4I7BA

Siah1 bound to synthetic peptide (ace)klrpv(aba)mvrptvr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
192
structure length
189
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SIAH1
publication title Structure-based design of covalent siah inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 36
structure length 189
sequence length 192
chains with identical sequence C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4i7bA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4i7bA01
3MQSC 3KQIA 2LGVA 4A4BA 2VJFA 3ZPVE 4WZ3B 1CA9A 1D01A 2YSJA 4XI1A 5D1LB 4LLBA 3ZNIA 1FLLA 3M99A 2C2VS 2F6JA 5B8DA 4AYCB 1WE9A 3MHSA 2FOPA 1JM7B 2LRIC 1LDJB 2CKLB 1N87A 4K8UA 1LB6A 2RI7A 4LJNA 3HQHA 1T1HA 2F1YA 5H1UA 2EODA 5AIUA 2KGIA 1WEWA 2IDAA 3PHDA 2CR2A 3V43A 5G05B 4ZDTA 2JRJA 2XXNA 1D0AA 1ZBDB 2F1XA 4AUQB 5FEYA 2RSDA 3O33A 5TRBA 1L0AA 2VJEA 1WEVA 2KREA 3O7AA 4YC9A 4AVXA 2FUUA 1MM3A 2KIZA 3FL2A 5H1VA 4AYCA 2F42A 2F6NA 5B78A 4N4FA 4PTBA 1F3VB 2H0DA 2LXPC 1WFKA 2QJ0A 2YREA 4B7YC 3T7LA 3O36A 5AITA 3T6RA 3O35A 2JMJA 3EB6A 4L58A 2NAAA 2YSMA 1WESA 4NN2A 1WIMA 4GNFA 4LADB 4WZ2A 2Y43A 3ZJBA 2ECTA 2LN0A 2L43A 2QICA 3HCTA 4QF3A 3HCUA 2M85A 4B86C 1V87A 2ECJA 2L0BA 4YBMA 1FBVA 3SHBA 2E6SA 3U5NA 2KFTA 4V3KC 1D0JA 2DX8A 2MUMA 4X3GA 2K4DA 2VNFA 2HDPA 3HU6A 4YSIA 1X4JA 4YAXA 1WENA 3HQIA 2XEUA 1LB5A 2FUIA 2YU4A 2G45A 4AP4A 4L7XA 4A0CD 3DQVR 4S3OB 2A25A 3U5PA 2K17A 3VK6A 5J3XA 3LQHA 3IVQA 2CT2A 3HSVA 4GB0A 5FB1A 5B75A 5FB0A 2ECVA 2ZETC 1MM2A 1CHCA 4LK9A 2MNZA 2MIQA 5TDRA 5KH3A 4Z8MA 3HTKC 5G04B 3GL6A 4O64A 3O34A 4YBTA 3M62A 4GWMA 2KR4A 5TDWA 2E6RA 3HCSA 5TBNA 5C11A 1DVPA 2LQ6A 2YW8A 2EA6A 4WZ0A 3I2DA 3EB5A 4ZUXU 3SOXA 1K2FA 5H9MA 4O1VA 5TABA 5LKTA 1WEPA 3O37A 2YQMA 5KH9A 1RMDA 2VPGA 4CCGX 4I7BA 1JOCA 3N9MA 4V3LC 4BHWA 3IVBA 1JM7A 2M3HA 3RPGB 2CKLA 5C13A 3HQMA 2K1JA 1CA4A 1WEQA 5DINA 2JMIA 2KWNA 5G0FA 4LKAA 3U5OA 1WGMA 4FK5A 4WA6A 1LDKC 4R8PK 1U6GB 2JMDA 3N9NA 3DPLR 4JJQA 1FLKA 2LGKA 4GJHA 5B79A 2KWJA 1VFYA 4MVTA 2I50A 3SOWA 4P5OB 2FOOA 2MT5A 5E1TA 4IC3A 3ASLA 1WILA 1X4IA 1X4UA 3GV4A 2MD7B 1LB4A 5D1KB 1ZMSA 2C2LA 2VPDA 3HQLA 2ECGA 4W4UA 2F1WA 4A49A 2FSAA 2VPEA 2MNYA 5H1TA 3LQJA 2KWKA 5FERA 4UP0A 2UZGA 2YQLA 5JG6A 4KG9A 1G25A 4GNEA 2LV9A 2MA5A 3PURA 4FJCA 4ZQLA 1YY6A 2XB1A 3MHHA 1WEEA 1Z60A 5LKZA 1WEMA 3QZVA 4N3WA 5B77A 2FOJA 4BBQA 4GNDA 2M1RA 2CSYA 3PUQA 2ECWA 4S3OC 1KZZA 2VJEB 2VP7A 2YURA 5LKUA 1BORA 3M63A 3ZVYA 2D8SA 5I3LA 1WEUA 4FIPA 2G6QA 4QF2A 1VD4A 2KE1A 4GWNA 2YYRA 1Z2QA 3ZPV1 4CA1A 2EGPA 2H0DB 4YBSA 1QSCA 4UP5A 2M6MA 2LDRA 1CZZA 2KU3A 2L75A 1VYXA 2YHOA 4FO9A 3L1ZB 2GKWA 3NG2A 2F1ZA 3L1XA 4R7EA 5B76A 2YUCA 2BAYA 4TKPB 2LGLA 1E4UA 5D1MB 4R2YA 3IHPA 2OXQC 4I7DA 4C9ZA 2G43A 5KH7A 3MQRA 1HYIA 3KNVA 2K16A 3C5KA 3ZTGA 4YABA 2VPBA 2KYUA 5EYAF 4I7CA 2LGGA 2PUYA 3O70A 3IVVA 3KV5A 3RPGC 1F62A 1D00A 4GHUA 2ECNA 1FP0A 3N9OA 2QIZA 2L80A 2CSZA 1WEOA 2AN6A 4A4CA 5LKXA 1XWHA 2KGGA 3N9PA 1HYJA 3SOUA 1Z6UA 4Q6FA 2MD8C 3RTRB 2YT5A 2VJFB 5LCWB 3U5MA 4UI9B 2Y1MA 2L5UA 3ZYQA 4YATA 1RF3A 1CZYA 4MSXA 4M4EA 4GNGA 5DKAA 3N9LA 2MA6A 2ECIA 1YZEA 2LXHC 3LQIA 4F52B 3L11A 3C6WA 3LRQA 4YADA 3N9QA 1IYMA 2KWOA 4PPEA 3KV6A 4IC2A 2PNXA 3ZVZB 2Y1NA 2YHNA 2HYED
chains in the Genus database with same CATH superfamily
3MQSC 3KQIA 2LGVA 2XOYA 4A4BA 2VJFA 3ZPVE 4WZ3B 1CA9A 1D01A 2YSJA 2D8UA 4XI1A 5D1LB 4LLBA 3ZNIA 1FLLA 3M99A 3KDEC 2C2VS 2F6JA 5B8DA 4AYCB 3LDYA 1WE9A 3MHSA 2FOPA 1JM7B 2LRIC 4F1PA 3DWDA 1LDJB 2CKLB 1N87A 4K8UA 1LB6A 2RI7A 4LJNA 3HQHA 1T1HA 2F1YA 5H1UA 2EODA 5AIUA 2KGIA 1WEWA 2IDAA 3PHDA 2CR2A 3V43A 5G05B 4ZDTA 4OGEA 2JRJA 2XXNA 1D0AA 2B0OE 1ZBDB 2F1XA 4AUQB 5FEYA 2RSDA 3O33A 5TRBA 1L0AA 2VJEA 1WEVA 2KREA 3O7AA 4YC9A 4AVXA 2FUUA 1MM3A 2KIZA 3FJUB 3SUBA 3FM8C 3FL2A 5H1VA 4AYCA 2F42A 2F6NA 5B78A 5K3QA 4N4FA 4PTBA 1F3VB 2H0DA 2LXPC 1WFKA 2QJ0A 3LJUX 2YREA 2CRWA 4B7YC 3T7LA 3O36A 5AITA 3T6RA 3O35A 2JMJA 3EB6A 4L58A 2NAAA 2YSMA 1WESA 4NN2A 3E2DA 1WIMA 4GNFA 4LADB 2KKYA 4WZ2A 2Y43A 3ZJBA 2ECTA 2LN0A 2L43A 2QICA 3HCTA 2XP0A 4QF3A 3HCUA 2M85A 4B86C 1V87A 2ECJA 2L0BA 4YBMA 1FBVA 3SHBA 2E6SA 3U5NA 2KFTA 4V3KC 1D0JA 2DX8A 2MUMA 4X3GA 2K4DA 2VNFA 2HDPA 3HU6A 5SVXA 4YSIA 1X4JA 4YAXA 1WENA 3HQIA 2DSMA 2XEUA 2FD4A 1LB5A 2FUIA 2YU4A 2G45A 4AP4A 4L7XA 4A0CD 3DQVR 4S3OB 2A25A 2DJAA 3U5PA 2K17A 3O47A 3VK6A 5J3XA 3LQHA 3IVQA 2CT2A 3HSVA 4GB0A 2CONA 2JUNA 5FB1A 5B75A 5FB0A 2ECVA 2ZETC 1MM2A 1CHCA 4LK9A 2MNZA 2MIQA 5TDRA 5KH3A 4Z8MA 3HTKC 5G04B 3GL6A 4O64A 3O34A 4YBTA 3M62A 4GWMA 2CSVA 2KR4A 5TDWA 2E6RA 3HCSA 5TBNA 5C11A 1DVPA 3FANA 2LQ6A 2YW8A 2EA6A 4WZ0A 3I2DA 3EB5A 4ZUXU 3SOXA 1K2FA 5H9MA 4O1VA 5TABA 5LKTA 1WEPA 3O37A 2YQMA 5KH9A 1RMDA 2VPGA 4CCGX 4I7BA 1JOCA 3N9MA 3Q1DA 4V3LC 4BHWA 3IVBA 1JM7A 2M3HA 3RPGB 2CKLA 5C13A 3HQMA 2K1JA 2RR4A 1CA4A 1WEQA 3PLWA 5DINA 3FAOA 2EGMA 3DDTA 2JMIA 2KWNA 5G0FA 4O62A 4LKAA 3U5OA 1WGMA 3LVQE 4FK5A 4WA6A 1LDKC 4R8PK 1U6GB 2JMDA 3N9NA 3DPLR 4JJQA 1FLKA 2LGKA 4GJHA 5B79A 2KWJA 1VFYA 4MVTA 2I50A 3SOWA 4P5OB 2LAUA 2L7PA 2FOOA 2MT5A 5E1TA 4IC3A 3MDBC 3ASLA 1WILA 1X4IA 1X4UA 3GV4A 2MD7B 1LB4A 5D1KB 1ZMSA 2C2LA 2VPDA 3HQLA 2ECGA 4W4UA 2F1WA 4QQ4A 4A49A 2FSAA 4H9DA 2VPEA 2MNYA 5H1TA 3LQJA 2KWKA 5FERA 4UP0A 2UZGA 2YQLA 5JG6A 4KG9A 1G25A 2JM3A 4GNEA 2YVRA 2LV9A 2MA5A 3PURA 4FJCA 4ZQLA 1YY6A 2XB1A 3MHHA 1WEEA 1Z60A 5LKZA 1WEMA 3QZVA 2KKXA 4N3WA 5B77A 2FOJA 4BBQA 4GNDA 2M1RA 2CSYA 3PUQA 2CRRA 2M13A 3FEHA 1MBMA 3T9KA 2ECWA 4S3OC 1KZZA 2VJEB 2VP7A 2YURA 5LKUA 1BORA 3M63A 3ZVYA 2D8SA 1DCQA 5I3LA 5SVYA 1WEUA 4FIPA 2G6QA 4QF2A 1VD4A 2KE1A 4GWNA 2YYRA 1Z2QA 3ZPV1 4CA1A 2EGPA 2H0DB 3JUEA 4YBSA 2FFWA 1QSCA 4UP5A 2M6MA 2LDRA 2P57A 1CZZA 2KU3A 2L75A 2MKEA 2XOCA 2OWAA 1VYXA 2YHOA 4FO9A 3L1ZB 2GKWA 3NG2A 2F1ZA 3L1XA 4R7EA 5B76A 2YUCA 2BAYA 4TKPB 2LGLA 1E4UA 5D1MB 5SVIB 4R2YA 3IHPA 2OXQC 4I7DA 4C9ZA 2G43A 5KH7A 3MQRA 1HYIA 3KNVA 2K16A 3C5KA 3ZTGA 3LVRE 4YABA 2VPBA 2KYUA 5EYAF 2EXUA 4I7CA 2LGGA 2PUYA 3O70A 3IVVA 3KV5A 3RPGC 1F62A 1D00A 4GHUA 2ECNA 1FP0A 3N9OA 2QIZA 2L80A 3M7KA 2CSZA 1WEOA 2AN6A 4A4CA 5LKXA 1XWHA 2KGGA 3N9PA 1HYJA 3SOUA 1Z6UA 4Q6FA 2MD8C 3RTRB 2YT5A 2VJFB 5LCWB 3U5MA 4Z0RA 4UI9B 2Y1MA 2L5UA 5SVIA 3H7HA 3ZYQA 4YATA 1RF3A 1CZYA 4MSXA 4M4EA 4GNGA 5DKAA 3N9LA 2XOZA 2MA6A 2ECIA 1YZEA 2LXHC 2E61A 3LQIA 4F52B 3L11A 3C6WA 3LRQA 4YADA 3N9QA 2IQJA 1IYMA 4OGCA 2KWOA 4PPEA 3KV6A 4IC2A 2PNXA 4Z0OA 3ZVZB 2Y1NA 2YHNA 2HYED
chains in the Genus database with same CATH topology
3MQSC 3KQIA 2LGVA 4A4BA 2VJFA 3ZPVE 4WZ3B 1CA9A 1D01A 2YSJA 4XI1A 5D1LB 4LLBA 3ZNIA 1FLLA 3M99A 2C2VS 2F6JA 5B8DA 4AYCB 1WE9A 3MHSA 2FOPA 1JM7B 2LRIC 1LDJB 2CKLB 1N87A 4K8UA 1LB6A 2RI7A 4LJNA 3HQHA 1T1HA 2F1YA 5H1UA 2EODA 5AIUA 2KGIA 1WEWA 2IDAA 3PHDA 2CR2A 3V43A 5G05B 4ZDTA 2JRJA 2XXNA 1D0AA 1ZBDB 2F1XA 4AUQB 5FEYA 2RSDA 3O33A 5TRBA 1L0AA 2VJEA 1WEVA 2KREA 3O7AA 4YC9A 4AVXA 2FUUA 1MM3A 2KIZA 3FL2A 5H1VA 4AYCA 2F42A 2F6NA 5B78A 4N4FA 4PTBA 1F3VB 2H0DA 2LXPC 1WFKA 2QJ0A 2YREA 4B7YC 3T7LA 3O36A 5AITA 3T6RA 3O35A 2JMJA 3EB6A 4L58A 2NAAA 2YSMA 1WESA 4NN2A 1WIMA 4GNFA 4LADB 4WZ2A 2Y43A 3ZJBA 2ECTA 2LN0A 2L43A 2QICA 3HCTA 4QF3A 3HCUA 2M85A 4B86C 1V87A 2ECJA 2L0BA 4YBMA 1FBVA 3SHBA 2E6SA 3U5NA 2KFTA 4V3KC 1D0JA 2DX8A 2MUMA 4X3GA 2K4DA 2VNFA 2HDPA 3HU6A 4YSIA 1X4JA 4YAXA 1WENA 3HQIA 2XEUA 1LB5A 2FUIA 2YU4A 2G45A 4AP4A 4L7XA 4A0CD 3DQVR 4S3OB 2A25A 3U5PA 2K17A 3VK6A 5J3XA 3LQHA 3IVQA 2CT2A 3HSVA 4GB0A 5FB1A 5B75A 5FB0A 2ECVA 2ZETC 1MM2A 1CHCA 4LK9A 2MNZA 2MIQA 5TDRA 5KH3A 4Z8MA 3HTKC 5G04B 3GL6A 4O64A 3O34A 4YBTA 3M62A 4GWMA 2KR4A 5TDWA 2E6RA 3HCSA 5TBNA 5C11A 1DVPA 2LQ6A 2YW8A 2EA6A 4WZ0A 3I2DA 3EB5A 4ZUXU 3SOXA 1K2FA 5H9MA 4O1VA 5TABA 5LKTA 1WEPA 3O37A 2YQMA 5KH9A 1RMDA 2VPGA 4CCGX 4I7BA 1JOCA 3N9MA 4V3LC 4BHWA 3IVBA 1JM7A 2M3HA 3RPGB 2CKLA 5C13A 3HQMA 2K1JA 1CA4A 1WEQA 5DINA 2JMIA 2KWNA 5G0FA 4LKAA 3U5OA 1WGMA 4FK5A 4WA6A 1LDKC 4R8PK 1U6GB 2JMDA 3N9NA 3DPLR 4JJQA 1FLKA 2LGKA 4GJHA 5B79A 2KWJA 1VFYA 4MVTA 2I50A 3SOWA 4P5OB 2FOOA 2MT5A 5E1TA 4IC3A 3ASLA 1WILA 1X4IA 1X4UA 3GV4A 2MD7B 1LB4A 5D1KB 1ZMSA 2C2LA 2VPDA 3HQLA 2ECGA 4W4UA 2F1WA 4A49A 2FSAA 2VPEA 2MNYA 5H1TA 3LQJA 2KWKA 5FERA 4UP0A 2UZGA 2YQLA 5JG6A 4KG9A 1G25A 4GNEA 2LV9A 2MA5A 3PURA 4FJCA 4ZQLA 1YY6A 2XB1A 3MHHA 1WEEA 1Z60A 5LKZA 1WEMA 3QZVA 4N3WA 5B77A 2FOJA 4BBQA 4GNDA 2M1RA 2CSYA 3PUQA 2ECWA 4S3OC 1KZZA 2VJEB 2VP7A 2YURA 5LKUA 1BORA 3M63A 3ZVYA 2D8SA 5I3LA 1WEUA 4FIPA 2G6QA 4QF2A 1VD4A 2KE1A 4GWNA 2YYRA 1Z2QA 3ZPV1 4CA1A 2EGPA 2H0DB 4YBSA 1QSCA 4UP5A 2M6MA 2LDRA 1CZZA 2KU3A 2L75A 1VYXA 2YHOA 4FO9A 3L1ZB 2GKWA 3NG2A 2F1ZA 3L1XA 4R7EA 5B76A 2YUCA 2BAYA 4TKPB 2LGLA 1E4UA 5D1MB 4R2YA 3IHPA 2OXQC 4I7DA 4C9ZA 2G43A 5KH7A 3MQRA 1HYIA 3KNVA 2K16A 3C5KA 3ZTGA 4YABA 2VPBA 2KYUA 5EYAF 4I7CA 2LGGA 2PUYA 3O70A 3IVVA 3KV5A 3RPGC 1F62A 1D00A 4GHUA 2ECNA 1FP0A 3N9OA 2QIZA 2L80A 2CSZA 1WEOA 2AN6A 4A4CA 5LKXA 1XWHA 2KGGA 3N9PA 1HYJA 3SOUA 1Z6UA 4Q6FA 2MD8C 3RTRB 2YT5A 2VJFB 5LCWB 3U5MA 4UI9B 2Y1MA 2L5UA 3ZYQA 4YATA 1RF3A 1CZYA 4MSXA 4M4EA 4GNGA 5DKAA 3N9LA 2MA6A 2ECIA 1YZEA 2LXHC 3LQIA 4F52B 3L11A 3C6WA 3LRQA 4YADA 3N9QA 1IYMA 2KWOA 4PPEA 3KV6A 4IC2A 2PNXA 3ZVZB 2Y1NA 2YHNA 2HYED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQS C;  3KQI A;  2LGV A;  4A4B A;  2VJF A;  3ZPV E;  4WZ3 B;  1CA9 A;  1D01 A;  2YSJ A;  4XI1 A;  5D1L B;  4LLB A;  3ZNI A;  1FLL A;  3M99 A;  2C2V S;  2F6J A;  5B8D A;  4AYC B;  1WE9 A;  3MHS A;  2FOP A;  1JM7 B;  2LRI C;  1LDJ B;  2CKL B;  1N87 A;  4K8U A;  1LB6 A;  2RI7 A;  4LJN A;  3HQH A;  1T1H A;  2F1Y A;  5H1U A;  2EOD A;  5AIU A;  2KGI A;  1WEW A;  2IDA A;  3PHD A;  2CR2 A;  3V43 A;  5G05 B;  4ZDT A;  2JRJ A;  2XXN A;  1D0A A;  1ZBD B;  2F1X A;  4AUQ B;  5FEY A;  2RSD A;  3O33 A;  5TRB A;  1L0A A;  2VJE A;  1WEV A;  2KRE A;  3O7A A;  4YC9 A;  4AVX A;  2FUU A;  1MM3 A;  2KIZ A;  3FL2 A;  5H1V A;  4AYC A;  2F42 A;  2F6N A;  5B78 A;  4N4F A;  4PTB A;  1F3V B;  2H0D A;  2LXP C;  1WFK A;  2QJ0 A;  2YRE A;  4B7Y C;  3T7L A;  3O36 A;  5AIT A;  3T6R A;  3O35 A;  2JMJ A;  3EB6 A;  4L58 A;  2NAA A;  2YSM A;  1WES A;  4NN2 A;  1WIM A;  4GNF A;  4LAD B;  4WZ2 A;  2Y43 A;  3ZJB A;  2ECT A;  2LN0 A;  2L43 A;  2QIC A;  3HCT A;  4QF3 A;  3HCU A;  2M85 A;  4B86 C;  1V87 A;  2ECJ A;  2L0B A;  4YBM A;  1FBV A;  3SHB A;  2E6S A;  3U5N A;  2KFT A;  4V3K C;  1D0J A;  2DX8 A;  2MUM A;  4X3G A;  2K4D A;  2VNF A;  2HDP A;  3HU6 A;  4YSI A;  1X4J A;  4YAX A;  1WEN A;  3HQI A;  2XEU A;  1LB5 A;  2FUI A;  2YU4 A;  2G45 A;  4AP4 A;  4L7X A;  4A0C D;  3DQV R;  4S3O B;  2A25 A;  3U5P A;  2K17 A;  3VK6 A;  5J3X A;  3LQH A;  3IVQ A;  2CT2 A;  3HSV A;  4GB0 A;  5FB1 A;  5B75 A;  5FB0 A;  2ECV A;  2ZET C;  1MM2 A;  1CHC A;  4LK9 A;  2MNZ A;  2MIQ A;  5TDR A;  5KH3 A;  4Z8M A;  3HTK C;  5G04 B;  3GL6 A;  4O64 A;  3O34 A;  4YBT A;  3M62 A;  4GWM A;  2KR4 A;  5TDW A;  2E6R A;  3HCS A;  5TBN A;  5C11 A;  1DVP A;  2LQ6 A;  2YW8 A;  2EA6 A;  4WZ0 A;  3I2D A;  3EB5 A;  4ZUX U;  3SOX A;  1K2F A;  5H9M A;  4O1V A;  5TAB A;  5LKT A;  1WEP A;  3O37 A;  2YQM A;  5KH9 A;  1RMD A;  2VPG A;  4CCG X;  4I7B A;  1JOC A;  3N9M A;  4V3L C;  4BHW A;  3IVB A;  1JM7 A;  2M3H A;  3RPG B;  2CKL A;  5C13 A;  3HQM A;  2K1J A;  1CA4 A;  1WEQ A;  5DIN A;  2JMI A;  2KWN A;  5G0F A;  4LKA A;  3U5O A;  1WGM A;  4FK5 A;  4WA6 A;  1LDK C;  4R8P K;  1U6G B;  2JMD A;  3N9N A;  3DPL R;  4JJQ A;  1FLK A;  2LGK A;  4GJH A;  5B79 A;  2KWJ A;  1VFY A;  4MVT A;  2I50 A;  3SOW A;  4P5O B;  2FOO A;  2MT5 A;  5E1T A;  4IC3 A;  3ASL A;  1WIL A;  1X4I A;  1X4U A;  3GV4 A;  2MD7 B;  1LB4 A;  5D1K B;  1ZMS A;  2C2L A;  2VPD A;  3HQL A;  2ECG A;  4W4U A;  2F1W A;  4A49 A;  2FSA A;  2VPE A;  2MNY A;  5H1T A;  3LQJ A;  2KWK A;  5FER A;  4UP0 A;  2UZG A;  2YQL A;  5JG6 A;  4KG9 A;  1G25 A;  4GNE A;  2LV9 A;  2MA5 A;  3PUR A;  4FJC A;  4ZQL A;  1YY6 A;  2XB1 A;  3MHH A;  1WEE A;  1Z60 A;  5LKZ A;  1WEM A;  3QZV A;  4N3W A;  5B77 A;  2FOJ A;  4BBQ A;  4GND A;  2M1R A;  2CSY A;  3PUQ A;  2ECW A;  4S3O C;  1KZZ A;  2VJE B;  2VP7 A;  2YUR A;  5LKU A;  1BOR A;  3M63 A;  3ZVY A;  2D8S A;  5I3L A;  1WEU A;  4FIP A;  2G6Q A;  4QF2 A;  1VD4 A;  2KE1 A;  4GWN A;  2YYR A;  1Z2Q A;  3ZPV 1;  4CA1 A;  2EGP A;  2H0D B;  4YBS A;  1QSC A;  4UP5 A;  2M6M A;  2LDR A;  1CZZ A;  2KU3 A;  2L75 A;  1VYX A;  2YHO A;  4FO9 A;  3L1Z B;  2GKW A;  3NG2 A;  2F1Z A;  3L1X A;  4R7E A;  5B76 A;  2YUC A;  2BAY A;  4TKP B;  2LGL A;  1E4U A;  5D1M B;  4R2Y A;  3IHP A;  2OXQ C;  4I7D A;  4C9Z A;  2G43 A;  5KH7 A;  3MQR A;  1HYI A;  3KNV A;  2K16 A;  3C5K A;  3ZTG A;  4YAB A;  2VPB A;  2KYU A;  5EYA F;  4I7C A;  2LGG A;  2PUY A;  3O70 A;  3IVV A;  3KV5 A;  3RPG C;  1F62 A;  1D00 A;  4GHU A;  2ECN A;  1FP0 A;  3N9O A;  2QIZ A;  2L80 A;  2CSZ A;  1WEO A;  2AN6 A;  4A4C A;  5LKX A;  1XWH A;  2KGG A;  3N9P A;  1HYJ A;  3SOU A;  1Z6U A;  4Q6F A;  2MD8 C;  3RTR B;  2YT5 A;  2VJF B;  5LCW B;  3U5M A;  4UI9 B;  2Y1M A;  2L5U A;  3ZYQ A;  4YAT A;  1RF3 A;  1CZY A;  4MSX A;  4M4E A;  4GNG A;  5DKA A;  3N9L A;  2MA6 A;  2ECI A;  1YZE A;  2LXH C;  3LQI A;  4F52 B;  3L11 A;  3C6W A;  3LRQ A;  4YAD A;  3N9Q A;  1IYM A;  2KWO A;  4PPE A;  3KV6 A;  4IC2 A;  2PNX A;  3ZVZ B;  2Y1N A;  2YHN A;  2HYE D; 
#chains in the Genus database with same CATH topology
 3MQS C;  3KQI A;  2LGV A;  2XOY A;  4A4B A;  2VJF A;  3ZPV E;  4WZ3 B;  1CA9 A;  1D01 A;  2YSJ A;  2D8U A;  4XI1 A;  5D1L B;  4LLB A;  3ZNI A;  1FLL A;  3M99 A;  3KDE C;  2C2V S;  2F6J A;  5B8D A;  4AYC B;  3LDY A;  1WE9 A;  3MHS A;  2FOP A;  1JM7 B;  2LRI C;  4F1P A;  3DWD A;  1LDJ B;  2CKL B;  1N87 A;  4K8U A;  1LB6 A;  2RI7 A;  4LJN A;  3HQH A;  1T1H A;  2F1Y A;  5H1U A;  2EOD A;  5AIU A;  2KGI A;  1WEW A;  2IDA A;  3PHD A;  2CR2 A;  3V43 A;  5G05 B;  4ZDT A;  4OGE A;  2JRJ A;  2XXN A;  1D0A A;  2B0O E;  1ZBD B;  2F1X A;  4AUQ B;  5FEY A;  2RSD A;  3O33 A;  5TRB A;  1L0A A;  2VJE A;  1WEV A;  2KRE A;  3O7A A;  4YC9 A;  4AVX A;  2FUU A;  1MM3 A;  2KIZ A;  3FJU B;  3SUB A;  3FM8 C;  3FL2 A;  5H1V A;  4AYC A;  2F42 A;  2F6N A;  5B78 A;  5K3Q A;  4N4F A;  4PTB A;  1F3V B;  2H0D A;  2LXP C;  1WFK A;  2QJ0 A;  3LJU X;  2YRE A;  2CRW A;  4B7Y C;  3T7L A;  3O36 A;  5AIT A;  3T6R A;  3O35 A;  2JMJ A;  3EB6 A;  4L58 A;  2NAA A;  2YSM A;  1WES A;  4NN2 A;  3E2D A;  1WIM A;  4GNF A;  4LAD B;  2KKY A;  4WZ2 A;  2Y43 A;  3ZJB A;  2ECT A;  2LN0 A;  2L43 A;  2QIC A;  3HCT A;  2XP0 A;  4QF3 A;  3HCU A;  2M85 A;  4B86 C;  1V87 A;  2ECJ A;  2L0B A;  4YBM A;  1FBV A;  3SHB A;  2E6S A;  3U5N A;  2KFT A;  4V3K C;  1D0J A;  2DX8 A;  2MUM A;  4X3G A;  2K4D A;  2VNF A;  2HDP A;  3HU6 A;  5SVX A;  4YSI A;  1X4J A;  4YAX A;  1WEN A;  3HQI A;  2DSM A;  2XEU A;  2FD4 A;  1LB5 A;  2FUI A;  2YU4 A;  2G45 A;  4AP4 A;  4L7X A;  4A0C D;  3DQV R;  4S3O B;  2A25 A;  2DJA A;  3U5P A;  2K17 A;  3O47 A;  3VK6 A;  5J3X A;  3LQH A;  3IVQ A;  2CT2 A;  3HSV A;  4GB0 A;  2CON A;  2JUN A;  5FB1 A;  5B75 A;  5FB0 A;  2ECV A;  2ZET C;  1MM2 A;  1CHC A;  4LK9 A;  2MNZ A;  2MIQ A;  5TDR A;  5KH3 A;  4Z8M A;  3HTK C;  5G04 B;  3GL6 A;  4O64 A;  3O34 A;  4YBT A;  3M62 A;  4GWM A;  2CSV A;  2KR4 A;  5TDW A;  2E6R A;  3HCS A;  5TBN A;  5C11 A;  1DVP A;  3FAN A;  2LQ6 A;  2YW8 A;  2EA6 A;  4WZ0 A;  3I2D A;  3EB5 A;  4ZUX U;  3SOX A;  1K2F A;  5H9M A;  4O1V A;  5TAB A;  5LKT A;  1WEP A;  3O37 A;  2YQM A;  5KH9 A;  1RMD A;  2VPG A;  4CCG X;  4I7B A;  1JOC A;  3N9M A;  3Q1D A;  4V3L C;  4BHW A;  3IVB A;  1JM7 A;  2M3H A;  3RPG B;  2CKL A;  5C13 A;  3HQM A;  2K1J A;  2RR4 A;  1CA4 A;  1WEQ A;  3PLW A;  5DIN A;  3FAO A;  2EGM A;  3DDT A;  2JMI A;  2KWN A;  5G0F A;  4O62 A;  4LKA A;  3U5O A;  1WGM A;  3LVQ E;  4FK5 A;  4WA6 A;  1LDK C;  4R8P K;  1U6G B;  2JMD A;  3N9N A;  3DPL R;  4JJQ A;  1FLK A;  2LGK A;  4GJH A;  5B79 A;  2KWJ A;  1VFY A;  4MVT A;  2I50 A;  3SOW A;  4P5O B;  2LAU A;  2L7P A;  2FOO A;  2MT5 A;  5E1T A;  4IC3 A;  3MDB C;  3ASL A;  1WIL A;  1X4I A;  1X4U A;  3GV4 A;  2MD7 B;  1LB4 A;  5D1K B;  1ZMS A;  2C2L A;  2VPD A;  3HQL A;  2ECG A;  4W4U A;  2F1W A;  4QQ4 A;  4A49 A;  2FSA A;  4H9D A;  2VPE A;  2MNY A;  5H1T A;  3LQJ A;  2KWK A;  5FER A;  4UP0 A;  2UZG A;  2YQL A;  5JG6 A;  4KG9 A;  1G25 A;  2JM3 A;  4GNE A;  2YVR A;  2LV9 A;  2MA5 A;  3PUR A;  4FJC A;  4ZQL A;  1YY6 A;  2XB1 A;  3MHH A;  1WEE A;  1Z60 A;  5LKZ A;  1WEM A;  3QZV A;  2KKX A;  4N3W A;  5B77 A;  2FOJ A;  4BBQ A;  4GND A;  2M1R A;  2CSY A;  3PUQ A;  2CRR A;  2M13 A;  3FEH A;  1MBM A;  3T9K A;  2ECW A;  4S3O C;  1KZZ A;  2VJE B;  2VP7 A;  2YUR A;  5LKU A;  1BOR A;  3M63 A;  3ZVY A;  2D8S A;  1DCQ A;  5I3L A;  5SVY A;  1WEU A;  4FIP A;  2G6Q A;  4QF2 A;  1VD4 A;  2KE1 A;  4GWN A;  2YYR A;  1Z2Q A;  3ZPV 1;  4CA1 A;  2EGP A;  2H0D B;  3JUE A;  4YBS A;  2FFW A;  1QSC A;  4UP5 A;  2M6M A;  2LDR A;  2P57 A;  1CZZ A;  2KU3 A;  2L75 A;  2MKE A;  2XOC A;  2OWA A;  1VYX A;  2YHO A;  4FO9 A;  3L1Z B;  2GKW A;  3NG2 A;  2F1Z A;  3L1X A;  4R7E A;  5B76 A;  2YUC A;  2BAY A;  4TKP B;  2LGL A;  1E4U A;  5D1M B;  5SVI B;  4R2Y A;  3IHP A;  2OXQ C;  4I7D A;  4C9Z A;  2G43 A;  5KH7 A;  3MQR A;  1HYI A;  3KNV A;  2K16 A;  3C5K A;  3ZTG A;  3LVR E;  4YAB A;  2VPB A;  2KYU A;  5EYA F;  2EXU A;  4I7C A;  2LGG A;  2PUY A;  3O70 A;  3IVV A;  3KV5 A;  3RPG C;  1F62 A;  1D00 A;  4GHU A;  2ECN A;  1FP0 A;  3N9O A;  2QIZ A;  2L80 A;  3M7K A;  2CSZ A;  1WEO A;  2AN6 A;  4A4C A;  5LKX A;  1XWH A;  2KGG A;  3N9P A;  1HYJ A;  3SOU A;  1Z6U A;  4Q6F A;  2MD8 C;  3RTR B;  2YT5 A;  2VJF B;  5LCW B;  3U5M A;  4Z0R A;  4UI9 B;  2Y1M A;  2L5U A;  5SVI A;  3H7H A;  3ZYQ A;  4YAT A;  1RF3 A;  1CZY A;  4MSX A;  4M4E A;  4GNG A;  5DKA A;  3N9L A;  2XOZ A;  2MA6 A;  2ECI A;  1YZE A;  2LXH C;  2E61 A;  3LQI A;  4F52 B;  3L11 A;  3C6W A;  3LRQ A;  4YAD A;  3N9Q A;  2IQJ A;  1IYM A;  4OGC A;  2KWO A;  4PPE A;  3KV6 A;  4IC2 A;  2PNX A;  4Z0O A;  3ZVZ B;  2Y1N A;  2YHN A;  2HYE D; 
#chains in the Genus database with same CATH homology
 3MQS C;  3KQI A;  2LGV A;  4A4B A;  2VJF A;  3ZPV E;  4WZ3 B;  1CA9 A;  1D01 A;  2YSJ A;  4XI1 A;  5D1L B;  4LLB A;  3ZNI A;  1FLL A;  3M99 A;  2C2V S;  2F6J A;  5B8D A;  4AYC B;  1WE9 A;  3MHS A;  2FOP A;  1JM7 B;  2LRI C;  1LDJ B;  2CKL B;  1N87 A;  4K8U A;  1LB6 A;  2RI7 A;  4LJN A;  3HQH A;  1T1H A;  2F1Y A;  5H1U A;  2EOD A;  5AIU A;  2KGI A;  1WEW A;  2IDA A;  3PHD A;  2CR2 A;  3V43 A;  5G05 B;  4ZDT A;  2JRJ A;  2XXN A;  1D0A A;  1ZBD B;  2F1X A;  4AUQ B;  5FEY A;  2RSD A;  3O33 A;  5TRB A;  1L0A A;  2VJE A;  1WEV A;  2KRE A;  3O7A A;  4YC9 A;  4AVX A;  2FUU A;  1MM3 A;  2KIZ A;  3FL2 A;  5H1V A;  4AYC A;  2F42 A;  2F6N A;  5B78 A;  4N4F A;  4PTB A;  1F3V B;  2H0D A;  2LXP C;  1WFK A;  2QJ0 A;  2YRE A;  4B7Y C;  3T7L A;  3O36 A;  5AIT A;  3T6R A;  3O35 A;  2JMJ A;  3EB6 A;  4L58 A;  2NAA A;  2YSM A;  1WES A;  4NN2 A;  1WIM A;  4GNF A;  4LAD B;  4WZ2 A;  2Y43 A;  3ZJB A;  2ECT A;  2LN0 A;  2L43 A;  2QIC A;  3HCT A;  4QF3 A;  3HCU A;  2M85 A;  4B86 C;  1V87 A;  2ECJ A;  2L0B A;  4YBM A;  1FBV A;  3SHB A;  2E6S A;  3U5N A;  2KFT A;  4V3K C;  1D0J A;  2DX8 A;  2MUM A;  4X3G A;  2K4D A;  2VNF A;  2HDP A;  3HU6 A;  4YSI A;  1X4J A;  4YAX A;  1WEN A;  3HQI A;  2XEU A;  1LB5 A;  2FUI A;  2YU4 A;  2G45 A;  4AP4 A;  4L7X A;  4A0C D;  3DQV R;  4S3O B;  2A25 A;  3U5P A;  2K17 A;  3VK6 A;  5J3X A;  3LQH A;  3IVQ A;  2CT2 A;  3HSV A;  4GB0 A;  5FB1 A;  5B75 A;  5FB0 A;  2ECV A;  2ZET C;  1MM2 A;  1CHC A;  4LK9 A;  2MNZ A;  2MIQ A;  5TDR A;  5KH3 A;  4Z8M A;  3HTK C;  5G04 B;  3GL6 A;  4O64 A;  3O34 A;  4YBT A;  3M62 A;  4GWM A;  2KR4 A;  5TDW A;  2E6R A;  3HCS A;  5TBN A;  5C11 A;  1DVP A;  2LQ6 A;  2YW8 A;  2EA6 A;  4WZ0 A;  3I2D A;  3EB5 A;  4ZUX U;  3SOX A;  1K2F A;  5H9M A;  4O1V A;  5TAB A;  5LKT A;  1WEP A;  3O37 A;  2YQM A;  5KH9 A;  1RMD A;  2VPG A;  4CCG X;  4I7B A;  1JOC A;  3N9M A;  4V3L C;  4BHW A;  3IVB A;  1JM7 A;  2M3H A;  3RPG B;  2CKL A;  5C13 A;  3HQM A;  2K1J A;  1CA4 A;  1WEQ A;  5DIN A;  2JMI A;  2KWN A;  5G0F A;  4LKA A;  3U5O A;  1WGM A;  4FK5 A;  4WA6 A;  1LDK C;  4R8P K;  1U6G B;  2JMD A;  3N9N A;  3DPL R;  4JJQ A;  1FLK A;  2LGK A;  4GJH A;  5B79 A;  2KWJ A;  1VFY A;  4MVT A;  2I50 A;  3SOW A;  4P5O B;  2FOO A;  2MT5 A;  5E1T A;  4IC3 A;  3ASL A;  1WIL A;  1X4I A;  1X4U A;  3GV4 A;  2MD7 B;  1LB4 A;  5D1K B;  1ZMS A;  2C2L A;  2VPD A;  3HQL A;  2ECG A;  4W4U A;  2F1W A;  4A49 A;  2FSA A;  2VPE A;  2MNY A;  5H1T A;  3LQJ A;  2KWK A;  5FER A;  4UP0 A;  2UZG A;  2YQL A;  5JG6 A;  4KG9 A;  1G25 A;  4GNE A;  2LV9 A;  2MA5 A;  3PUR A;  4FJC A;  4ZQL A;  1YY6 A;  2XB1 A;  3MHH A;  1WEE A;  1Z60 A;  5LKZ A;  1WEM A;  3QZV A;  4N3W A;  5B77 A;  2FOJ A;  4BBQ A;  4GND A;  2M1R A;  2CSY A;  3PUQ A;  2ECW A;  4S3O C;  1KZZ A;  2VJE B;  2VP7 A;  2YUR A;  5LKU A;  1BOR A;  3M63 A;  3ZVY A;  2D8S A;  5I3L A;  1WEU A;  4FIP A;  2G6Q A;  4QF2 A;  1VD4 A;  2KE1 A;  4GWN A;  2YYR A;  1Z2Q A;  3ZPV 1;  4CA1 A;  2EGP A;  2H0D B;  4YBS A;  1QSC A;  4UP5 A;  2M6M A;  2LDR A;  1CZZ A;  2KU3 A;  2L75 A;  1VYX A;  2YHO A;  4FO9 A;  3L1Z B;  2GKW A;  3NG2 A;  2F1Z A;  3L1X A;  4R7E A;  5B76 A;  2YUC A;  2BAY A;  4TKP B;  2LGL A;  1E4U A;  5D1M B;  4R2Y A;  3IHP A;  2OXQ C;  4I7D A;  4C9Z A;  2G43 A;  5KH7 A;  3MQR A;  1HYI A;  3KNV A;  2K16 A;  3C5K A;  3ZTG A;  4YAB A;  2VPB A;  2KYU A;  5EYA F;  4I7C A;  2LGG A;  2PUY A;  3O70 A;  3IVV A;  3KV5 A;  3RPG C;  1F62 A;  1D00 A;  4GHU A;  2ECN A;  1FP0 A;  3N9O A;  2QIZ A;  2L80 A;  2CSZ A;  1WEO A;  2AN6 A;  4A4C A;  5LKX A;  1XWH A;  2KGG A;  3N9P A;  1HYJ A;  3SOU A;  1Z6U A;  4Q6F A;  2MD8 C;  3RTR B;  2YT5 A;  2VJF B;  5LCW B;  3U5M A;  4UI9 B;  2Y1M A;  2L5U A;  3ZYQ A;  4YAT A;  1RF3 A;  1CZY A;  4MSX A;  4M4E A;  4GNG A;  5DKA A;  3N9L A;  2MA6 A;  2ECI A;  1YZE A;  2LXH C;  3LQI A;  4F52 B;  3L11 A;  3C6W A;  3LRQ A;  4YAD A;  3N9Q A;  1IYM A;  2KWO A;  4PPE A;  3KV6 A;  4IC2 A;  2PNX A;  3ZVZ B;  2Y1N A;  2YHN A;  2HYE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...