4I7BA

Siah1 bound to synthetic peptide (ace)klrpv(aba)mvrptvr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
189
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
molecule keywords E3 ubiquitin-protein ligase SIAH1
total genus 36
structure length 189
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7bA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7bA01
1FLLA 3C6WA 4CCGX 3ASLA 3DPLR 2DX8A 2EODA 4LADB 3ZVZB 4LLBA 1JM7B 2F42A 4UI9B 5DKAA 3T6RA 3O7AA 3GL6A 1QSCA 5B8DA 4TKPB 1IYMA 2LXPC 4GWMA 2LGKA 3RTRB 2K16A 3N9NA 1WEEA 2VJFA 2YSJA 1G25A 2K1JA 5H1UA 1HYJA 1X4JA 1MM2A 4F52B 3KQIA 2E6SA 2OXQC 4B7YC 4I7CA 2MD8C 3SOUA 4R2YA 2Y1MA 5LCWB 2FSAA 4C9ZA 4GJHA 2XXNA 1VD4A 2VJEA 3I2DA 3PUQA 3O34A 4BBQA 3HQHA 2M6MA 5DINA 4PTBA 4M4EA 4JJQA 1BORA 2LN0A 4UP0A 3IHPA 2YT5A 2KWOA 5TABA 4IC2A 2A25A 1WESA 2Y1NA 4GNFA 2C2LA 2HDPA 5G04B 3HCTA 2MT5A 5KH3A 2LQ6A 2YHNA 3HCUA 4L58A 3U5OA 2YW8A 2KU3A 3FL2A 4N3WA 2RI7A 1WENA 2G6QA 4I7DA 4V3KC 5E1TA 5TDWA 5TBNA 2MUMA 1WEQA 4AVXA 2L0BA 3KV6A 2YYRA 4YATA 4AYCA 3RPGC 2UZGA 5H1TA 2XEUA 4UP5A 1CHCA 5G05B 2KFTA 2LGLA 1LB5A 4A0CD 4Z8MA 3O70A 4YC9A 2CKLB 2MNYA 3HTKC 1FP0A 3N9QA 5LKZA 5D1KB 2K17A 5LKXA 1N87A 2JMDA 2K4DA 1E4UA 3IVBA 4ZUXU 5LKUA 2LGGA 2KWKA 4YBMA 3HQMA 5D1MB 5TDRA 3L1XA 3SOWA 1X4IA 2FOPA 3O37A 2F1WA 3HSVA 1T1HA 4LJNA 4AP4A 5B78A 1JOCA 5AITA 3T7LA 5FEYA 1RMDA 2G45A 4P5OB 2AN6A 4YBTA 2MA5A 4KG9A 2VPDA 4ZQLA 3NG2A 4XI1A 1ZMSA 1LDJB 3LQIA 4YBSA 4S3OC 3ZTGA 1WEVA 2JRJA 2L80A 2CSYA 3SHBA 5AIUA 4WZ0A 3U5PA 3KV5A 4FJCA 3LQHA 2YURA 2LXHC 2EGPA 5JG6A 1WEOA 4LKAA 5H9MA 2G43A 2YQMA 2ECVA 2ZETC 2LDRA 4W4UA 4YAXA 2KYUA 3N9LA 1D0JA 3MQSC 1WEUA 1WILA 1FBVA 3ZJBA 4N4FA 3PHDA 1LB4A 1LDKC 2MA6A 2ECJA 2KWJA 3HCSA 2MNZA 2FOOA 3HQLA 4NN2A 1KZZA 2NAAA 4GNDA 3HU6A 4FIPA 4YSIA 2YU4A 3O36A 2YHOA 3IVVA 4A4BA 1U6GB 1L0AA 5J3XA 2H0DA 1D00A 3O33A 3MQRA 4LK9A 4O1VA 3IVQA 5G0FA 2MD7B 2YUCA 2JMIA 2ECTA 2FUIA 3L1ZB 4PPEA 1K2FA 1JM7A 1RF3A 3L11A 3ZYQA 2L5UA 4CA1A 3N9PA 3VK6A 2F6NA 2H0DB 3MHHA 5C11A 3N9OA 1WEMA 4WA6A 4BHWA 3RPGB 3LRQA 4I7BA 2VJEB 1VFYA 1CA9A 3LQJA 4O64A 2MIQA 3MHSA 3U5NA 4R7EA 2QJ0A 3N9MA 1CZZA 2ECIA 2YSMA 2HYED 3U5MA 4Q6FA 1X4UA 1WIMA 2KE1A 3EB6A 1Z60A 2KGIA 3ZPVE 4YADA 1XWHA 1CZYA 5B75A 2KREA 4WZ2A 2I50A 4GNGA 2ECGA 2GKWA 3QZVA 2LV9A 2KWNA 4GB0A 3EB5A 3DQVR 3HQIA 1YZEA 4V3LC 4AYCB 1Z6UA 2L75A 2RSDA 1DVPA 4R8PK 4FK5A 5LKTA 5KH7A 4AUQB 4GWNA 5EYAF 5B79A 4MSXA 5FB1A 2FOJA 1VYXA 4QF3A 1WEPA 1WGMA 3V43A 3M62A 2VJFB 2XB1A 3SOXA 2FUUA 1HYIA 2CKLA 3ZPV1 5I3LA 2F1XA 1WE9A 2BAYA 2Y43A 4YABA 2L43A 3GV4A 5TRBA 3M99A 3KNVA 2ECNA 4X3GA 2M85A 2JMJA 1ZBDB 2F1YA 1F3VB 4ZDTA 2D8SA 2CT2A 2KR4A 2CSZA 2VPEA 3ZNIA 4IC3A 1MM3A 2PUYA 5B77A 3C5KA 3O35A 2M3HA 2LGVA 5H1VA 4B86C 1WFKA 2KGGA 1V87A 1LB6A 4WZ3B 2VP7A 2PNXA 2EA6A 2QICA 3PURA 2F1ZA 2YQLA 1FLKA 2M1RA 1CA4A 4A4CA 1D0AA 5D1LB 2F6JA 2ECWA 4S3OB 2VPGA 4L7XA 4FO9A 4MVTA 5B76A 1Z2QA 1D01A 1YY6A 4QF2A 5FB0A 4K8UA 4GHUA 2LRIC 1WEWA 2YREA 5KH9A 2QIZA 4A49A 5C13A 1F62A 2E6RA 2VNFA 3M63A 4GNEA 2VPBA 5FERA 2IDAA 3ZVYA 2CR2A 2C2VS 2KIZA
chains in the Genus database with same CATH superfamily
1FLLA 2YVRA 3C6WA 4CCGX 3ASLA 3DPLR 2DX8A 2EODA 4LADB 3ZVZB 4LLBA 1JM7B 2F42A 4UI9B 5DKAA 3T6RA 3O7AA 3GL6A 1QSCA 5B8DA 4TKPB 1IYMA 2LXPC 4GWMA 2E61A 2LGKA 3RTRB 2K16A 3N9NA 1WEEA 2VJFA 2YSJA 1G25A 2K1JA 5H1UA 2OWAA 1HYJA 2P57A 1X4JA 3LDYA 1MM2A 4F52B 3KQIA 2E6SA 2OXQC 4B7YC 4I7CA 3PLWA 5K3QA 4Z0OA 2MD8C 3SOUA 4R2YA 2Y1MA 5LCWB 2FSAA 5SVIA 4C9ZA 4GJHA 2XXNA 1VD4A 2VJEA 3I2DA 3O47A 3PUQA 3O34A 4BBQA 3HQHA 2M6MA 5DINA 4PTBA 4M4EA 4JJQA 1BORA 2LN0A 4UP0A 3IHPA 2YT5A 3FAOA 2KWOA 5TABA 4IC2A 2A25A 1MBMA 1WESA 2XOYA 2Y1NA 4GNFA 2C2LA 3MDBC 2HDPA 5G04B 3HCTA 2MT5A 5KH3A 2LQ6A 2YHNA 2RR4A 3HCUA 4L58A 3U5OA 2YW8A 2KU3A 3FL2A 4F1PA 4N3WA 2RI7A 1WENA 2G6QA 2DJAA 4I7DA 4V3KC 5E1TA 5TDWA 5TBNA 2MUMA 1WEQA 4AVXA 2MKEA 2L0BA 3KV6A 2YYRA 4YATA 4AYCA 3RPGC 2XOCA 2JUNA 2UZGA 5H1TA 2KKXA 2XEUA 4UP5A 1CHCA 5G05B 2KFTA 2LGLA 1LB5A 3LVRE 4A0CD 4Z8MA 3O70A 4YC9A 2CKLB 2MNYA 3HTKC 1FP0A 3N9QA 5LKZA 5D1KB 2K17A 5LKXA 3FEHA 1N87A 2JMDA 2K4DA 1E4UA 3IVBA 4ZUXU 2CRRA 5LKUA 2LGGA 2KWKA 4YBMA 3HQMA 5D1MB 5TDRA 3L1XA 3SOWA 1X4IA 3Q1DA 2FOPA 3O37A 2F1WA 3HSVA 1T1HA 4LJNA 4AP4A 5B78A 1JOCA 5AITA 3T7LA 5FEYA 1RMDA 2G45A 4P5OB 2AN6A 4YBTA 2XOZA 2MA5A 4KG9A 2VPDA 4ZQLA 3NG2A 4XI1A 1ZMSA 1LDJB 2B0OE 3LQIA 3SUBA 4YBSA 4S3OC 3ZTGA 1WEVA 2JRJA 2L80A 2CSYA 3SHBA 5AIUA 4WZ0A 3U5PA 3KV5A 4FJCA 3LQHA 2M13A 2YURA 4H9DA 2LXHC 2EGPA 5JG6A 1WEOA 4LKAA 5H9MA 2G43A 2YQMA 5SVXA 2ECVA 2ZETC 2LDRA 4W4UA 4YAXA 3FANA 2KYUA 3N9LA 1D0JA 3MQSC 1WEUA 1WILA 1FBVA 3ZJBA 4N4FA 3PHDA 1LB4A 1LDKC 2MA6A 2ECJA 2KWJA 3HCSA 2MNZA 2FOOA 3HQLA 4NN2A 4O62A 3DDTA 2DSMA 1KZZA 2NAAA 4GNDA 3HU6A 4FIPA 4YSIA 2YU4A 3O36A 2YHOA 3IVVA 4A4BA 3M7KA 1U6GB 1L0AA 5J3XA 2H0DA 1D00A 3O33A 3MQRA 4LK9A 4O1VA 3IVQA 2KKYA 5G0FA 2FFWA 2MD7B 4OGEA 2YUCA 2JMIA 2JM3A 2ECTA 2FUIA 3L1ZB 4PPEA 1K2FA 3FM8C 1JM7A 1RF3A 3L11A 3ZYQA 2L5UA 4CA1A 3N9PA 3VK6A 3H7HA 2F6NA 2H0DB 3MHHA 5C11A 3DWDA 3N9OA 1WEMA 4WA6A 4BHWA 5SVIB 3RPGB 3LRQA 4I7BA 2VJEB 1VFYA 2L7PA 1CA9A 3LQJA 4O64A 2MIQA 3MHSA 3U5NA 4R7EA 2QJ0A 3N9MA 1CZZA 2ECIA 2YSMA 2HYED 3U5MA 4Q6FA 1X4UA 1WIMA 2KE1A 3EB6A 1Z60A 2KGIA 2FD4A 3ZPVE 4YADA 1XWHA 2LAUA 1CZYA 5B75A 2KREA 4WZ2A 2I50A 4GNGA 2ECGA 2EXUA 2GKWA 3QZVA 2LV9A 2CRWA 2KWNA 4GB0A 3JUEA 3EB5A 3DQVR 3E2DA 3HQIA 1YZEA 4V3LC 4AYCB 1Z6UA 2L75A 2RSDA 1DVPA 4R8PK 2IQJA 4FK5A 5LKTA 5KH7A 4AUQB 4GWNA 5EYAF 5B79A 4MSXA 5FB1A 2FOJA 1VYXA 4QQ4A 4QF3A 1WEPA 1WGMA 3V43A 3M62A 2VJFB 2XB1A 2XP0A 3SOXA 2FUUA 1HYIA 2CKLA 3ZPV1 3KDEC 5I3LA 2F1XA 1WE9A 2BAYA 2Y43A 4YABA 2L43A 3GV4A 3FJUB 5TRBA 3M99A 3KNVA 2CSVA 3LJUX 2ECNA 4X3GA 2M85A 2JMJA 3T9KA 1ZBDB 2F1YA 1F3VB 4ZDTA 2D8SA 2CT2A 2KR4A 2CSZA 2VPEA 3ZNIA 4IC3A 2CONA 1MM3A 2PUYA 3LVQE 5B77A 3C5KA 3O35A 2M3HA 2LGVA 5H1VA 4Z0RA 4B86C 1WFKA 2KGGA 1V87A 1LB6A 4WZ3B 2VP7A 2PNXA 2D8UA 2EA6A 2QICA 3PURA 2F1ZA 5SVYA 2YQLA 1FLKA 2M1RA 1CA4A 4A4CA 1D0AA 2F6JA 2ECWA 5D1LB 4S3OB 2VPGA 4L7XA 2EGMA 4FO9A 4MVTA 5B76A 1Z2QA 1D01A 1YY6A 4QF2A 5FB0A 4K8UA 4GHUA 2LRIC 1WEWA 2YREA 5KH9A 2QIZA 4A49A 5C13A 1F62A 2E6RA 2VNFA 3M63A 4GNEA 4OGCA 2VPBA 5FERA 2IDAA 3ZVYA 2CR2A 2C2VS 2KIZA 1DCQA
chains in the Genus database with same CATH topology
1FLLA 3C6WA 4CCGX 3ASLA 3DPLR 2DX8A 2EODA 4LADB 3ZVZB 4LLBA 1JM7B 2F42A 4UI9B 5DKAA 3T6RA 3O7AA 3GL6A 1QSCA 5B8DA 4TKPB 1IYMA 2LXPC 4GWMA 2LGKA 3RTRB 2K16A 3N9NA 1WEEA 2VJFA 2YSJA 1G25A 2K1JA 5H1UA 1HYJA 1X4JA 1MM2A 4F52B 3KQIA 2E6SA 2OXQC 4B7YC 4I7CA 2MD8C 3SOUA 4R2YA 2Y1MA 5LCWB 2FSAA 4C9ZA 4GJHA 2XXNA 1VD4A 2VJEA 3I2DA 3PUQA 3O34A 4BBQA 3HQHA 2M6MA 5DINA 4PTBA 4M4EA 4JJQA 1BORA 2LN0A 4UP0A 3IHPA 2YT5A 2KWOA 5TABA 4IC2A 2A25A 1WESA 2Y1NA 4GNFA 2C2LA 2HDPA 5G04B 3HCTA 2MT5A 5KH3A 2LQ6A 2YHNA 3HCUA 4L58A 3U5OA 2YW8A 2KU3A 3FL2A 4N3WA 2RI7A 1WENA 2G6QA 4I7DA 4V3KC 5E1TA 5TDWA 5TBNA 2MUMA 1WEQA 4AVXA 2L0BA 3KV6A 2YYRA 4YATA 4AYCA 3RPGC 2UZGA 5H1TA 2XEUA 4UP5A 1CHCA 5G05B 2KFTA 2LGLA 1LB5A 4A0CD 4Z8MA 3O70A 4YC9A 2CKLB 2MNYA 3HTKC 1FP0A 3N9QA 5LKZA 5D1KB 2K17A 5LKXA 1N87A 2JMDA 2K4DA 1E4UA 3IVBA 4ZUXU 5LKUA 2LGGA 2KWKA 4YBMA 3HQMA 5D1MB 5TDRA 3L1XA 3SOWA 1X4IA 2FOPA 3O37A 2F1WA 3HSVA 1T1HA 4LJNA 4AP4A 5B78A 1JOCA 5AITA 3T7LA 5FEYA 1RMDA 2G45A 4P5OB 2AN6A 4YBTA 2MA5A 4KG9A 2VPDA 4ZQLA 3NG2A 4XI1A 1ZMSA 1LDJB 3LQIA 4YBSA 4S3OC 3ZTGA 1WEVA 2JRJA 2L80A 2CSYA 3SHBA 5AIUA 4WZ0A 3U5PA 3KV5A 4FJCA 3LQHA 2YURA 2LXHC 2EGPA 5JG6A 1WEOA 4LKAA 5H9MA 2G43A 2YQMA 2ECVA 2ZETC 2LDRA 4W4UA 4YAXA 2KYUA 3N9LA 1D0JA 3MQSC 1WEUA 1WILA 1FBVA 3ZJBA 4N4FA 3PHDA 1LB4A 1LDKC 2MA6A 2ECJA 2KWJA 3HCSA 2MNZA 2FOOA 3HQLA 4NN2A 1KZZA 2NAAA 4GNDA 3HU6A 4FIPA 4YSIA 2YU4A 3O36A 2YHOA 3IVVA 4A4BA 1U6GB 1L0AA 5J3XA 2H0DA 1D00A 3O33A 3MQRA 4LK9A 4O1VA 3IVQA 5G0FA 2MD7B 2YUCA 2JMIA 2ECTA 2FUIA 3L1ZB 4PPEA 1K2FA 1JM7A 1RF3A 3L11A 3ZYQA 2L5UA 4CA1A 3N9PA 3VK6A 2F6NA 2H0DB 3MHHA 5C11A 3N9OA 1WEMA 4WA6A 4BHWA 3RPGB 3LRQA 4I7BA 2VJEB 1VFYA 1CA9A 3LQJA 4O64A 2MIQA 3MHSA 3U5NA 4R7EA 2QJ0A 3N9MA 1CZZA 2ECIA 2YSMA 2HYED 3U5MA 4Q6FA 1X4UA 1WIMA 2KE1A 3EB6A 1Z60A 2KGIA 3ZPVE 4YADA 1XWHA 1CZYA 5B75A 2KREA 4WZ2A 2I50A 4GNGA 2ECGA 2GKWA 3QZVA 2LV9A 2KWNA 4GB0A 3EB5A 3DQVR 3HQIA 1YZEA 4V3LC 4AYCB 1Z6UA 2L75A 2RSDA 1DVPA 4R8PK 4FK5A 5LKTA 5KH7A 4AUQB 4GWNA 5EYAF 5B79A 4MSXA 5FB1A 2FOJA 1VYXA 4QF3A 1WEPA 1WGMA 3V43A 3M62A 2VJFB 2XB1A 3SOXA 2FUUA 1HYIA 2CKLA 3ZPV1 5I3LA 2F1XA 1WE9A 2BAYA 2Y43A 4YABA 2L43A 3GV4A 5TRBA 3M99A 3KNVA 2ECNA 4X3GA 2M85A 2JMJA 1ZBDB 2F1YA 1F3VB 4ZDTA 2D8SA 2CT2A 2KR4A 2CSZA 2VPEA 3ZNIA 4IC3A 1MM3A 2PUYA 5B77A 3C5KA 3O35A 2M3HA 2LGVA 5H1VA 4B86C 1WFKA 2KGGA 1V87A 1LB6A 4WZ3B 2VP7A 2PNXA 2EA6A 2QICA 3PURA 2F1ZA 2YQLA 1FLKA 2M1RA 1CA4A 4A4CA 1D0AA 5D1LB 2F6JA 2ECWA 4S3OB 2VPGA 4L7XA 4FO9A 4MVTA 5B76A 1Z2QA 1D01A 1YY6A 4QF2A 5FB0A 4K8UA 4GHUA 2LRIC 1WEWA 2YREA 5KH9A 2QIZA 4A49A 5C13A 1F62A 2E6RA 2VNFA 3M63A 4GNEA 2VPBA 5FERA 2IDAA 3ZVYA 2CR2A 2C2VS 2KIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FLL A;  3C6W A;  4CCG X;  3ASL A;  3DPL R;  2DX8 A;  2EOD A;  4LAD B;  3ZVZ B;  4LLB A;  1JM7 B;  2F42 A;  4UI9 B;  5DKA A;  3T6R A;  3O7A A;  3GL6 A;  1QSC A;  5B8D A;  4TKP B;  1IYM A;  2LXP C;  4GWM A;  2LGK A;  3RTR B;  2K16 A;  3N9N A;  1WEE A;  2VJF A;  2YSJ A;  1G25 A;  2K1J A;  5H1U A;  1HYJ A;  1X4J A;  1MM2 A;  4F52 B;  3KQI A;  2E6S A;  2OXQ C;  4B7Y C;  4I7C A;  2MD8 C;  3SOU A;  4R2Y A;  2Y1M A;  5LCW B;  2FSA A;  4C9Z A;  4GJH A;  2XXN A;  1VD4 A;  2VJE A;  3I2D A;  3PUQ A;  3O34 A;  4BBQ A;  3HQH A;  2M6M A;  5DIN A;  4PTB A;  4M4E A;  4JJQ A;  1BOR A;  2LN0 A;  4UP0 A;  3IHP A;  2YT5 A;  2KWO A;  5TAB A;  4IC2 A;  2A25 A;  1WES A;  2Y1N A;  4GNF A;  2C2L A;  2HDP A;  5G04 B;  3HCT A;  2MT5 A;  5KH3 A;  2LQ6 A;  2YHN A;  3HCU A;  4L58 A;  3U5O A;  2YW8 A;  2KU3 A;  3FL2 A;  4N3W A;  2RI7 A;  1WEN A;  2G6Q A;  4I7D A;  4V3K C;  5E1T A;  5TDW A;  5TBN A;  2MUM A;  1WEQ A;  4AVX A;  2L0B A;  3KV6 A;  2YYR A;  4YAT A;  4AYC A;  3RPG C;  2UZG A;  5H1T A;  2XEU A;  4UP5 A;  1CHC A;  5G05 B;  2KFT A;  2LGL A;  1LB5 A;  4A0C D;  4Z8M A;  3O70 A;  4YC9 A;  2CKL B;  2MNY A;  3HTK C;  1FP0 A;  3N9Q A;  5LKZ A;  5D1K B;  2K17 A;  5LKX A;  1N87 A;  2JMD A;  2K4D A;  1E4U A;  3IVB A;  4ZUX U;  5LKU A;  2LGG A;  2KWK A;  4YBM A;  3HQM A;  5D1M B;  5TDR A;  3L1X A;  3SOW A;  1X4I A;  2FOP A;  3O37 A;  2F1W A;  3HSV A;  1T1H A;  4LJN A;  4AP4 A;  5B78 A;  1JOC A;  5AIT A;  3T7L A;  5FEY A;  1RMD A;  2G45 A;  4P5O B;  2AN6 A;  4YBT A;  2MA5 A;  4KG9 A;  2VPD A;  4ZQL A;  3NG2 A;  4XI1 A;  1ZMS A;  1LDJ B;  3LQI A;  4YBS A;  4S3O C;  3ZTG A;  1WEV A;  2JRJ A;  2L80 A;  2CSY A;  3SHB A;  5AIU A;  4WZ0 A;  3U5P A;  3KV5 A;  4FJC A;  3LQH A;  2YUR A;  2LXH C;  2EGP A;  5JG6 A;  1WEO A;  4LKA A;  5H9M A;  2G43 A;  2YQM A;  2ECV A;  2ZET C;  2LDR A;  4W4U A;  4YAX A;  2KYU A;  3N9L A;  1D0J A;  3MQS C;  1WEU A;  1WIL A;  1FBV A;  3ZJB A;  4N4F A;  3PHD A;  1LB4 A;  1LDK C;  2MA6 A;  2ECJ A;  2KWJ A;  3HCS A;  2MNZ A;  2FOO A;  3HQL A;  4NN2 A;  1KZZ A;  2NAA A;  4GND A;  3HU6 A;  4FIP A;  4YSI A;  2YU4 A;  3O36 A;  2YHO A;  3IVV A;  4A4B A;  1U6G B;  1L0A A;  5J3X A;  2H0D A;  1D00 A;  3O33 A;  3MQR A;  4LK9 A;  4O1V A;  3IVQ A;  5G0F A;  2MD7 B;  2YUC A;  2JMI A;  2ECT A;  2FUI A;  3L1Z B;  4PPE A;  1K2F A;  1JM7 A;  1RF3 A;  3L11 A;  3ZYQ A;  2L5U A;  4CA1 A;  3N9P A;  3VK6 A;  2F6N A;  2H0D B;  3MHH A;  5C11 A;  3N9O A;  1WEM A;  4WA6 A;  4BHW A;  3RPG B;  3LRQ A;  4I7B A;  2VJE B;  1VFY A;  1CA9 A;  3LQJ A;  4O64 A;  2MIQ A;  3MHS A;  3U5N A;  4R7E A;  2QJ0 A;  3N9M A;  1CZZ A;  2ECI A;  2YSM A;  2HYE D;  3U5M A;  4Q6F A;  1X4U A;  1WIM A;  2KE1 A;  3EB6 A;  1Z60 A;  2KGI A;  3ZPV E;  4YAD A;  1XWH A;  1CZY A;  5B75 A;  2KRE A;  4WZ2 A;  2I50 A;  4GNG A;  2ECG A;  2GKW A;  3QZV A;  2LV9 A;  2KWN A;  4GB0 A;  3EB5 A;  3DQV R;  3HQI A;  1YZE A;  4V3L C;  4AYC B;  1Z6U A;  2L75 A;  2RSD A;  1DVP A;  4R8P K;  4FK5 A;  5LKT A;  5KH7 A;  4AUQ B;  4GWN A;  5EYA F;  5B79 A;  4MSX A;  5FB1 A;  2FOJ A;  1VYX A;  4QF3 A;  1WEP A;  1WGM A;  3V43 A;  3M62 A;  2VJF B;  2XB1 A;  3SOX A;  2FUU A;  1HYI A;  2CKL A;  3ZPV 1;  5I3L A;  2F1X A;  1WE9 A;  2BAY A;  2Y43 A;  4YAB A;  2L43 A;  3GV4 A;  5TRB A;  3M99 A;  3KNV A;  2ECN A;  4X3G A;  2M85 A;  2JMJ A;  1ZBD B;  2F1Y A;  1F3V B;  4ZDT A;  2D8S A;  2CT2 A;  2KR4 A;  2CSZ A;  2VPE A;  3ZNI A;  4IC3 A;  1MM3 A;  2PUY A;  5B77 A;  3C5K A;  3O35 A;  2M3H A;  2LGV A;  5H1V A;  4B86 C;  1WFK A;  2KGG A;  1V87 A;  1LB6 A;  4WZ3 B;  2VP7 A;  2PNX A;  2EA6 A;  2QIC A;  3PUR A;  2F1Z A;  2YQL A;  1FLK A;  2M1R A;  1CA4 A;  4A4C A;  1D0A A;  5D1L B;  2F6J A;  2ECW A;  4S3O B;  2VPG A;  4L7X A;  4FO9 A;  4MVT A;  5B76 A;  1Z2Q A;  1D01 A;  1YY6 A;  4QF2 A;  5FB0 A;  4K8U A;  4GHU A;  2LRI C;  1WEW A;  2YRE A;  5KH9 A;  2QIZ A;  4A49 A;  5C13 A;  1F62 A;  2E6R A;  2VNF A;  3M63 A;  4GNE A;  2VPB A;  5FER A;  2IDA A;  3ZVY A;  2CR2 A;  2C2V S;  2KIZ A; 
#chains in the Genus database with same CATH topology
 1FLL A;  2YVR A;  3C6W A;  4CCG X;  3ASL A;  3DPL R;  2DX8 A;  2EOD A;  4LAD B;  3ZVZ B;  4LLB A;  1JM7 B;  2F42 A;  4UI9 B;  5DKA A;  3T6R A;  3O7A A;  3GL6 A;  1QSC A;  5B8D A;  4TKP B;  1IYM A;  2LXP C;  4GWM A;  2E61 A;  2LGK A;  3RTR B;  2K16 A;  3N9N A;  1WEE A;  2VJF A;  2YSJ A;  1G25 A;  2K1J A;  5H1U A;  2OWA A;  1HYJ A;  2P57 A;  1X4J A;  3LDY A;  1MM2 A;  4F52 B;  3KQI A;  2E6S A;  2OXQ C;  4B7Y C;  4I7C A;  3PLW A;  5K3Q A;  4Z0O A;  2MD8 C;  3SOU A;  4R2Y A;  2Y1M A;  5LCW B;  2FSA A;  5SVI A;  4C9Z A;  4GJH A;  2XXN A;  1VD4 A;  2VJE A;  3I2D A;  3O47 A;  3PUQ A;  3O34 A;  4BBQ A;  3HQH A;  2M6M A;  5DIN A;  4PTB A;  4M4E A;  4JJQ A;  1BOR A;  2LN0 A;  4UP0 A;  3IHP A;  2YT5 A;  3FAO A;  2KWO A;  5TAB A;  4IC2 A;  2A25 A;  1MBM A;  1WES A;  2XOY A;  2Y1N A;  4GNF A;  2C2L A;  3MDB C;  2HDP A;  5G04 B;  3HCT A;  2MT5 A;  5KH3 A;  2LQ6 A;  2YHN A;  2RR4 A;  3HCU A;  4L58 A;  3U5O A;  2YW8 A;  2KU3 A;  3FL2 A;  4F1P A;  4N3W A;  2RI7 A;  1WEN A;  2G6Q A;  2DJA A;  4I7D A;  4V3K C;  5E1T A;  5TDW A;  5TBN A;  2MUM A;  1WEQ A;  4AVX A;  2MKE A;  2L0B A;  3KV6 A;  2YYR A;  4YAT A;  4AYC A;  3RPG C;  2XOC A;  2JUN A;  2UZG A;  5H1T A;  2KKX A;  2XEU A;  4UP5 A;  1CHC A;  5G05 B;  2KFT A;  2LGL A;  1LB5 A;  3LVR E;  4A0C D;  4Z8M A;  3O70 A;  4YC9 A;  2CKL B;  2MNY A;  3HTK C;  1FP0 A;  3N9Q A;  5LKZ A;  5D1K B;  2K17 A;  5LKX A;  3FEH A;  1N87 A;  2JMD A;  2K4D A;  1E4U A;  3IVB A;  4ZUX U;  2CRR A;  5LKU A;  2LGG A;  2KWK A;  4YBM A;  3HQM A;  5D1M B;  5TDR A;  3L1X A;  3SOW A;  1X4I A;  3Q1D A;  2FOP A;  3O37 A;  2F1W A;  3HSV A;  1T1H A;  4LJN A;  4AP4 A;  5B78 A;  1JOC A;  5AIT A;  3T7L A;  5FEY A;  1RMD A;  2G45 A;  4P5O B;  2AN6 A;  4YBT A;  2XOZ A;  2MA5 A;  4KG9 A;  2VPD A;  4ZQL A;  3NG2 A;  4XI1 A;  1ZMS A;  1LDJ B;  2B0O E;  3LQI A;  3SUB A;  4YBS A;  4S3O C;  3ZTG A;  1WEV A;  2JRJ A;  2L80 A;  2CSY A;  3SHB A;  5AIU A;  4WZ0 A;  3U5P A;  3KV5 A;  4FJC A;  3LQH A;  2M13 A;  2YUR A;  4H9D A;  2LXH C;  2EGP A;  5JG6 A;  1WEO A;  4LKA A;  5H9M A;  2G43 A;  2YQM A;  5SVX A;  2ECV A;  2ZET C;  2LDR A;  4W4U A;  4YAX A;  3FAN A;  2KYU A;  3N9L A;  1D0J A;  3MQS C;  1WEU A;  1WIL A;  1FBV A;  3ZJB A;  4N4F A;  3PHD A;  1LB4 A;  1LDK C;  2MA6 A;  2ECJ A;  2KWJ A;  3HCS A;  2MNZ A;  2FOO A;  3HQL A;  4NN2 A;  4O62 A;  3DDT A;  2DSM A;  1KZZ A;  2NAA A;  4GND A;  3HU6 A;  4FIP A;  4YSI A;  2YU4 A;  3O36 A;  2YHO A;  3IVV A;  4A4B A;  3M7K A;  1U6G B;  1L0A A;  5J3X A;  2H0D A;  1D00 A;  3O33 A;  3MQR A;  4LK9 A;  4O1V A;  3IVQ A;  2KKY A;  5G0F A;  2FFW A;  2MD7 B;  4OGE A;  2YUC A;  2JMI A;  2JM3 A;  2ECT A;  2FUI A;  3L1Z B;  4PPE A;  1K2F A;  3FM8 C;  1JM7 A;  1RF3 A;  3L11 A;  3ZYQ A;  2L5U A;  4CA1 A;  3N9P A;  3VK6 A;  3H7H A;  2F6N A;  2H0D B;  3MHH A;  5C11 A;  3DWD A;  3N9O A;  1WEM A;  4WA6 A;  4BHW A;  5SVI B;  3RPG B;  3LRQ A;  4I7B A;  2VJE B;  1VFY A;  2L7P A;  1CA9 A;  3LQJ A;  4O64 A;  2MIQ A;  3MHS A;  3U5N A;  4R7E A;  2QJ0 A;  3N9M A;  1CZZ A;  2ECI A;  2YSM A;  2HYE D;  3U5M A;  4Q6F A;  1X4U A;  1WIM A;  2KE1 A;  3EB6 A;  1Z60 A;  2KGI A;  2FD4 A;  3ZPV E;  4YAD A;  1XWH A;  2LAU A;  1CZY A;  5B75 A;  2KRE A;  4WZ2 A;  2I50 A;  4GNG A;  2ECG A;  2EXU A;  2GKW A;  3QZV A;  2LV9 A;  2CRW A;  2KWN A;  4GB0 A;  3JUE A;  3EB5 A;  3DQV R;  3E2D A;  3HQI A;  1YZE A;  4V3L C;  4AYC B;  1Z6U A;  2L75 A;  2RSD A;  1DVP A;  4R8P K;  2IQJ A;  4FK5 A;  5LKT A;  5KH7 A;  4AUQ B;  4GWN A;  5EYA F;  5B79 A;  4MSX A;  5FB1 A;  2FOJ A;  1VYX A;  4QQ4 A;  4QF3 A;  1WEP A;  1WGM A;  3V43 A;  3M62 A;  2VJF B;  2XB1 A;  2XP0 A;  3SOX A;  2FUU A;  1HYI A;  2CKL A;  3ZPV 1;  3KDE C;  5I3L A;  2F1X A;  1WE9 A;  2BAY A;  2Y43 A;  4YAB A;  2L43 A;  3GV4 A;  3FJU B;  5TRB A;  3M99 A;  3KNV A;  2CSV A;  3LJU X;  2ECN A;  4X3G A;  2M85 A;  2JMJ A;  3T9K A;  1ZBD B;  2F1Y A;  1F3V B;  4ZDT A;  2D8S A;  2CT2 A;  2KR4 A;  2CSZ A;  2VPE A;  3ZNI A;  4IC3 A;  2CON A;  1MM3 A;  2PUY A;  3LVQ E;  5B77 A;  3C5K A;  3O35 A;  2M3H A;  2LGV A;  5H1V A;  4Z0R A;  4B86 C;  1WFK A;  2KGG A;  1V87 A;  1LB6 A;  4WZ3 B;  2VP7 A;  2PNX A;  2D8U A;  2EA6 A;  2QIC A;  3PUR A;  2F1Z A;  5SVY A;  2YQL A;  1FLK A;  2M1R A;  1CA4 A;  4A4C A;  1D0A A;  2F6J A;  2ECW A;  5D1L B;  4S3O B;  2VPG A;  4L7X A;  2EGM A;  4FO9 A;  4MVT A;  5B76 A;  1Z2Q A;  1D01 A;  1YY6 A;  4QF2 A;  5FB0 A;  4K8U A;  4GHU A;  2LRI C;  1WEW A;  2YRE A;  5KH9 A;  2QIZ A;  4A49 A;  5C13 A;  1F62 A;  2E6R A;  2VNF A;  3M63 A;  4GNE A;  4OGC A;  2VPB A;  5FER A;  2IDA A;  3ZVY A;  2CR2 A;  2C2V S;  2KIZ A;  1DCQ A; 
#chains in the Genus database with same CATH homology
 1FLL A;  3C6W A;  4CCG X;  3ASL A;  3DPL R;  2DX8 A;  2EOD A;  4LAD B;  3ZVZ B;  4LLB A;  1JM7 B;  2F42 A;  4UI9 B;  5DKA A;  3T6R A;  3O7A A;  3GL6 A;  1QSC A;  5B8D A;  4TKP B;  1IYM A;  2LXP C;  4GWM A;  2LGK A;  3RTR B;  2K16 A;  3N9N A;  1WEE A;  2VJF A;  2YSJ A;  1G25 A;  2K1J A;  5H1U A;  1HYJ A;  1X4J A;  1MM2 A;  4F52 B;  3KQI A;  2E6S A;  2OXQ C;  4B7Y C;  4I7C A;  2MD8 C;  3SOU A;  4R2Y A;  2Y1M A;  5LCW B;  2FSA A;  4C9Z A;  4GJH A;  2XXN A;  1VD4 A;  2VJE A;  3I2D A;  3PUQ A;  3O34 A;  4BBQ A;  3HQH A;  2M6M A;  5DIN A;  4PTB A;  4M4E A;  4JJQ A;  1BOR A;  2LN0 A;  4UP0 A;  3IHP A;  2YT5 A;  2KWO A;  5TAB A;  4IC2 A;  2A25 A;  1WES A;  2Y1N A;  4GNF A;  2C2L A;  2HDP A;  5G04 B;  3HCT A;  2MT5 A;  5KH3 A;  2LQ6 A;  2YHN A;  3HCU A;  4L58 A;  3U5O A;  2YW8 A;  2KU3 A;  3FL2 A;  4N3W A;  2RI7 A;  1WEN A;  2G6Q A;  4I7D A;  4V3K C;  5E1T A;  5TDW A;  5TBN A;  2MUM A;  1WEQ A;  4AVX A;  2L0B A;  3KV6 A;  2YYR A;  4YAT A;  4AYC A;  3RPG C;  2UZG A;  5H1T A;  2XEU A;  4UP5 A;  1CHC A;  5G05 B;  2KFT A;  2LGL A;  1LB5 A;  4A0C D;  4Z8M A;  3O70 A;  4YC9 A;  2CKL B;  2MNY A;  3HTK C;  1FP0 A;  3N9Q A;  5LKZ A;  5D1K B;  2K17 A;  5LKX A;  1N87 A;  2JMD A;  2K4D A;  1E4U A;  3IVB A;  4ZUX U;  5LKU A;  2LGG A;  2KWK A;  4YBM A;  3HQM A;  5D1M B;  5TDR A;  3L1X A;  3SOW A;  1X4I A;  2FOP A;  3O37 A;  2F1W A;  3HSV A;  1T1H A;  4LJN A;  4AP4 A;  5B78 A;  1JOC A;  5AIT A;  3T7L A;  5FEY A;  1RMD A;  2G45 A;  4P5O B;  2AN6 A;  4YBT A;  2MA5 A;  4KG9 A;  2VPD A;  4ZQL A;  3NG2 A;  4XI1 A;  1ZMS A;  1LDJ B;  3LQI A;  4YBS A;  4S3O C;  3ZTG A;  1WEV A;  2JRJ A;  2L80 A;  2CSY A;  3SHB A;  5AIU A;  4WZ0 A;  3U5P A;  3KV5 A;  4FJC A;  3LQH A;  2YUR A;  2LXH C;  2EGP A;  5JG6 A;  1WEO A;  4LKA A;  5H9M A;  2G43 A;  2YQM A;  2ECV A;  2ZET C;  2LDR A;  4W4U A;  4YAX A;  2KYU A;  3N9L A;  1D0J A;  3MQS C;  1WEU A;  1WIL A;  1FBV A;  3ZJB A;  4N4F A;  3PHD A;  1LB4 A;  1LDK C;  2MA6 A;  2ECJ A;  2KWJ A;  3HCS A;  2MNZ A;  2FOO A;  3HQL A;  4NN2 A;  1KZZ A;  2NAA A;  4GND A;  3HU6 A;  4FIP A;  4YSI A;  2YU4 A;  3O36 A;  2YHO A;  3IVV A;  4A4B A;  1U6G B;  1L0A A;  5J3X A;  2H0D A;  1D00 A;  3O33 A;  3MQR A;  4LK9 A;  4O1V A;  3IVQ A;  5G0F A;  2MD7 B;  2YUC A;  2JMI A;  2ECT A;  2FUI A;  3L1Z B;  4PPE A;  1K2F A;  1JM7 A;  1RF3 A;  3L11 A;  3ZYQ A;  2L5U A;  4CA1 A;  3N9P A;  3VK6 A;  2F6N A;  2H0D B;  3MHH A;  5C11 A;  3N9O A;  1WEM A;  4WA6 A;  4BHW A;  3RPG B;  3LRQ A;  4I7B A;  2VJE B;  1VFY A;  1CA9 A;  3LQJ A;  4O64 A;  2MIQ A;  3MHS A;  3U5N A;  4R7E A;  2QJ0 A;  3N9M A;  1CZZ A;  2ECI A;  2YSM A;  2HYE D;  3U5M A;  4Q6F A;  1X4U A;  1WIM A;  2KE1 A;  3EB6 A;  1Z60 A;  2KGI A;  3ZPV E;  4YAD A;  1XWH A;  1CZY A;  5B75 A;  2KRE A;  4WZ2 A;  2I50 A;  4GNG A;  2ECG A;  2GKW A;  3QZV A;  2LV9 A;  2KWN A;  4GB0 A;  3EB5 A;  3DQV R;  3HQI A;  1YZE A;  4V3L C;  4AYC B;  1Z6U A;  2L75 A;  2RSD A;  1DVP A;  4R8P K;  4FK5 A;  5LKT A;  5KH7 A;  4AUQ B;  4GWN A;  5EYA F;  5B79 A;  4MSX A;  5FB1 A;  2FOJ A;  1VYX A;  4QF3 A;  1WEP A;  1WGM A;  3V43 A;  3M62 A;  2VJF B;  2XB1 A;  3SOX A;  2FUU A;  1HYI A;  2CKL A;  3ZPV 1;  5I3L A;  2F1X A;  1WE9 A;  2BAY A;  2Y43 A;  4YAB A;  2L43 A;  3GV4 A;  5TRB A;  3M99 A;  3KNV A;  2ECN A;  4X3G A;  2M85 A;  2JMJ A;  1ZBD B;  2F1Y A;  1F3V B;  4ZDT A;  2D8S A;  2CT2 A;  2KR4 A;  2CSZ A;  2VPE A;  3ZNI A;  4IC3 A;  1MM3 A;  2PUY A;  5B77 A;  3C5K A;  3O35 A;  2M3H A;  2LGV A;  5H1V A;  4B86 C;  1WFK A;  2KGG A;  1V87 A;  1LB6 A;  4WZ3 B;  2VP7 A;  2PNX A;  2EA6 A;  2QIC A;  3PUR A;  2F1Z A;  2YQL A;  1FLK A;  2M1R A;  1CA4 A;  4A4C A;  1D0A A;  5D1L B;  2F6J A;  2ECW A;  4S3O B;  2VPG A;  4L7X A;  4FO9 A;  4MVT A;  5B76 A;  1Z2Q A;  1D01 A;  1YY6 A;  4QF2 A;  5FB0 A;  4K8U A;  4GHU A;  2LRI C;  1WEW A;  2YRE A;  5KH9 A;  2QIZ A;  4A49 A;  5C13 A;  1F62 A;  2E6R A;  2VNF A;  3M63 A;  4GNE A;  2VPB A;  5FER A;  2IDA A;  3ZVY A;  2CR2 A;  2C2V S;  2KIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...