4I7BA

Siah1 bound to synthetic peptide (ace)klrpv(aba)mvrptvr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
189
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords E3 ubiquitin-protein ligase SIAH1
total genus 36
structure length 189
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7bA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7bA01
4WA6A 4YBMA 1WGMA 4F52B 2VJEB 4GWMA 3LQHA 2JMIA 2VJFB 2FSAA 2MUMA 3KV6A 4BHWA 4CA1A 2XXNA 1ZMSA 2VJFA 3RPGB 3O37A 5KH7A 4LK9A 5AITA 5LKXA 2LGLA 1Z6UA 2KIZA 3IVVA 4WZ0A 2ECGA 3HQMA 2L0BA 4N4FA 4MVTA 3SHBA 1HYIA 2M1RA 2YYRA 5AIUA 3RPGC 2LXHC 3U5OA 1CA9A 4IC2A 3V43A 1N87A 4LKAA 1D00A 2LRIC 5G04B 4X3GA 1E4UA 1JOCA 2LXPC 4S3OB 1CHCA 5LKUA 2Y43A 2YSJA 4IC3A 1V87A 3ZJBA 5KH9A 3MHSA 5D1MB 5TABA 1WILA 4JJQA 2YUCA 3T7LA 5I3LA 1VFYA 2MD8C 3MQRA 2KGGA 4FO9A 2KE1A 4R8PK 2YQMA 2ECIA 1QSCA 4YAXA 2EA6A 2PUYA 5B8DA 1ZBDB 4YADA 1FP0A 5D1KB 2L5UA 4O64A 4UI9B 4GJHA 2KYUA 2VJEA 4B7YC 3HSVA 2FOOA 3RTRB 1F3VB 4UP5A 2YU4A 4WZ3B 2M3HA 5B78A 2MD7B 5LKTA 3IVBA 3MHHA 2F1XA 4V3LC 4Q6FA 3T6RA 2VPEA 2F1YA 2KWNA 5DKAA 4FK5A 2CKLB 2YURA 3U5MA 4FJCA 3ASLA 4GHUA 2YHNA 4PTBA 5FB0A 5B75A 4KG9A 2GKWA 4QF3A 1CA4A 3VK6A 4GB0A 2CSYA 1KZZA 1DVPA 1CZYA 4A49A 3LQJA 3HQLA 2LN0A 3N9NA 2MT5A 5H9MA 5EYAF 2FUIA 4N3WA 1K2FA 5H1TA 3SOUA 4ZQLA 2CSZA 1WE9A 2F6NA 2LGGA 1LB4A 3HQIA 2F1ZA 5G0FA 4YABA 1JM7B 3ZTGA 2NAAA 4GNEA 4YC9A 2HDPA 4V3KC 2MNZA 2DX8A 1RF3A 2M6MA 2LV9A 2ZETC 2XB1A 2QJ0A 2FUUA 4NN2A 2L80A 5TRBA 4A4CA 2VPDA 3L11A 3ZPV1 4AUQB 3M99A 2JMDA 3ZYQA 3M63A 1D0AA 4I7CA 5LCWB 1WEUA 3ZVZB 5E1TA 1LDJB 3M62A 2G45A 3HCSA 1RMDA 1WFKA 1G25A 2E6SA 2ECJA 3I2DA 4L58A 2MNYA 5B77A 1XWHA 2OXQC 4I7DA 1WEOA 2M85A 4MSXA 4UP0A 2F1WA 5H1UA 2C2LA 2LDRA 2K17A 4GNDA 1BORA 2C2VS 2BAYA 1LDKC 3GL6A 2ECNA 2A25A 4AP4A 4GNFA 2E6RA 2KREA 2VNFA 2H0DA 4TKPB 1L0AA 2L75A 1T1HA 5DINA 3ZNIA 3O35A 3HQHA 1LB6A 3GV4A 2H0DB 2KWKA 2ECVA 3L1ZB 2CR2A 1Z2QA 4R7EA 5TDRA 5B76A 1IYMA 2VPGA 2YT5A 1CZZA 2CKLA 1YY6A 4L7XA 2RI7A 3KQIA 2K16A 4YSIA 1X4UA 4A0CD 4PPEA 1FBVA 5FB1A 3KNVA 2F6JA 3SOXA 3N9MA 4Z8MA 2ECTA 3C5KA 2D8SA 4B86C 3O70A 3N9LA 4ZDTA 5J3XA 5B79A 4LADB 4S3OC 4M4EA 3O36A 3O33A 2QIZA 1JM7A 1Z60A 2Y1NA 5LKZA 3PUQA 4AVXA 2K4DA 5H1VA 4GWNA 1VD4A 3ZPVE 1WEEA 2XEUA 5G05B 2VP7A 2EGPA 2LGVA 5KH3A 4R2YA 3MQSC 4YBSA 1WESA 2KU3A 4C9ZA 5TBNA 1LB5A 2EODA 2QICA 1X4IA 1WEPA 1WEVA 3HCUA 4AYCB 4O1VA 3DPLR 3O34A 2AN6A 2MIQA 2IDAA 2YQLA 3HU6A 3ZVYA 4A4BA 3N9QA 2L43A 4AYCA 3U5NA 2JRJA 2KGIA 3N9PA 4P5OB 3PHDA 3PURA 3L1XA 4YBTA 2HYED 5FEYA 5C11A 3LQIA 2PNXA 4XI1A 5JG6A 1YZEA 5D1LB 1MM2A 1WEQA 1VYXA 3LRQA 4LLBA 4WZ2A 3IHPA 4W4UA 4ZUXU 2KWJA 3SOWA 3C6WA 2LQ6A 5C13A 2MA5A 2I50A 2VPBA 2LGKA 2KR4A 3FL2A 2RSDA 4QF2A 1D0JA 1WENA 1FLLA 4GNGA 3HCTA 3IVQA 3DQVR 5TDWA 4BBQA 1WEWA 1WEMA 2KFTA 4CCGX 2KWOA 4K8UA 3QZVA 2UZGA 2Y1MA 2JMJA 3U5PA 1F62A 3EB6A 3N9OA 2G43A 1HYJA 1X4JA 2MA6A 2YSMA 2FOJA 2ECWA 5FERA 3KV5A 2YREA 1WIMA 4I7BA 2G6QA 4LJNA 2YHOA 2FOPA 2YW8A 2CT2A 1D01A 1U6GB 2K1JA 3O7AA 4FIPA 3EB5A 4YATA 1MM3A 3HTKC 2F42A 1FLKA 3NG2A
chains in the Genus database with same CATH superfamily
3FANA 4WA6A 4YBMA 5SVYA 1WGMA 2FFWA 4F52B 2VJEB 4GWMA 3LQHA 2JMIA 2VJFB 2FSAA 2MUMA 3KV6A 4H9DA 4BHWA 4CA1A 2XXNA 1ZMSA 2VJFA 3RPGB 3O37A 5KH7A 4LK9A 5AITA 5LKXA 2LGLA 1Z6UA 2KIZA 3IVVA 4WZ0A 2ECGA 3HQMA 2L0BA 4N4FA 4MVTA 3SHBA 1HYIA 2M1RA 2YYRA 5AIUA 3RPGC 1MBMA 3FJUB 2LXHC 3U5OA 1CA9A 4IC2A 3V43A 1N87A 4LKAA 1D00A 2LRIC 5G04B 4X3GA 1E4UA 3SUBA 1JOCA 2LXPC 4S3OB 1CHCA 2CRWA 5LKUA 2Y43A 2YSJA 4IC3A 1V87A 3ZJBA 5KH9A 3MHSA 5D1MB 5TABA 1WILA 3DDTA 4JJQA 2YUCA 3T7LA 5I3LA 1VFYA 2MD8C 3MQRA 2KGGA 4FO9A 2KE1A 4O62A 4R8PK 2XOCA 3Q1DA 2YQMA 2ECIA 1QSCA 4YAXA 2EA6A 5K3QA 2PUYA 5B8DA 1ZBDB 4YADA 1FP0A 5D1KB 2L5UA 4O64A 4UI9B 4GJHA 2KYUA 2XOYA 2VJEA 4B7YC 3HSVA 2FOOA 3RTRB 1F3VB 4UP5A 2YU4A 4WZ3B 2M3HA 5B78A 2MD7B 5LKTA 3IVBA 3LDYA 3MHHA 2F1XA 4V3LC 4Q6FA 3T6RA 2VPEA 2F1YA 5SVIB 2KWNA 5DKAA 4FK5A 2CKLB 2YURA 3U5MA 4FJCA 3ASLA 4GHUA 2IQJA 2LAUA 2YHNA 4PTBA 5FB0A 5B75A 4KG9A 2GKWA 4QF3A 1CA4A 3VK6A 2KKYA 4GB0A 3KDEC 2CONA 2CSYA 1KZZA 1DVPA 2B0OE 1CZYA 4A49A 3LQJA 3HQLA 3MDBC 2LN0A 3N9NA 2MT5A 2D8UA 5H9MA 5EYAF 2FUIA 4N3WA 1K2FA 5H1TA 3SOUA 4ZQLA 2CSZA 2FD4A 3LVQE 1WE9A 2F6NA 2LGGA 3H7HA 1LB4A 3HQIA 2CRRA 2F1ZA 5G0FA 4YABA 1JM7B 3ZTGA 2NAAA 4GNEA 2HDPA 4YC9A 4V3KC 2MNZA 2DX8A 1RF3A 2M6MA 2LV9A 2ZETC 5SVXA 2XB1A 2QJ0A 2FUUA 4NN2A 1DCQA 2L80A 5TRBA 4A4CA 2VPDA 3L11A 3ZPV1 4AUQB 3M99A 2JMDA 3ZYQA 3M63A 2RR4A 1D0AA 4I7CA 5LCWB 1WEUA 3ZVZB 5E1TA 1LDJB 3M62A 2G45A 3HCSA 1RMDA 1WFKA 2DJAA 2L7PA 1G25A 2E6SA 2ECJA 3FEHA 3I2DA 3M7KA 4L58A 2MNYA 2YVRA 5B77A 1XWHA 2OXQC 4I7DA 1WEOA 2M85A 4MSXA 4UP0A 2F1WA 5H1UA 2C2LA 4F1PA 2LDRA 2K17A 4GNDA 1BORA 2C2VS 2BAYA 1LDKC 3GL6A 2ECNA 2A25A 4AP4A 4GNFA 2E6RA 2KREA 2VNFA 2H0DA 4TKPB 1L0AA 2L75A 1T1HA 5DINA 3ZNIA 3O35A 3HQHA 1LB6A 3GV4A 2H0DB 2KWKA 2ECVA 3L1ZB 2CR2A 1Z2QA 3LVRE 3O47A 4R7EA 5TDRA 5B76A 1IYMA 2VPGA 2YT5A 1CZZA 3LJUX 3DWDA 2CKLA 1YY6A 4L7XA 2RI7A 3KQIA 2K16A 4YSIA 1X4UA 4A0CD 3E2DA 4PPEA 1FBVA 5FB1A 3KNVA 2F6JA 3SOXA 3N9MA 4Z8MA 2ECTA 3C5KA 2D8SA 4B86C 2EXUA 2XOZA 3O70A 3N9LA 4ZDTA 5J3XA 5B79A 4LADB 4S3OC 4M4EA 3O36A 2JM3A 2QIZA 2DSMA 3O33A 1Z60A 1JM7A 2Y1NA 5LKZA 3PUQA 4AVXA 2K4DA 2JUNA 5H1VA 3PLWA 4GWNA 1VD4A 3ZPVE 1WEEA 2XEUA 2CSVA 5G05B 2VP7A 2EGPA 2LGVA 5KH3A 4R2YA 3MQSC 4YBSA 1WESA 2KU3A 2MKEA 4C9ZA 5TBNA 1LB5A 2EODA 2QICA 1X4IA 1WEPA 1WEVA 3HCUA 4AYCB 4O1VA 3DPLR 3O34A 2AN6A 2MIQA 2IDAA 2YQLA 3HU6A 3ZVYA 4A4BA 3N9QA 2L43A 4AYCA 3U5NA 2JRJA 2KGIA 3N9PA 4P5OB 4OGEA 4Z0RA 3PHDA 3PURA 3L1XA 4YBTA 2HYED 5FEYA 5C11A 3LQIA 2PNXA 4XI1A 5JG6A 1YZEA 5D1LB 1MM2A 1WEQA 3T9KA 1VYXA 3LRQA 4LLBA 4WZ2A 3IHPA 4W4UA 4ZUXU 2KWJA 3SOWA 3C6WA 2OWAA 2LQ6A 5C13A 2MA5A 2I50A 4Z0OA 2VPBA 3FAOA 2LGKA 2KR4A 3FL2A 2RSDA 4QF2A 1D0JA 2E61A 1WENA 1FLLA 4GNGA 3HCTA 3IVQA 3DQVR 5TDWA 4OGCA 2P57A 4BBQA 1WEWA 1WEMA 2KFTA 4CCGX 2KWOA 3QZVA 4K8UA 2XP0A 3FM8C 2KKXA 2UZGA 2Y1MA 2JMJA 3U5PA 1F62A 3EB6A 3N9OA 2G43A 1HYJA 1X4JA 2MA6A 2YSMA 2FOJA 2ECWA 5FERA 2EGMA 3KV5A 2YREA 1WIMA 4I7BA 2G6QA 4LJNA 2YHOA 2FOPA 2YW8A 2CT2A 1D01A 4QQ4A 1U6GB 2K1JA 3O7AA 3JUEA 4FIPA 3EB5A 5SVIA 4YATA 2M13A 1MM3A 3HTKC 2F42A 1FLKA 3NG2A
chains in the Genus database with same CATH topology
4WA6A 4YBMA 1WGMA 4F52B 2VJEB 4GWMA 3LQHA 2JMIA 2VJFB 2FSAA 2MUMA 3KV6A 4BHWA 4CA1A 2XXNA 1ZMSA 2VJFA 3RPGB 3O37A 5KH7A 4LK9A 5AITA 5LKXA 2LGLA 1Z6UA 2KIZA 3IVVA 4WZ0A 2ECGA 3HQMA 2L0BA 4N4FA 4MVTA 3SHBA 1HYIA 2M1RA 2YYRA 5AIUA 3RPGC 2LXHC 3U5OA 1CA9A 4IC2A 3V43A 1N87A 4LKAA 1D00A 2LRIC 5G04B 4X3GA 1E4UA 1JOCA 2LXPC 4S3OB 1CHCA 5LKUA 2Y43A 2YSJA 4IC3A 1V87A 3ZJBA 5KH9A 3MHSA 5D1MB 5TABA 1WILA 4JJQA 2YUCA 3T7LA 5I3LA 1VFYA 2MD8C 3MQRA 2KGGA 4FO9A 2KE1A 4R8PK 2YQMA 2ECIA 1QSCA 4YAXA 2EA6A 2PUYA 5B8DA 1ZBDB 4YADA 1FP0A 5D1KB 2L5UA 4O64A 4UI9B 4GJHA 2KYUA 2VJEA 4B7YC 3HSVA 2FOOA 3RTRB 1F3VB 4UP5A 2YU4A 4WZ3B 2M3HA 5B78A 2MD7B 5LKTA 3IVBA 3MHHA 2F1XA 4V3LC 4Q6FA 3T6RA 2VPEA 2F1YA 2KWNA 5DKAA 4FK5A 2CKLB 2YURA 3U5MA 4FJCA 3ASLA 4GHUA 2YHNA 4PTBA 5FB0A 5B75A 4KG9A 2GKWA 4QF3A 1CA4A 3VK6A 4GB0A 2CSYA 1KZZA 1DVPA 1CZYA 4A49A 3LQJA 3HQLA 2LN0A 3N9NA 2MT5A 5H9MA 5EYAF 2FUIA 4N3WA 1K2FA 5H1TA 3SOUA 4ZQLA 2CSZA 1WE9A 2F6NA 2LGGA 1LB4A 3HQIA 2F1ZA 5G0FA 4YABA 1JM7B 3ZTGA 2NAAA 4GNEA 4YC9A 2HDPA 4V3KC 2MNZA 2DX8A 1RF3A 2M6MA 2LV9A 2ZETC 2XB1A 2QJ0A 2FUUA 4NN2A 2L80A 5TRBA 4A4CA 2VPDA 3L11A 3ZPV1 4AUQB 3M99A 2JMDA 3ZYQA 3M63A 1D0AA 4I7CA 5LCWB 1WEUA 3ZVZB 5E1TA 1LDJB 3M62A 2G45A 3HCSA 1RMDA 1WFKA 1G25A 2E6SA 2ECJA 3I2DA 4L58A 2MNYA 5B77A 1XWHA 2OXQC 4I7DA 1WEOA 2M85A 4MSXA 4UP0A 2F1WA 5H1UA 2C2LA 2LDRA 2K17A 4GNDA 1BORA 2C2VS 2BAYA 1LDKC 3GL6A 2ECNA 2A25A 4AP4A 4GNFA 2E6RA 2KREA 2VNFA 2H0DA 4TKPB 1L0AA 2L75A 1T1HA 5DINA 3ZNIA 3O35A 3HQHA 1LB6A 3GV4A 2H0DB 2KWKA 2ECVA 3L1ZB 2CR2A 1Z2QA 4R7EA 5TDRA 5B76A 1IYMA 2VPGA 2YT5A 1CZZA 2CKLA 1YY6A 4L7XA 2RI7A 3KQIA 2K16A 4YSIA 1X4UA 4A0CD 4PPEA 1FBVA 5FB1A 3KNVA 2F6JA 3SOXA 3N9MA 4Z8MA 2ECTA 3C5KA 2D8SA 4B86C 3O70A 3N9LA 4ZDTA 5J3XA 5B79A 4LADB 4S3OC 4M4EA 3O36A 3O33A 2QIZA 1JM7A 1Z60A 2Y1NA 5LKZA 3PUQA 4AVXA 2K4DA 5H1VA 4GWNA 1VD4A 3ZPVE 1WEEA 2XEUA 5G05B 2VP7A 2EGPA 2LGVA 5KH3A 4R2YA 3MQSC 4YBSA 1WESA 2KU3A 4C9ZA 5TBNA 1LB5A 2EODA 2QICA 1X4IA 1WEPA 1WEVA 3HCUA 4AYCB 4O1VA 3DPLR 3O34A 2AN6A 2MIQA 2IDAA 2YQLA 3HU6A 3ZVYA 4A4BA 3N9QA 2L43A 4AYCA 3U5NA 2JRJA 2KGIA 3N9PA 4P5OB 3PHDA 3PURA 3L1XA 4YBTA 2HYED 5FEYA 5C11A 3LQIA 2PNXA 4XI1A 5JG6A 1YZEA 5D1LB 1MM2A 1WEQA 1VYXA 3LRQA 4LLBA 4WZ2A 3IHPA 4W4UA 4ZUXU 2KWJA 3SOWA 3C6WA 2LQ6A 5C13A 2MA5A 2I50A 2VPBA 2LGKA 2KR4A 3FL2A 2RSDA 4QF2A 1D0JA 1WENA 1FLLA 4GNGA 3HCTA 3IVQA 3DQVR 5TDWA 4BBQA 1WEWA 1WEMA 2KFTA 4CCGX 2KWOA 4K8UA 3QZVA 2UZGA 2Y1MA 2JMJA 3U5PA 1F62A 3EB6A 3N9OA 2G43A 1HYJA 1X4JA 2MA6A 2YSMA 2FOJA 2ECWA 5FERA 3KV5A 2YREA 1WIMA 4I7BA 2G6QA 4LJNA 2YHOA 2FOPA 2YW8A 2CT2A 1D01A 1U6GB 2K1JA 3O7AA 4FIPA 3EB5A 4YATA 1MM3A 3HTKC 2F42A 1FLKA 3NG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WA6 A;  4YBM A;  1WGM A;  4F52 B;  2VJE B;  4GWM A;  3LQH A;  2JMI A;  2VJF B;  2FSA A;  2MUM A;  3KV6 A;  4BHW A;  4CA1 A;  2XXN A;  1ZMS A;  2VJF A;  3RPG B;  3O37 A;  5KH7 A;  4LK9 A;  5AIT A;  5LKX A;  2LGL A;  1Z6U A;  2KIZ A;  3IVV A;  4WZ0 A;  2ECG A;  3HQM A;  2L0B A;  4N4F A;  4MVT A;  3SHB A;  1HYI A;  2M1R A;  2YYR A;  5AIU A;  3RPG C;  2LXH C;  3U5O A;  1CA9 A;  4IC2 A;  3V43 A;  1N87 A;  4LKA A;  1D00 A;  2LRI C;  5G04 B;  4X3G A;  1E4U A;  1JOC A;  2LXP C;  4S3O B;  1CHC A;  5LKU A;  2Y43 A;  2YSJ A;  4IC3 A;  1V87 A;  3ZJB A;  5KH9 A;  3MHS A;  5D1M B;  5TAB A;  1WIL A;  4JJQ A;  2YUC A;  3T7L A;  5I3L A;  1VFY A;  2MD8 C;  3MQR A;  2KGG A;  4FO9 A;  2KE1 A;  4R8P K;  2YQM A;  2ECI A;  1QSC A;  4YAX A;  2EA6 A;  2PUY A;  5B8D A;  1ZBD B;  4YAD A;  1FP0 A;  5D1K B;  2L5U A;  4O64 A;  4UI9 B;  4GJH A;  2KYU A;  2VJE A;  4B7Y C;  3HSV A;  2FOO A;  3RTR B;  1F3V B;  4UP5 A;  2YU4 A;  4WZ3 B;  2M3H A;  5B78 A;  2MD7 B;  5LKT A;  3IVB A;  3MHH A;  2F1X A;  4V3L C;  4Q6F A;  3T6R A;  2VPE A;  2F1Y A;  2KWN A;  5DKA A;  4FK5 A;  2CKL B;  2YUR A;  3U5M A;  4FJC A;  3ASL A;  4GHU A;  2YHN A;  4PTB A;  5FB0 A;  5B75 A;  4KG9 A;  2GKW A;  4QF3 A;  1CA4 A;  3VK6 A;  4GB0 A;  2CSY A;  1KZZ A;  1DVP A;  1CZY A;  4A49 A;  3LQJ A;  3HQL A;  2LN0 A;  3N9N A;  2MT5 A;  5H9M A;  5EYA F;  2FUI A;  4N3W A;  1K2F A;  5H1T A;  3SOU A;  4ZQL A;  2CSZ A;  1WE9 A;  2F6N A;  2LGG A;  1LB4 A;  3HQI A;  2F1Z A;  5G0F A;  4YAB A;  1JM7 B;  3ZTG A;  2NAA A;  4GNE A;  4YC9 A;  2HDP A;  4V3K C;  2MNZ A;  2DX8 A;  1RF3 A;  2M6M A;  2LV9 A;  2ZET C;  2XB1 A;  2QJ0 A;  2FUU A;  4NN2 A;  2L80 A;  5TRB A;  4A4C A;  2VPD A;  3L11 A;  3ZPV 1;  4AUQ B;  3M99 A;  2JMD A;  3ZYQ A;  3M63 A;  1D0A A;  4I7C A;  5LCW B;  1WEU A;  3ZVZ B;  5E1T A;  1LDJ B;  3M62 A;  2G45 A;  3HCS A;  1RMD A;  1WFK A;  1G25 A;  2E6S A;  2ECJ A;  3I2D A;  4L58 A;  2MNY A;  5B77 A;  1XWH A;  2OXQ C;  4I7D A;  1WEO A;  2M85 A;  4MSX A;  4UP0 A;  2F1W A;  5H1U A;  2C2L A;  2LDR A;  2K17 A;  4GND A;  1BOR A;  2C2V S;  2BAY A;  1LDK C;  3GL6 A;  2ECN A;  2A25 A;  4AP4 A;  4GNF A;  2E6R A;  2KRE A;  2VNF A;  2H0D A;  4TKP B;  1L0A A;  2L75 A;  1T1H A;  5DIN A;  3ZNI A;  3O35 A;  3HQH A;  1LB6 A;  3GV4 A;  2H0D B;  2KWK A;  2ECV A;  3L1Z B;  2CR2 A;  1Z2Q A;  4R7E A;  5TDR A;  5B76 A;  1IYM A;  2VPG A;  2YT5 A;  1CZZ A;  2CKL A;  1YY6 A;  4L7X A;  2RI7 A;  3KQI A;  2K16 A;  4YSI A;  1X4U A;  4A0C D;  4PPE A;  1FBV A;  5FB1 A;  3KNV A;  2F6J A;  3SOX A;  3N9M A;  4Z8M A;  2ECT A;  3C5K A;  2D8S A;  4B86 C;  3O70 A;  3N9L A;  4ZDT A;  5J3X A;  5B79 A;  4LAD B;  4S3O C;  4M4E A;  3O36 A;  3O33 A;  2QIZ A;  1JM7 A;  1Z60 A;  2Y1N A;  5LKZ A;  3PUQ A;  4AVX A;  2K4D A;  5H1V A;  4GWN A;  1VD4 A;  3ZPV E;  1WEE A;  2XEU A;  5G05 B;  2VP7 A;  2EGP A;  2LGV A;  5KH3 A;  4R2Y A;  3MQS C;  4YBS A;  1WES A;  2KU3 A;  4C9Z A;  5TBN A;  1LB5 A;  2EOD A;  2QIC A;  1X4I A;  1WEP A;  1WEV A;  3HCU A;  4AYC B;  4O1V A;  3DPL R;  3O34 A;  2AN6 A;  2MIQ A;  2IDA A;  2YQL A;  3HU6 A;  3ZVY A;  4A4B A;  3N9Q A;  2L43 A;  4AYC A;  3U5N A;  2JRJ A;  2KGI A;  3N9P A;  4P5O B;  3PHD A;  3PUR A;  3L1X A;  4YBT A;  2HYE D;  5FEY A;  5C11 A;  3LQI A;  2PNX A;  4XI1 A;  5JG6 A;  1YZE A;  5D1L B;  1MM2 A;  1WEQ A;  1VYX A;  3LRQ A;  4LLB A;  4WZ2 A;  3IHP A;  4W4U A;  4ZUX U;  2KWJ A;  3SOW A;  3C6W A;  2LQ6 A;  5C13 A;  2MA5 A;  2I50 A;  2VPB A;  2LGK A;  2KR4 A;  3FL2 A;  2RSD A;  4QF2 A;  1D0J A;  1WEN A;  1FLL A;  4GNG A;  3HCT A;  3IVQ A;  3DQV R;  5TDW A;  4BBQ A;  1WEW A;  1WEM A;  2KFT A;  4CCG X;  2KWO A;  4K8U A;  3QZV A;  2UZG A;  2Y1M A;  2JMJ A;  3U5P A;  1F62 A;  3EB6 A;  3N9O A;  2G43 A;  1HYJ A;  1X4J A;  2MA6 A;  2YSM A;  2FOJ A;  2ECW A;  5FER A;  3KV5 A;  2YRE A;  1WIM A;  4I7B A;  2G6Q A;  4LJN A;  2YHO A;  2FOP A;  2YW8 A;  2CT2 A;  1D01 A;  1U6G B;  2K1J A;  3O7A A;  4FIP A;  3EB5 A;  4YAT A;  1MM3 A;  3HTK C;  2F42 A;  1FLK A;  3NG2 A; 
#chains in the Genus database with same CATH topology
 3FAN A;  4WA6 A;  4YBM A;  5SVY A;  1WGM A;  2FFW A;  4F52 B;  2VJE B;  4GWM A;  3LQH A;  2JMI A;  2VJF B;  2FSA A;  2MUM A;  3KV6 A;  4H9D A;  4BHW A;  4CA1 A;  2XXN A;  1ZMS A;  2VJF A;  3RPG B;  3O37 A;  5KH7 A;  4LK9 A;  5AIT A;  5LKX A;  2LGL A;  1Z6U A;  2KIZ A;  3IVV A;  4WZ0 A;  2ECG A;  3HQM A;  2L0B A;  4N4F A;  4MVT A;  3SHB A;  1HYI A;  2M1R A;  2YYR A;  5AIU A;  3RPG C;  1MBM A;  3FJU B;  2LXH C;  3U5O A;  1CA9 A;  4IC2 A;  3V43 A;  1N87 A;  4LKA A;  1D00 A;  2LRI C;  5G04 B;  4X3G A;  1E4U A;  3SUB A;  1JOC A;  2LXP C;  4S3O B;  1CHC A;  2CRW A;  5LKU A;  2Y43 A;  2YSJ A;  4IC3 A;  1V87 A;  3ZJB A;  5KH9 A;  3MHS A;  5D1M B;  5TAB A;  1WIL A;  3DDT A;  4JJQ A;  2YUC A;  3T7L A;  5I3L A;  1VFY A;  2MD8 C;  3MQR A;  2KGG A;  4FO9 A;  2KE1 A;  4O62 A;  4R8P K;  2XOC A;  3Q1D A;  2YQM A;  2ECI A;  1QSC A;  4YAX A;  2EA6 A;  5K3Q A;  2PUY A;  5B8D A;  1ZBD B;  4YAD A;  1FP0 A;  5D1K B;  2L5U A;  4O64 A;  4UI9 B;  4GJH A;  2KYU A;  2XOY A;  2VJE A;  4B7Y C;  3HSV A;  2FOO A;  3RTR B;  1F3V B;  4UP5 A;  2YU4 A;  4WZ3 B;  2M3H A;  5B78 A;  2MD7 B;  5LKT A;  3IVB A;  3LDY A;  3MHH A;  2F1X A;  4V3L C;  4Q6F A;  3T6R A;  2VPE A;  2F1Y A;  5SVI B;  2KWN A;  5DKA A;  4FK5 A;  2CKL B;  2YUR A;  3U5M A;  4FJC A;  3ASL A;  4GHU A;  2IQJ A;  2LAU A;  2YHN A;  4PTB A;  5FB0 A;  5B75 A;  4KG9 A;  2GKW A;  4QF3 A;  1CA4 A;  3VK6 A;  2KKY A;  4GB0 A;  3KDE C;  2CON A;  2CSY A;  1KZZ A;  1DVP A;  2B0O E;  1CZY A;  4A49 A;  3LQJ A;  3HQL A;  3MDB C;  2LN0 A;  3N9N A;  2MT5 A;  2D8U A;  5H9M A;  5EYA F;  2FUI A;  4N3W A;  1K2F A;  5H1T A;  3SOU A;  4ZQL A;  2CSZ A;  2FD4 A;  3LVQ E;  1WE9 A;  2F6N A;  2LGG A;  3H7H A;  1LB4 A;  3HQI A;  2CRR A;  2F1Z A;  5G0F A;  4YAB A;  1JM7 B;  3ZTG A;  2NAA A;  4GNE A;  2HDP A;  4YC9 A;  4V3K C;  2MNZ A;  2DX8 A;  1RF3 A;  2M6M A;  2LV9 A;  2ZET C;  5SVX A;  2XB1 A;  2QJ0 A;  2FUU A;  4NN2 A;  1DCQ A;  2L80 A;  5TRB A;  4A4C A;  2VPD A;  3L11 A;  3ZPV 1;  4AUQ B;  3M99 A;  2JMD A;  3ZYQ A;  3M63 A;  2RR4 A;  1D0A A;  4I7C A;  5LCW B;  1WEU A;  3ZVZ B;  5E1T A;  1LDJ B;  3M62 A;  2G45 A;  3HCS A;  1RMD A;  1WFK A;  2DJA A;  2L7P A;  1G25 A;  2E6S A;  2ECJ A;  3FEH A;  3I2D A;  3M7K A;  4L58 A;  2MNY A;  2YVR A;  5B77 A;  1XWH A;  2OXQ C;  4I7D A;  1WEO A;  2M85 A;  4MSX A;  4UP0 A;  2F1W A;  5H1U A;  2C2L A;  4F1P A;  2LDR A;  2K17 A;  4GND A;  1BOR A;  2C2V S;  2BAY A;  1LDK C;  3GL6 A;  2ECN A;  2A25 A;  4AP4 A;  4GNF A;  2E6R A;  2KRE A;  2VNF A;  2H0D A;  4TKP B;  1L0A A;  2L75 A;  1T1H A;  5DIN A;  3ZNI A;  3O35 A;  3HQH A;  1LB6 A;  3GV4 A;  2H0D B;  2KWK A;  2ECV A;  3L1Z B;  2CR2 A;  1Z2Q A;  3LVR E;  3O47 A;  4R7E A;  5TDR A;  5B76 A;  1IYM A;  2VPG A;  2YT5 A;  1CZZ A;  3LJU X;  3DWD A;  2CKL A;  1YY6 A;  4L7X A;  2RI7 A;  3KQI A;  2K16 A;  4YSI A;  1X4U A;  4A0C D;  3E2D A;  4PPE A;  1FBV A;  5FB1 A;  3KNV A;  2F6J A;  3SOX A;  3N9M A;  4Z8M A;  2ECT A;  3C5K A;  2D8S A;  4B86 C;  2EXU A;  2XOZ A;  3O70 A;  3N9L A;  4ZDT A;  5J3X A;  5B79 A;  4LAD B;  4S3O C;  4M4E A;  3O36 A;  2JM3 A;  2QIZ A;  2DSM A;  3O33 A;  1Z60 A;  1JM7 A;  2Y1N A;  5LKZ A;  3PUQ A;  4AVX A;  2K4D A;  2JUN A;  5H1V A;  3PLW A;  4GWN A;  1VD4 A;  3ZPV E;  1WEE A;  2XEU A;  2CSV A;  5G05 B;  2VP7 A;  2EGP A;  2LGV A;  5KH3 A;  4R2Y A;  3MQS C;  4YBS A;  1WES A;  2KU3 A;  2MKE A;  4C9Z A;  5TBN A;  1LB5 A;  2EOD A;  2QIC A;  1X4I A;  1WEP A;  1WEV A;  3HCU A;  4AYC B;  4O1V A;  3DPL R;  3O34 A;  2AN6 A;  2MIQ A;  2IDA A;  2YQL A;  3HU6 A;  3ZVY A;  4A4B A;  3N9Q A;  2L43 A;  4AYC A;  3U5N A;  2JRJ A;  2KGI A;  3N9P A;  4P5O B;  4OGE A;  4Z0R A;  3PHD A;  3PUR A;  3L1X A;  4YBT A;  2HYE D;  5FEY A;  5C11 A;  3LQI A;  2PNX A;  4XI1 A;  5JG6 A;  1YZE A;  5D1L B;  1MM2 A;  1WEQ A;  3T9K A;  1VYX A;  3LRQ A;  4LLB A;  4WZ2 A;  3IHP A;  4W4U A;  4ZUX U;  2KWJ A;  3SOW A;  3C6W A;  2OWA A;  2LQ6 A;  5C13 A;  2MA5 A;  2I50 A;  4Z0O A;  2VPB A;  3FAO A;  2LGK A;  2KR4 A;  3FL2 A;  2RSD A;  4QF2 A;  1D0J A;  2E61 A;  1WEN A;  1FLL A;  4GNG A;  3HCT A;  3IVQ A;  3DQV R;  5TDW A;  4OGC A;  2P57 A;  4BBQ A;  1WEW A;  1WEM A;  2KFT A;  4CCG X;  2KWO A;  3QZV A;  4K8U A;  2XP0 A;  3FM8 C;  2KKX A;  2UZG A;  2Y1M A;  2JMJ A;  3U5P A;  1F62 A;  3EB6 A;  3N9O A;  2G43 A;  1HYJ A;  1X4J A;  2MA6 A;  2YSM A;  2FOJ A;  2ECW A;  5FER A;  2EGM A;  3KV5 A;  2YRE A;  1WIM A;  4I7B A;  2G6Q A;  4LJN A;  2YHO A;  2FOP A;  2YW8 A;  2CT2 A;  1D01 A;  4QQ4 A;  1U6G B;  2K1J A;  3O7A A;  3JUE A;  4FIP A;  3EB5 A;  5SVI A;  4YAT A;  2M13 A;  1MM3 A;  3HTK C;  2F42 A;  1FLK A;  3NG2 A; 
#chains in the Genus database with same CATH homology
 4WA6 A;  4YBM A;  1WGM A;  4F52 B;  2VJE B;  4GWM A;  3LQH A;  2JMI A;  2VJF B;  2FSA A;  2MUM A;  3KV6 A;  4BHW A;  4CA1 A;  2XXN A;  1ZMS A;  2VJF A;  3RPG B;  3O37 A;  5KH7 A;  4LK9 A;  5AIT A;  5LKX A;  2LGL A;  1Z6U A;  2KIZ A;  3IVV A;  4WZ0 A;  2ECG A;  3HQM A;  2L0B A;  4N4F A;  4MVT A;  3SHB A;  1HYI A;  2M1R A;  2YYR A;  5AIU A;  3RPG C;  2LXH C;  3U5O A;  1CA9 A;  4IC2 A;  3V43 A;  1N87 A;  4LKA A;  1D00 A;  2LRI C;  5G04 B;  4X3G A;  1E4U A;  1JOC A;  2LXP C;  4S3O B;  1CHC A;  5LKU A;  2Y43 A;  2YSJ A;  4IC3 A;  1V87 A;  3ZJB A;  5KH9 A;  3MHS A;  5D1M B;  5TAB A;  1WIL A;  4JJQ A;  2YUC A;  3T7L A;  5I3L A;  1VFY A;  2MD8 C;  3MQR A;  2KGG A;  4FO9 A;  2KE1 A;  4R8P K;  2YQM A;  2ECI A;  1QSC A;  4YAX A;  2EA6 A;  2PUY A;  5B8D A;  1ZBD B;  4YAD A;  1FP0 A;  5D1K B;  2L5U A;  4O64 A;  4UI9 B;  4GJH A;  2KYU A;  2VJE A;  4B7Y C;  3HSV A;  2FOO A;  3RTR B;  1F3V B;  4UP5 A;  2YU4 A;  4WZ3 B;  2M3H A;  5B78 A;  2MD7 B;  5LKT A;  3IVB A;  3MHH A;  2F1X A;  4V3L C;  4Q6F A;  3T6R A;  2VPE A;  2F1Y A;  2KWN A;  5DKA A;  4FK5 A;  2CKL B;  2YUR A;  3U5M A;  4FJC A;  3ASL A;  4GHU A;  2YHN A;  4PTB A;  5FB0 A;  5B75 A;  4KG9 A;  2GKW A;  4QF3 A;  1CA4 A;  3VK6 A;  4GB0 A;  2CSY A;  1KZZ A;  1DVP A;  1CZY A;  4A49 A;  3LQJ A;  3HQL A;  2LN0 A;  3N9N A;  2MT5 A;  5H9M A;  5EYA F;  2FUI A;  4N3W A;  1K2F A;  5H1T A;  3SOU A;  4ZQL A;  2CSZ A;  1WE9 A;  2F6N A;  2LGG A;  1LB4 A;  3HQI A;  2F1Z A;  5G0F A;  4YAB A;  1JM7 B;  3ZTG A;  2NAA A;  4GNE A;  4YC9 A;  2HDP A;  4V3K C;  2MNZ A;  2DX8 A;  1RF3 A;  2M6M A;  2LV9 A;  2ZET C;  2XB1 A;  2QJ0 A;  2FUU A;  4NN2 A;  2L80 A;  5TRB A;  4A4C A;  2VPD A;  3L11 A;  3ZPV 1;  4AUQ B;  3M99 A;  2JMD A;  3ZYQ A;  3M63 A;  1D0A A;  4I7C A;  5LCW B;  1WEU A;  3ZVZ B;  5E1T A;  1LDJ B;  3M62 A;  2G45 A;  3HCS A;  1RMD A;  1WFK A;  1G25 A;  2E6S A;  2ECJ A;  3I2D A;  4L58 A;  2MNY A;  5B77 A;  1XWH A;  2OXQ C;  4I7D A;  1WEO A;  2M85 A;  4MSX A;  4UP0 A;  2F1W A;  5H1U A;  2C2L A;  2LDR A;  2K17 A;  4GND A;  1BOR A;  2C2V S;  2BAY A;  1LDK C;  3GL6 A;  2ECN A;  2A25 A;  4AP4 A;  4GNF A;  2E6R A;  2KRE A;  2VNF A;  2H0D A;  4TKP B;  1L0A A;  2L75 A;  1T1H A;  5DIN A;  3ZNI A;  3O35 A;  3HQH A;  1LB6 A;  3GV4 A;  2H0D B;  2KWK A;  2ECV A;  3L1Z B;  2CR2 A;  1Z2Q A;  4R7E A;  5TDR A;  5B76 A;  1IYM A;  2VPG A;  2YT5 A;  1CZZ A;  2CKL A;  1YY6 A;  4L7X A;  2RI7 A;  3KQI A;  2K16 A;  4YSI A;  1X4U A;  4A0C D;  4PPE A;  1FBV A;  5FB1 A;  3KNV A;  2F6J A;  3SOX A;  3N9M A;  4Z8M A;  2ECT A;  3C5K A;  2D8S A;  4B86 C;  3O70 A;  3N9L A;  4ZDT A;  5J3X A;  5B79 A;  4LAD B;  4S3O C;  4M4E A;  3O36 A;  3O33 A;  2QIZ A;  1JM7 A;  1Z60 A;  2Y1N A;  5LKZ A;  3PUQ A;  4AVX A;  2K4D A;  5H1V A;  4GWN A;  1VD4 A;  3ZPV E;  1WEE A;  2XEU A;  5G05 B;  2VP7 A;  2EGP A;  2LGV A;  5KH3 A;  4R2Y A;  3MQS C;  4YBS A;  1WES A;  2KU3 A;  4C9Z A;  5TBN A;  1LB5 A;  2EOD A;  2QIC A;  1X4I A;  1WEP A;  1WEV A;  3HCU A;  4AYC B;  4O1V A;  3DPL R;  3O34 A;  2AN6 A;  2MIQ A;  2IDA A;  2YQL A;  3HU6 A;  3ZVY A;  4A4B A;  3N9Q A;  2L43 A;  4AYC A;  3U5N A;  2JRJ A;  2KGI A;  3N9P A;  4P5O B;  3PHD A;  3PUR A;  3L1X A;  4YBT A;  2HYE D;  5FEY A;  5C11 A;  3LQI A;  2PNX A;  4XI1 A;  5JG6 A;  1YZE A;  5D1L B;  1MM2 A;  1WEQ A;  1VYX A;  3LRQ A;  4LLB A;  4WZ2 A;  3IHP A;  4W4U A;  4ZUX U;  2KWJ A;  3SOW A;  3C6W A;  2LQ6 A;  5C13 A;  2MA5 A;  2I50 A;  2VPB A;  2LGK A;  2KR4 A;  3FL2 A;  2RSD A;  4QF2 A;  1D0J A;  1WEN A;  1FLL A;  4GNG A;  3HCT A;  3IVQ A;  3DQV R;  5TDW A;  4BBQ A;  1WEW A;  1WEM A;  2KFT A;  4CCG X;  2KWO A;  4K8U A;  3QZV A;  2UZG A;  2Y1M A;  2JMJ A;  3U5P A;  1F62 A;  3EB6 A;  3N9O A;  2G43 A;  1HYJ A;  1X4J A;  2MA6 A;  2YSM A;  2FOJ A;  2ECW A;  5FER A;  3KV5 A;  2YRE A;  1WIM A;  4I7B A;  2G6Q A;  4LJN A;  2YHO A;  2FOP A;  2YW8 A;  2CT2 A;  1D01 A;  1U6G B;  2K1J A;  3O7A A;  4FIP A;  3EB5 A;  4YAT A;  1MM3 A;  3HTK C;  2F42 A;  1FLK A;  3NG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...