2LGKA 1U6GB 3HTKC 4F52B 2FUIA 1ZBDB 3HCUA 1G25A 5G05B 3EB6A 2KE1A 4ZQLA 4Z8MA 2E6SA 2LGVA 5B79A 5FB1A 1LB5A 1HYIA 1FBVA 2KFTA 3FL2A 5H9MA 3C5KA 2RSDA 2YW8A 2KIZA 2UZGA 2I50A 3O7AA 5B76A 4TKPB 4JJQA 2CR2A 2QICA 5H1TA 1Z60A 1CA4A 4A4BA 4IC3A 2KWJA 5LKZA 1CZZA 4A4CA 2DX8A 5DKAA 2F6NA 2Y1MA 1RF3A 3LRQA 4UP0A 1X4UA 3ZVZB 3QZVA 2Y43A 1E4UA 2YQLA 3VK6A 2YYRA 3C6WA 3SOWA 5C13A 3T7LA 3IVBA 3N9MA 2VPDA 2CKLB 2KGIA 2C2VS 3ZPV1 1WFKA 4QF3A 2IDAA 4N4FA 4GHUA 2JMIA 2YHNA 1YZEA 1FLKA 3LQJA 2C2LA 2ECTA 4MSXA 3KQIA 2NAAA 5KH7A 3KNVA 2HDPA 3PURA 1WEPA 3V43A 2LGLA 5KH3A 1VYXA 4YBMA 4B86C 2XEUA 1BORA 3ASLA 3DPLR 2L80A 2F1ZA 4S3OC 4LADB 4V3LC 1D01A 5H1VA 3U5OA 2MNYA 4NN2A 1X4JA 3HSVA 5TDRA 2M3HA 2FOJA 1D00A 5G0FA 3M99A 3NG2A 3GL6A 2EA6A 5TABA 4BBQA 3MHSA 2LN0A 2KR4A 2MUMA 2K1JA 4MVTA 4P5OB 1D0AA 4GWNA 2LGGA 1X4IA 5B75A 5LKTA 1RMDA 1V87A 3IVQA 4C9ZA 2KWNA 4FIPA 1YY6A 2ZETC 3MHHA 4UI9B 2E6RA 5I3LA 1LDKC 3L11A 3L1XA 1WEMA 1FLLA 2G43A 2BAYA 4WZ3B 2ECWA 2A25A 4O64A 5C11A 5LCWB 4YBSA 4M4EA 3U5NA 2YSMA 1LB4A 2F1XA 3N9NA 3IVVA 4FK5A 3DQVR 3L1ZB 5FB0A 2VPEA
chains in the Genus database with same CATH superfamily
2MD8C 1WEOA 5B8DA 4GNDA 3N9LA 4WA6A 4PPEA 3LDYA 1CA9A 2ECIA 3M63A 1CZYA 1L0AA 5H1UA 2KYUA 2VPGA 2XOCA 3O36A 4X3GA 2RI7A 2F1WA 2YUCA 5E1TA 4YAXA 3M7KA 2D8SA 4AVXA 3LJUX 4GNEA 1WEWA 2VJEA 2VJFA 4YADA 2MT5A 3ZJBA 4OGEA 1D0JA 5K3QA 2LV9A 2ECJA 2KWKA 2M6MA 2AN6A 4YATA 2XXNA 3LQHA 1JM7A 2EGMA 4I7BA 4LK9A 1JOCA 2L75A 2KREA 1IYMA 2VJEB 2VJFB 5J3XA 4GJHA 3SHBA 3PLWA 4B7YC 1WEUA 2LDRA 4GB0A 2EXUA 3T6RA 3I2DA 3O70A 2PNXA 3KV5A 2M85A 4UP5A 2CT2A 1JM7B 1WE9A 2CSVA 3PHDA 5AIUA 4FJCA 1VFYA 3MDBC 4QF2A 5KH9A 4AP4A 5AITA 1WEEA 3RTRB 2L43A 1T1HA 3PUQA 4S3OB 2MNZA 1LB6A 4W4UA 2YVRA 3SUBA 4I7DA 2Y1NA 2YQMA 4Q6FA 3ZYQA 4BHWA 4O1VA 3ZNIA 2QIZA 4R7EA 2H0DA 4YBTA 5FERA 2F1YA 1XWHA 4QQ4A 3H7HA 4A0CD 2KWOA 3HCTA 2ECGA 1CHCA 4ZDTA 5D1MB 4GWMA 2FSAA 4V3KC 2ECNA 4YC9A 3ZPVE 2P57A 4Z0RA 3EB5A 2LXHC 3FANA 1Z6UA 2B0OE 2OXQC 2LRIC 3DDTA 3ZVYA 2VP7A 2H0DB 1KZZA 4R8PK 1VD4A 3SOXA 2MD7B 1WENA 1WESA 4I7CA 2YT5A 3O33A 3SOUA 4LKAA 5D1LB 2JUNA 1K2FA 4YABA 5D1KB 3IHPA 2XB1A 3N9PA 2JRJA 4L58A 2RR4A 3O35A 4GNGA 2LQ6A 1LDJB 1WEVA 4AYCA 2CSYA 3FJUB 2L0BA 5LKUA 4GNFA 2VPBA 2HYED 3ZTGA 5TDWA 4FO9A 2EGPA 2YHOA 4L7XA 2FUUA 2FOPA 1N87A 2CKLA 2K16A 2CSZA 2MA6A 1WGMA 2LXPC 5TBNA 2ECVA 4R2YA 4AYCB 3LQIA 4IC2A 5B78A 4K8UA 3DWDA 2YSJA 3O37A 3O34A 2KGGA 2KU3A 4WZ2A 2MIQA 3JUEA 3MQSC 3HQMA 2XP0A 3N9QA 2G6QA 2D8UA 2K17A 4LLBA 2FOOA 2G45A 3HQIA 2K4DA 3HCSA 3KDEC 1WIMA 5G04B 2YURA 2XOYA 2JMJA 1DVPA 3HQLA 5JG6A 2QJ0A 1WILA 4CA1A 1WEQA 2L5UA 1MM3A 4ZUXU 4WZ0A 2M13A 4LJNA 1Z2QA 2MA5A 3KV6A 1HYJA 2F42A 5SVIA 3RPGC 5B77A 3MQRA 3HU6A 4YSIA 1F62A 4XI1A 5DINA 5EYAF 2E61A 3N9OA 3RPGB 4KG9A 5LKXA 4N3WA 2YREA 1F3VB 2GKWA 2M1RA 1FP0A 3HQHA 3GV4A 3M62A 4A49A 2F6JA 2JMDA 4PTBA 1ZMSA 2YU4A 3U5PA 4H9DA 1QSCA 1MM2A 2VNFA 5TRBA 3U5MA 4CCGX 3O47A 4Z0OA 2PUYA 4AUQB 2EODA 5FEYA 2LGKA 1U6GB 3HTKC 4F52B 2FUIA 1ZBDB 5SVXA 3HCUA 1G25A 5G05B 3EB6A 2KE1A 4ZQLA 4Z8MA 2E6SA 2LGVA 5B79A 2XOZA 5FB1A 3FAOA 1LB5A 3E2DA 1HYIA 1FBVA 2KFTA 3FL2A 5H9MA 3C5KA 2RSDA 2YW8A 2KIZA 2UZGA 2I50A 3O7AA 5B76A 4TKPB 4JJQA 2CR2A 2QICA 5H1TA 1Z60A 1CA4A 4A4BA 4IC3A 2KWJA 5LKZA 1CZZA 1DCQA 4A4CA 2DX8A 5DKAA 2F6NA 2Y1MA 1RF3A 3LRQA 4UP0A 1X4UA 3ZVZB 3QZVA 2Y43A 1E4UA 2YQLA 3VK6A 2YYRA 3C6WA 3SOWA 5C13A 3T7LA 3IVBA 3N9MA 2VPDA 2CKLB 2KGIA 2IQJA 2C2VS 3ZPV1 3Q1DA 1WFKA 2LAUA 3FEHA 4QF3A 2IDAA 4N4FA 4GHUA 2JMIA 2YHNA 2CRWA 1YZEA 1FLKA 2FD4A 3LQJA 4OGCA 4F1PA 2C2LA 2ECTA 4MSXA 3KQIA 2NAAA 5KH7A 3KNVA 2HDPA 3PURA 1WEPA 3V43A 2CRRA 2LGLA 5KH3A 1VYXA 4YBMA 4B86C 2OWAA 3T9KA 2XEUA 1BORA 3ASLA 3DPLR 2L80A 2DSMA 2F1ZA 4S3OC 4LADB 4V3LC 1D01A 5H1VA 3U5OA 2MNYA 4NN2A 1X4JA 3HSVA 2L7PA 5TDRA 2M3HA 2FOJA 1D00A 5G0FA 2FFWA 3M99A 3NG2A 3GL6A 2EA6A 5TABA 2JM3A 4BBQA 3MHSA 2LN0A 2KR4A 5SVIB 2MUMA 2K1JA 4MVTA 4P5OB 1D0AA 4GWNA 2LGGA 1X4IA 5B75A 5LKTA 1RMDA 1V87A 2MKEA 3IVQA 4C9ZA 2KWNA 3LVQE 4FIPA 1YY6A 2DJAA 2ZETC 3MHHA 4UI9B 2E6RA 5I3LA 1LDKC 3L11A 3L1XA 3FM8C 1WEMA 2CONA 1FLLA 2G43A 2BAYA 4WZ3B 2ECWA 2A25A 3LVRE 4O64A 5C11A 5LCWB 4YBSA 4M4EA 5SVYA 3U5NA 2YSMA 1LB4A 2F1XA 3N9NA 1MBMA 3IVVA 4FK5A 2KKXA 3DQVR 3L1ZB 4O62A 5FB0A 2KKYA 2VPEA
chains in the Genus database with same CATH topology
2MD8C 1WEOA 5B8DA 4GNDA 3N9LA 4WA6A 4PPEA 1CA9A 2ECIA 3M63A 1CZYA 1L0AA 5H1UA 2KYUA 2VPGA 3O36A 4X3GA 2RI7A 2F1WA 2YUCA 5E1TA 4YAXA 2D8SA 4AVXA 4GNEA 1WEWA 2VJEA 2VJFA 4YADA 2MT5A 3ZJBA 1D0JA 2LV9A 2ECJA 2KWKA 2M6MA 2AN6A 4YATA 2XXNA 3LQHA 1JM7A 4I7BA 4LK9A 1JOCA 2L75A 2KREA 1IYMA 2VJEB 2VJFB 5J3XA 4GJHA 3SHBA 4B7YC 1WEUA 4GB0A 2LDRA 3T6RA 3I2DA 3O70A 2PNXA 3KV5A 2M85A 4UP5A 2CT2A 1JM7B 1WE9A 3PHDA 5AIUA 4FJCA 1VFYA 4QF2A 5KH9A 4AP4A 5AITA 1WEEA 3RTRB 2L43A 1T1HA 3PUQA 4S3OB 2MNZA 1LB6A 4W4UA 4I7DA 2Y1NA 2YQMA 4Q6FA 3ZYQA 4BHWA 4O1VA 3ZNIA 2QIZA 4R7EA 2H0DA 4YBTA 5FERA 2F1YA 1XWHA 4A0CD 2KWOA 3HCTA 2ECGA 1CHCA 4ZDTA 5D1MB 4GWMA 2FSAA 4V3KC 2ECNA 4YC9A 3ZPVE 3EB5A 2LXHC 1Z6UA 2OXQC 2LRIC 3ZVYA 2VP7A 2H0DB 1KZZA 4R8PK 1VD4A 3SOXA 2MD7B 1WENA 1WESA 4I7CA 2YT5A 3O33A 3SOUA 4LKAA 5D1LB 1K2FA 4YABA 5D1KB 3IHPA 2XB1A 3N9PA 2JRJA 4L58A 3O35A 4GNGA 2LQ6A 1LDJB 1WEVA 4AYCA 2CSYA 2L0BA 5LKUA 4GNFA 2VPBA 2HYED 3ZTGA 5TDWA 4FO9A 2EGPA 2YHOA 4L7XA 2FUUA 2FOPA 1N87A 2CKLA 2K16A 2CSZA 2MA6A 1WGMA 2LXPC 5TBNA 2ECVA 4R2YA 4AYCB 3LQIA 4IC2A 5B78A 4K8UA 2YSJA 3O37A 3O34A 2KGGA 2KU3A 4WZ2A 2MIQA 3MQSC 3HQMA 3N9QA 2G6QA 2K17A 4LLBA 2FOOA 2G45A 3HQIA 2K4DA 3HCSA 1WIMA 5G04B 2YURA 2JMJA 1DVPA 3HQLA 5JG6A 2QJ0A 1WILA 4CA1A 1WEQA 2L5UA 1MM3A 4ZUXU 4WZ0A 4LJNA 1Z2QA 2MA5A 3KV6A 1HYJA 2F42A 3RPGC 5B77A 3MQRA 3HU6A 4YSIA 1F62A 4XI1A 5DINA 5EYAF 3N9OA 3RPGB 4KG9A 5LKXA 4N3WA 2YREA 1F3VB 2GKWA 2M1RA 1FP0A 3HQHA 3GV4A 3M62A 4A49A 2F6JA 2JMDA 4PTBA 1ZMSA 2YU4A 3U5PA 1QSCA 1MM2A 2VNFA 5TRBA 3U5MA 4CCGX 2PUYA 4AUQB 2EODA 5FEYA 2LGKA 1U6GB 3HTKC 4F52B 2FUIA 1ZBDB 3HCUA 1G25A 5G05B 3EB6A 2KE1A 4ZQLA 4Z8MA 2E6SA 2LGVA 5B79A 5FB1A 1LB5A 1HYIA 1FBVA 2KFTA 3FL2A 5H9MA 3C5KA 2RSDA 2YW8A 2KIZA 2UZGA 2I50A 3O7AA 5B76A 4TKPB 4JJQA 2CR2A 2QICA 5H1TA 1Z60A 1CA4A 4A4BA 4IC3A 2KWJA 5LKZA 1CZZA 4A4CA 2DX8A 5DKAA 2F6NA 2Y1MA 1RF3A 3LRQA 4UP0A 1X4UA 3ZVZB 3QZVA 2Y43A 1E4UA 2YQLA 3VK6A 2YYRA 3C6WA 3SOWA 5C13A 3T7LA 3IVBA 3N9MA 2VPDA 2CKLB 2KGIA 2C2VS 3ZPV1 1WFKA 4QF3A 2IDAA 4N4FA 4GHUA 2JMIA 2YHNA 1YZEA 1FLKA 3LQJA 2C2LA 2ECTA 4MSXA 3KQIA 2NAAA 5KH7A 3KNVA 2HDPA 3PURA 1WEPA 3V43A 2LGLA 5KH3A 1VYXA 4YBMA 4B86C 2XEUA 1BORA 3ASLA 3DPLR 2L80A 2F1ZA 4S3OC 4LADB 4V3LC 1D01A 5H1VA 3U5OA 2MNYA 4NN2A 1X4JA 3HSVA 5TDRA 2M3HA 2FOJA 1D00A 5G0FA 3M99A 3NG2A 3GL6A 2EA6A 5TABA 4BBQA 3MHSA 2LN0A 2KR4A 2MUMA 2K1JA 4MVTA 4P5OB 1D0AA 4GWNA 2LGGA 1X4IA 5B75A 5LKTA 1RMDA 1V87A 3IVQA 4C9ZA 2KWNA 4FIPA 1YY6A 2ZETC 3MHHA 4UI9B 2E6RA 5I3LA 1LDKC 3L11A 3L1XA 1WEMA 1FLLA 2G43A 2BAYA 4WZ3B 2ECWA 2A25A 4O64A 5C11A 5LCWB 4YBSA 4M4EA 3U5NA 2YSMA 1LB4A 2F1XA 3N9NA 3IVVA 4FK5A 3DQVR 3L1ZB 5FB0A 2VPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD8 C;  1WEO A;  5B8D A;  4GND A;  3N9L A;  4WA6 A;  4PPE A;  1CA9 A;  2ECI A;  3M63 A;  1CZY A;  1L0A A;  5H1U A;  2KYU A;  2VPG A;  3O36 A;  4X3G A;  2RI7 A;  2F1W A;  2YUC A;  5E1T A;  4YAX A;  2D8S A;  4AVX A;  4GNE A;  1WEW A;  2VJE A;  2VJF A;  4YAD A;  2MT5 A;  3ZJB A;  1D0J A;  2LV9 A;  2ECJ A;  2KWK A;  2M6M A;  2AN6 A;  4YAT A;  2XXN A;  3LQH A;  1JM7 A;  4I7B A;  4LK9 A;  1JOC A;  2L75 A;  2KRE A;  1IYM A;  2VJE B;  2VJF B;  5J3X A;  4GJH A;  3SHB A;  4B7Y C;  1WEU A;  4GB0 A;  2LDR A;  3T6R A;  3I2D A;  3O70 A;  2PNX A;  3KV5 A;  2M85 A;  4UP5 A;  2CT2 A;  1JM7 B;  1WE9 A;  3PHD A;  5AIU A;  4FJC A;  1VFY A;  4QF2 A;  5KH9 A;  4AP4 A;  5AIT A;  1WEE A;  3RTR B;  2L43 A;  1T1H A;  3PUQ A;  4S3O B;  2MNZ A;  1LB6 A;  4W4U A;  4I7D A;  2Y1N A;  2YQM A;  4Q6F A;  3ZYQ A;  4BHW A;  4O1V A;  3ZNI A;  2QIZ A;  4R7E A;  2H0D A;  4YBT A;  5FER A;  2F1Y A;  1XWH A;  4A0C D;  2KWO A;  3HCT A;  2ECG A;  1CHC A;  4ZDT A;  5D1M B;  4GWM A;  2FSA A;  4V3K C;  2ECN A;  4YC9 A;  3ZPV E;  3EB5 A;  2LXH C;  1Z6U A;  2OXQ C;  2LRI C;  3ZVY A;  2VP7 A;  2H0D B;  1KZZ A;  4R8P K;  1VD4 A;  3SOX A;  2MD7 B;  1WEN A;  1WES A;  4I7C A;  2YT5 A;  3O33 A;  3SOU A;  4LKA A;  5D1L B;  1K2F A;  4YAB A;  5D1K B;  3IHP A;  2XB1 A;  3N9P A;  2JRJ A;  4L58 A;  3O35 A;  4GNG A;  2LQ6 A;  1LDJ B;  1WEV A;  4AYC A;  2CSY A;  2L0B A;  5LKU A;  4GNF A;  2VPB A;  2HYE D;  3ZTG A;  5TDW A;  4FO9 A;  2EGP A;  2YHO A;  4L7X A;  2FUU A;  2FOP A;  1N87 A;  2CKL A;  2K16 A;  2CSZ A;  2MA6 A;  1WGM A;  2LXP C;  5TBN A;  2ECV A;  4R2Y A;  4AYC B;  3LQI A;  4IC2 A;  5B78 A;  4K8U A;  2YSJ A;  3O37 A;  3O34 A;  2KGG A;  2KU3 A;  4WZ2 A;  2MIQ A;  3MQS C;  3HQM A;  3N9Q A;  2G6Q A;  2K17 A;  4LLB A;  2FOO A;  2G45 A;  3HQI A;  2K4D A;  3HCS A;  1WIM A;  5G04 B;  2YUR A;  2JMJ A;  1DVP A;  3HQL A;  5JG6 A;  2QJ0 A;  1WIL A;  4CA1 A;  1WEQ A;  2L5U A;  1MM3 A;  4ZUX U;  4WZ0 A;  4LJN A;  1Z2Q A;  2MA5 A;  3KV6 A;  1HYJ A;  2F42 A;  3RPG C;  5B77 A;  3MQR A;  3HU6 A;  4YSI A;  1F62 A;  4XI1 A;  5DIN A;  5EYA F;  3N9O A;  3RPG B;  4KG9 A;  5LKX A;  4N3W A;  2YRE A;  1F3V B;  2GKW A;  2M1R A;  1FP0 A;  3HQH A;  3GV4 A;  3M62 A;  4A49 A;  2F6J A;  2JMD A;  4PTB A;  1ZMS A;  2YU4 A;  3U5P A;  1QSC A;  1MM2 A;  2VNF A;  5TRB A;  3U5M A;  4CCG X;  2PUY A;  4AUQ B;  2EOD A;  5FEY A;  2LGK A;  1U6G B;  3HTK C;  4F52 B;  2FUI A;  1ZBD B;  3HCU A;  1G25 A;  5G05 B;  3EB6 A;  2KE1 A;  4ZQL A;  4Z8M A;  2E6S A;  2LGV A;  5B79 A;  5FB1 A;  1LB5 A;  1HYI A;  1FBV A;  2KFT A;  3FL2 A;  5H9M A;  3C5K A;  2RSD A;  2YW8 A;  2KIZ A;  2UZG A;  2I50 A;  3O7A A;  5B76 A;  4TKP B;  4JJQ A;  2CR2 A;  2QIC A;  5H1T A;  1Z60 A;  1CA4 A;  4A4B A;  4IC3 A;  2KWJ A;  5LKZ A;  1CZZ A;  4A4C A;  2DX8 A;  5DKA A;  2F6N A;  2Y1M A;  1RF3 A;  3LRQ A;  4UP0 A;  1X4U A;  3ZVZ B;  3QZV A;  2Y43 A;  1E4U A;  2YQL A;  3VK6 A;  2YYR A;  3C6W A;  3SOW A;  5C13 A;  3T7L A;  3IVB A;  3N9M A;  2VPD A;  2CKL B;  2KGI A;  2C2V S;  3ZPV 1;  1WFK A;  4QF3 A;  2IDA A;  4N4F A;  4GHU A;  2JMI A;  2YHN A;  1YZE A;  1FLK A;  3LQJ A;  2C2L A;  2ECT A;  4MSX A;  3KQI A;  2NAA A;  5KH7 A;  3KNV A;  2HDP A;  3PUR A;  1WEP A;  3V43 A;  2LGL A;  5KH3 A;  1VYX A;  4YBM A;  4B86 C;  2XEU A;  1BOR A;  3ASL A;  3DPL R;  2L80 A;  2F1Z A;  4S3O C;  4LAD B;  4V3L C;  1D01 A;  5H1V A;  3U5O A;  2MNY A;  4NN2 A;  1X4J A;  3HSV A;  5TDR A;  2M3H A;  2FOJ A;  1D00 A;  5G0F A;  3M99 A;  3NG2 A;  3GL6 A;  2EA6 A;  5TAB A;  4BBQ A;  3MHS A;  2LN0 A;  2KR4 A;  2MUM A;  2K1J A;  4MVT A;  4P5O B;  1D0A A;  4GWN A;  2LGG A;  1X4I A;  5B75 A;  5LKT A;  1RMD A;  1V87 A;  3IVQ A;  4C9Z A;  2KWN A;  4FIP A;  1YY6 A;  2ZET C;  3MHH A;  4UI9 B;  2E6R A;  5I3L A;  1LDK C;  3L11 A;  3L1X A;  1WEM A;  1FLL A;  2G43 A;  2BAY A;  4WZ3 B;  2ECW A;  2A25 A;  4O64 A;  5C11 A;  5LCW B;  4YBS A;  4M4E A;  3U5N A;  2YSM A;  1LB4 A;  2F1X A;  3N9N A;  3IVV A;  4FK5 A;  3DQV R;  3L1Z B;  5FB0 A;  2VPE A; 
#chains in the Genus database with same CATH topology
 2MD8 C;  1WEO A;  5B8D A;  4GND A;  3N9L A;  4WA6 A;  4PPE A;  3LDY A;  1CA9 A;  2ECI A;  3M63 A;  1CZY A;  1L0A A;  5H1U A;  2KYU A;  2VPG A;  2XOC A;  3O36 A;  4X3G A;  2RI7 A;  2F1W A;  2YUC A;  5E1T A;  4YAX A;  3M7K A;  2D8S A;  4AVX A;  3LJU X;  4GNE A;  1WEW A;  2VJE A;  2VJF A;  4YAD A;  2MT5 A;  3ZJB A;  4OGE A;  1D0J A;  5K3Q A;  2LV9 A;  2ECJ A;  2KWK A;  2M6M A;  2AN6 A;  4YAT A;  2XXN A;  3LQH A;  1JM7 A;  2EGM A;  4I7B A;  4LK9 A;  1JOC A;  2L75 A;  2KRE A;  1IYM A;  2VJE B;  2VJF B;  5J3X A;  4GJH A;  3SHB A;  3PLW A;  4B7Y C;  1WEU A;  2LDR A;  4GB0 A;  2EXU A;  3T6R A;  3I2D A;  3O70 A;  2PNX A;  3KV5 A;  2M85 A;  4UP5 A;  2CT2 A;  1JM7 B;  1WE9 A;  2CSV A;  3PHD A;  5AIU A;  4FJC A;  1VFY A;  3MDB C;  4QF2 A;  5KH9 A;  4AP4 A;  5AIT A;  1WEE A;  3RTR B;  2L43 A;  1T1H A;  3PUQ A;  4S3O B;  2MNZ A;  1LB6 A;  4W4U A;  2YVR A;  3SUB A;  4I7D A;  2Y1N A;  2YQM A;  4Q6F A;  3ZYQ A;  4BHW A;  4O1V A;  3ZNI A;  2QIZ A;  4R7E A;  2H0D A;  4YBT A;  5FER A;  2F1Y A;  1XWH A;  4QQ4 A;  3H7H A;  4A0C D;  2KWO A;  3HCT A;  2ECG A;  1CHC A;  4ZDT A;  5D1M B;  4GWM A;  2FSA A;  4V3K C;  2ECN A;  4YC9 A;  3ZPV E;  2P57 A;  4Z0R A;  3EB5 A;  2LXH C;  3FAN A;  1Z6U A;  2B0O E;  2OXQ C;  2LRI C;  3DDT A;  3ZVY A;  2VP7 A;  2H0D B;  1KZZ A;  4R8P K;  1VD4 A;  3SOX A;  2MD7 B;  1WEN A;  1WES A;  4I7C A;  2YT5 A;  3O33 A;  3SOU A;  4LKA A;  5D1L B;  2JUN A;  1K2F A;  4YAB A;  5D1K B;  3IHP A;  2XB1 A;  3N9P A;  2JRJ A;  4L58 A;  2RR4 A;  3O35 A;  4GNG A;  2LQ6 A;  1LDJ B;  1WEV A;  4AYC A;  2CSY A;  3FJU B;  2L0B A;  5LKU A;  4GNF A;  2VPB A;  2HYE D;  3ZTG A;  5TDW A;  4FO9 A;  2EGP A;  2YHO A;  4L7X A;  2FUU A;  2FOP A;  1N87 A;  2CKL A;  2K16 A;  2CSZ A;  2MA6 A;  1WGM A;  2LXP C;  5TBN A;  2ECV A;  4R2Y A;  4AYC B;  3LQI A;  4IC2 A;  5B78 A;  4K8U A;  3DWD A;  2YSJ A;  3O37 A;  3O34 A;  2KGG A;  2KU3 A;  4WZ2 A;  2MIQ A;  3JUE A;  3MQS C;  3HQM A;  2XP0 A;  3N9Q A;  2G6Q A;  2D8U A;  2K17 A;  4LLB A;  2FOO A;  2G45 A;  3HQI A;  2K4D A;  3HCS A;  3KDE C;  1WIM A;  5G04 B;  2YUR A;  2XOY A;  2JMJ A;  1DVP A;  3HQL A;  5JG6 A;  2QJ0 A;  1WIL A;  4CA1 A;  1WEQ A;  2L5U A;  1MM3 A;  4ZUX U;  4WZ0 A;  2M13 A;  4LJN A;  1Z2Q A;  2MA5 A;  3KV6 A;  1HYJ A;  2F42 A;  5SVI A;  3RPG C;  5B77 A;  3MQR A;  3HU6 A;  4YSI A;  1F62 A;  4XI1 A;  5DIN A;  5EYA F;  2E61 A;  3N9O A;  3RPG B;  4KG9 A;  5LKX A;  4N3W A;  2YRE A;  1F3V B;  2GKW A;  2M1R A;  1FP0 A;  3HQH A;  3GV4 A;  3M62 A;  4A49 A;  2F6J A;  2JMD A;  4PTB A;  1ZMS A;  2YU4 A;  3U5P A;  4H9D A;  1QSC A;  1MM2 A;  2VNF A;  5TRB A;  3U5M A;  4CCG X;  3O47 A;  4Z0O A;  2PUY A;  4AUQ B;  2EOD A;  5FEY A;  2LGK A;  1U6G B;  3HTK C;  4F52 B;  2FUI A;  1ZBD B;  5SVX A;  3HCU A;  1G25 A;  5G05 B;  3EB6 A;  2KE1 A;  4ZQL A;  4Z8M A;  2E6S A;  2LGV A;  5B79 A;  2XOZ A;  5FB1 A;  3FAO A;  1LB5 A;  3E2D A;  1HYI A;  1FBV A;  2KFT A;  3FL2 A;  5H9M A;  3C5K A;  2RSD A;  2YW8 A;  2KIZ A;  2UZG A;  2I50 A;  3O7A A;  5B76 A;  4TKP B;  4JJQ A;  2CR2 A;  2QIC A;  5H1T A;  1Z60 A;  1CA4 A;  4A4B A;  4IC3 A;  2KWJ A;  5LKZ A;  1CZZ A;  1DCQ A;  4A4C A;  2DX8 A;  5DKA A;  2F6N A;  2Y1M A;  1RF3 A;  3LRQ A;  4UP0 A;  1X4U A;  3ZVZ B;  3QZV A;  2Y43 A;  1E4U A;  2YQL A;  3VK6 A;  2YYR A;  3C6W A;  3SOW A;  5C13 A;  3T7L A;  3IVB A;  3N9M A;  2VPD A;  2CKL B;  2KGI A;  2IQJ A;  2C2V S;  3ZPV 1;  3Q1D A;  1WFK A;  2LAU A;  3FEH A;  4QF3 A;  2IDA A;  4N4F A;  4GHU A;  2JMI A;  2YHN A;  2CRW A;  1YZE A;  1FLK A;  2FD4 A;  3LQJ A;  4OGC A;  4F1P A;  2C2L A;  2ECT A;  4MSX A;  3KQI A;  2NAA A;  5KH7 A;  3KNV A;  2HDP A;  3PUR A;  1WEP A;  3V43 A;  2CRR A;  2LGL A;  5KH3 A;  1VYX A;  4YBM A;  4B86 C;  2OWA A;  3T9K A;  2XEU A;  1BOR A;  3ASL A;  3DPL R;  2L80 A;  2DSM A;  2F1Z A;  4S3O C;  4LAD B;  4V3L C;  1D01 A;  5H1V A;  3U5O A;  2MNY A;  4NN2 A;  1X4J A;  3HSV A;  2L7P A;  5TDR A;  2M3H A;  2FOJ A;  1D00 A;  5G0F A;  2FFW A;  3M99 A;  3NG2 A;  3GL6 A;  2EA6 A;  5TAB A;  2JM3 A;  4BBQ A;  3MHS A;  2LN0 A;  2KR4 A;  5SVI B;  2MUM A;  2K1J A;  4MVT A;  4P5O B;  1D0A A;  4GWN A;  2LGG A;  1X4I A;  5B75 A;  5LKT A;  1RMD A;  1V87 A;  2MKE A;  3IVQ A;  4C9Z A;  2KWN A;  3LVQ E;  4FIP A;  1YY6 A;  2DJA A;  2ZET C;  3MHH A;  4UI9 B;  2E6R A;  5I3L A;  1LDK C;  3L11 A;  3L1X A;  3FM8 C;  1WEM A;  2CON A;  1FLL A;  2G43 A;  2BAY A;  4WZ3 B;  2ECW A;  2A25 A;  3LVR E;  4O64 A;  5C11 A;  5LCW B;  4YBS A;  4M4E A;  5SVY A;  3U5N A;  2YSM A;  1LB4 A;  2F1X A;  3N9N A;  1MBM A;  3IVV A;  4FK5 A;  2KKX A;  3DQV R;  3L1Z B;  4O62 A;  5FB0 A;  2KKY A;  2VPE A; 
#chains in the Genus database with same CATH homology
 2MD8 C;  1WEO A;  5B8D A;  4GND A;  3N9L A;  4WA6 A;  4PPE A;  1CA9 A;  2ECI A;  3M63 A;  1CZY A;  1L0A A;  5H1U A;  2KYU A;  2VPG A;  3O36 A;  4X3G A;  2RI7 A;  2F1W A;  2YUC A;  5E1T A;  4YAX A;  2D8S A;  4AVX A;  4GNE A;  1WEW A;  2VJE A;  2VJF A;  4YAD A;  2MT5 A;  3ZJB A;  1D0J A;  2LV9 A;  2ECJ A;  2KWK A;  2M6M A;  2AN6 A;  4YAT A;  2XXN A;  3LQH A;  1JM7 A;  4I7B A;  4LK9 A;  1JOC A;  2L75 A;  2KRE A;  1IYM A;  2VJE B;  2VJF B;  5J3X A;  4GJH A;  3SHB A;  4B7Y C;  1WEU A;  4GB0 A;  2LDR A;  3T6R A;  3I2D A;  3O70 A;  2PNX A;  3KV5 A;  2M85 A;  4UP5 A;  2CT2 A;  1JM7 B;  1WE9 A;  3PHD A;  5AIU A;  4FJC A;  1VFY A;  4QF2 A;  5KH9 A;  4AP4 A;  5AIT A;  1WEE A;  3RTR B;  2L43 A;  1T1H A;  3PUQ A;  4S3O B;  2MNZ A;  1LB6 A;  4W4U A;  4I7D A;  2Y1N A;  2YQM A;  4Q6F A;  3ZYQ A;  4BHW A;  4O1V A;  3ZNI A;  2QIZ A;  4R7E A;  2H0D A;  4YBT A;  5FER A;  2F1Y A;  1XWH A;  4A0C D;  2KWO A;  3HCT A;  2ECG A;  1CHC A;  4ZDT A;  5D1M B;  4GWM A;  2FSA A;  4V3K C;  2ECN A;  4YC9 A;  3ZPV E;  3EB5 A;  2LXH C;  1Z6U A;  2OXQ C;  2LRI C;  3ZVY A;  2VP7 A;  2H0D B;  1KZZ A;  4R8P K;  1VD4 A;  3SOX A;  2MD7 B;  1WEN A;  1WES A;  4I7C A;  2YT5 A;  3O33 A;  3SOU A;  4LKA A;  5D1L B;  1K2F A;  4YAB A;  5D1K B;  3IHP A;  2XB1 A;  3N9P A;  2JRJ A;  4L58 A;  3O35 A;  4GNG A;  2LQ6 A;  1LDJ B;  1WEV A;  4AYC A;  2CSY A;  2L0B A;  5LKU A;  4GNF A;  2VPB A;  2HYE D;  3ZTG A;  5TDW A;  4FO9 A;  2EGP A;  2YHO A;  4L7X A;  2FUU A;  2FOP A;  1N87 A;  2CKL A;  2K16 A;  2CSZ A;  2MA6 A;  1WGM A;  2LXP C;  5TBN A;  2ECV A;  4R2Y A;  4AYC B;  3LQI A;  4IC2 A;  5B78 A;  4K8U A;  2YSJ A;  3O37 A;  3O34 A;  2KGG A;  2KU3 A;  4WZ2 A;  2MIQ A;  3MQS C;  3HQM A;  3N9Q A;  2G6Q A;  2K17 A;  4LLB A;  2FOO A;  2G45 A;  3HQI A;  2K4D A;  3HCS A;  1WIM A;  5G04 B;  2YUR A;  2JMJ A;  1DVP A;  3HQL A;  5JG6 A;  2QJ0 A;  1WIL A;  4CA1 A;  1WEQ A;  2L5U A;  1MM3 A;  4ZUX U;  4WZ0 A;  4LJN A;  1Z2Q A;  2MA5 A;  3KV6 A;  1HYJ A;  2F42 A;  3RPG C;  5B77 A;  3MQR A;  3HU6 A;  4YSI A;  1F62 A;  4XI1 A;  5DIN A;  5EYA F;  3N9O A;  3RPG B;  4KG9 A;  5LKX A;  4N3W A;  2YRE A;  1F3V B;  2GKW A;  2M1R A;  1FP0 A;  3HQH A;  3GV4 A;  3M62 A;  4A49 A;  2F6J A;  2JMD A;  4PTB A;  1ZMS A;  2YU4 A;  3U5P A;  1QSC A;  1MM2 A;  2VNF A;  5TRB A;  3U5M A;  4CCG X;  2PUY A;  4AUQ B;  2EOD A;  5FEY A;  2LGK A;  1U6G B;  3HTK C;  4F52 B;  2FUI A;  1ZBD B;  3HCU A;  1G25 A;  5G05 B;  3EB6 A;  2KE1 A;  4ZQL A;  4Z8M A;  2E6S A;  2LGV A;  5B79 A;  5FB1 A;  1LB5 A;  1HYI A;  1FBV A;  2KFT A;  3FL2 A;  5H9M A;  3C5K A;  2RSD A;  2YW8 A;  2KIZ A;  2UZG A;  2I50 A;  3O7A A;  5B76 A;  4TKP B;  4JJQ A;  2CR2 A;  2QIC A;  5H1T A;  1Z60 A;  1CA4 A;  4A4B A;  4IC3 A;  2KWJ A;  5LKZ A;  1CZZ A;  4A4C A;  2DX8 A;  5DKA A;  2F6N A;  2Y1M A;  1RF3 A;  3LRQ A;  4UP0 A;  1X4U A;  3ZVZ B;  3QZV A;  2Y43 A;  1E4U A;  2YQL A;  3VK6 A;  2YYR A;  3C6W A;  3SOW A;  5C13 A;  3T7L A;  3IVB A;  3N9M A;  2VPD A;  2CKL B;  2KGI A;  2C2V S;  3ZPV 1;  1WFK A;  4QF3 A;  2IDA A;  4N4F A;  4GHU A;  2JMI A;  2YHN A;  1YZE A;  1FLK A;  3LQJ A;  2C2L A;  2ECT A;  4MSX A;  3KQI A;  2NAA A;  5KH7 A;  3KNV A;  2HDP A;  3PUR A;  1WEP A;  3V43 A;  2LGL A;  5KH3 A;  1VYX A;  4YBM A;  4B86 C;  2XEU A;  1BOR A;  3ASL A;  3DPL R;  2L80 A;  2F1Z A;  4S3O C;  4LAD B;  4V3L C;  1D01 A;  5H1V A;  3U5O A;  2MNY A;  4NN2 A;  1X4J A;  3HSV A;  5TDR A;  2M3H A;  2FOJ A;  1D00 A;  5G0F A;  3M99 A;  3NG2 A;  3GL6 A;  2EA6 A;  5TAB A;  4BBQ A;  3MHS A;  2LN0 A;  2KR4 A;  2MUM A;  2K1J A;  4MVT A;  4P5O B;  1D0A A;  4GWN A;  2LGG A;  1X4I A;  5B75 A;  5LKT A;  1RMD A;  1V87 A;  3IVQ A;  4C9Z A;  2KWN A;  4FIP A;  1YY6 A;  2ZET C;  3MHH A;  4UI9 B;  2E6R A;  5I3L A;  1LDK C;  3L11 A;  3L1X A;  1WEM A;  1FLL A;  2G43 A;  2BAY A;  4WZ3 B;  2ECW A;  2A25 A;  4O64 A;  5C11 A;  5LCW B;  4YBS A;  4M4E A;  3U5N A;  2YSM A;  1LB4 A;  2F1X A;  3N9N A;  3IVV A;  4FK5 A;  3DQV R;  3L1Z B;  5FB0 A;  2VPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...