1K2FA

Siah, seven in absentia homolog
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
190
structure length
190
Chain Sequence
b'SVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords siah-1A protein
publication title Siah ubiquitin ligase is structurally related to TRAF and modulates TNF-alpha signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase, protein binding
total genus 39
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 1k2fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1k2fA02
2LQ6A 5LKTA 4W4UA 3HQLA 1WEUA 5FB0A 3KV5A 2M1RA 2DX8A 4O64A 5B76A 2CKLB 2M3HA 3O37A 3ASLA 4O1VA 1Z6UA 4AUQB 2VJFB 2G43A 2KIZA 2MA5A 2VPGA 2YREA 2FOPA 5D1MB 4L7XA 2VJFA 3C6WA 5H1VA 2ECNA 4UI9B 4WA6A 1L0AA 2LRIC 4QF2A 4FIPA 1WEEA 4R2YA 1CZZA 4S3OB 3KV6A 4GB0A 2HDPA 2KE1A 4YABA 5LKXA 5LKUA 2XXNA 4QF3A 1T1HA 2IDAA 1X4IA 3HTKC 2JMDA 2MNYA 2KU3A 5G05B 2F1XA 4R7EA 2YQLA 5JG6A 2D8SA 4GJHA 3ZYQA 2M85A 4F52B 2CSYA 2F1WA 1F62A 3ZVZB 2PUYA 5TDWA 2M6MA 4N3WA 2YU4A 2UZGA 2VP7A 4B7YC 5B77A 2CSZA 2VNFA 3T6RA 3DQVR 4BHWA 1VYXA 4CA1A 2QIZA 1D0AA 3PUQA 2RSDA 4L58A 2MD8C 1DVPA 3U5NA 2NAAA 2C2VS 1E4UA 4BBQA 3EB5A 2KR4A 1KZZA 5DINA 2F6JA 4FJCA 3V43A 1IYMA 5H9MA 1X4JA 2MUMA 3IVBA 4A4CA 2K16A 2F42A 3ZNIA 2MIQA 1CA4A 1D01A 4MVTA 3RTRB 2FUUA 3N9MA 2MA6A 4Z8MA 3O7AA 4AP4A 1WILA 1X4UA 5TABA 4GNFA 3M62A 2KGGA 2Y1MA 5D1LB 3U5OA 3ZPV1 1LDJB 4M4EA 3L1ZB 2ECIA 1QSCA 4PTBA 5B78A 4ZDTA 4CCGX 4GNDA 1CZYA 1MM3A 4WZ3B 4WZ0A 1JM7A 4I7DA 2LGLA 2YUCA 1ZBDB 2PNXA 3O33A 1VD4A 5TRBA 2KWJA 4ZQLA 3KQIA 2JMJA 2E6RA 3FL2A 2FOJA 3MHHA 4C9ZA 3EB6A 4AVXA 2K1JA 2YW8A 3GL6A 3IVVA 4TKPB 5FERA 2H0DA 3HQMA 2LGKA 3DPLR 3HQIA 4AYCB 1CA9A 2LGGA 4KG9A 2L75A 5EYAF 1HYIA 1WEWA 1WFKA 4AYCA 2LGVA 2KWKA 3QZVA 2YHOA 3HSVA 2FUIA 2XB1A 5AIUA 2LDRA 4Q6FA 5FEYA 1MM2A 4IC3A 4YATA 4FK5A 2F6NA 3HU6A 1WEQA 2L43A 1LB6A 2L5UA 5LCWB 3M99A 3RPGC 1WGMA 2RI7A 2LN0A 3MQRA 2EGPA 4GNEA 3O35A 2ECTA 1LDKC 5E1TA 5I3LA 1G25A 2MT5A 3ZJBA 3HCUA 3VK6A 2KGIA 2YURA 2VPEA 3NG2A 2FOOA 4GHUA 2G6QA 1FBVA 2VPDA 5H1TA 3U5MA 3LQHA 2QJ0A 2ECVA 2KYUA 3PURA 4LKAA 4UP5A 2G45A 3HCTA 2VPBA 3IVQA 4YBMA 4R8PK 4NN2A 5C11A 5D1KB 1FLKA 1WEPA 2YSJA 4IC2A 4K8UA 3KNVA 1ZMSA 4N4FA 4V3LC 3HQHA 4XI1A 1V87A 4LADB 2I50A 5C13A 1JM7B 1Z2QA 3MHSA 4GNGA 4UP0A 2F1YA 1U6GB 4B86C 4LK9A 2MNZA 2LXHC 1XWHA 1LB5A 5B79A 2K4DA 3O36A 5H1UA 2A25A 3L1XA 1LB4A 2YYRA 3GV4A 2F1ZA 4YBTA 3LRQA 4A49A 3N9LA 2JMIA 2ECWA 2H0DB 1RF3A 3L11A 2LXPC 5FB1A 2YT5A 2EA6A 1D00A 5LKZA 5TBNA 5G04B 1N87A 1WEMA 3N9QA 3HCSA 4JJQA 4S3OC 1JOCA 3I2DA 2HYED 1FLLA 4LLBA 4ZUXU 5J3XA 3LQJA 4MSXA 2CKLA 3SOWA 2Y1NA 4I7BA 4YSIA 2VJEB 3ZVYA 1YY6A 5DKAA 1WENA 4A0CD 2OXQC 4X3GA 3O70A 2ECGA 4LJNA 2VJEA 5KH7A 2YQMA 2YSMA 2ECJA 4PPEA 2JRJA 1RMDA 3SOXA 4P5OB 3N9PA 1WE9A 1F3VB 3IHPA 2Y43A 2YHNA 1FP0A 2KWOA 5B75A 4YBSA 1WEOA 2BAYA 3O34A 5TDRA 4I7CA 4V3KC 4YAXA 1WEVA 5KH9A 5B8DA 2C2LA 3T7LA 4A4BA 4GWMA 2QICA 3SOUA 2EODA 3ZPVE 4YADA 3ZTGA 1Z60A 2CT2A 4YC9A 2K17A 3C5KA 5G0FA 1WESA 4WZ2A 1VFYA 2KREA 2KFTA 3RPGB 2ZETC 2L0BA 2MD7B 3N9NA 2L80A 2CR2A 2GKWA 1BORA 1K2FA 3U5PA 2E6SA 4FO9A 2XEUA 1CHCA 3SHBA 3M63A 5AITA 3PHDA 2KWNA 3MQSC 1YZEA 3N9OA 1D0JA 4GWNA 1HYJA 1WIMA 3LQIA 2FSAA 5KH3A 2LV9A 2AN6A
chains in the Genus database with same CATH superfamily
2LQ6A 5LKTA 3PLWA 3M7KA 5K3QA 4W4UA 3HQLA 2M13A 1WEUA 5FB0A 3FM8C 3KV5A 2M1RA 2DX8A 4O64A 5B76A 2CKLB 2M3HA 3O37A 3ASLA 4O1VA 1Z6UA 4AUQB 2VJFB 2G43A 2KIZA 2LAUA 2MA5A 2VPGA 2YREA 2FOPA 5D1MB 4L7XA 2L7PA 2VJFA 3C6WA 5H1VA 2ECNA 4UI9B 4WA6A 1L0AA 2LRIC 5SVIB 4QF2A 4FIPA 4QQ4A 1WEEA 4R2YA 1CZZA 4S3OB 3KV6A 4GB0A 2HDPA 2KE1A 4YABA 5LKXA 5LKUA 2CRRA 2XOCA 2XXNA 2OWAA 4QF3A 1T1HA 2IDAA 1X4IA 3HTKC 2JMDA 2MNYA 2KU3A 5G05B 2F1XA 4R7EA 2YQLA 5JG6A 2D8SA 4GJHA 3ZYQA 2M85A 4F52B 2CSYA 2F1WA 4O62A 1F62A 3DWDA 2PUYA 3ZVZB 5TDWA 2XP0A 2M6MA 4N3WA 2YU4A 2UZGA 2VP7A 4B7YC 5B77A 2CSZA 2VNFA 3T6RA 3DQVR 4BHWA 1VYXA 3SUBA 4CA1A 2QIZA 1D0AA 3PUQA 2RSDA 4L58A 2MD8C 1DVPA 3U5NA 2NAAA 2C2VS 1E4UA 4BBQA 3EB5A 2DSMA 2KR4A 1KZZA 5DINA 2F6JA 3KDEC 4FJCA 3V43A 1IYMA 5H9MA 1X4JA 2MUMA 3IVBA 4A4CA 2K16A 2CRWA 2F42A 3ZNIA 2MIQA 1CA4A 1D01A 4MVTA 3RTRB 3JUEA 2FUUA 3N9MA 2MA6A 4Z8MA 3O7AA 4AP4A 1WILA 1X4UA 5TABA 2DJAA 4GNFA 3M62A 2KGGA 2Y1MA 5D1LB 2XOZA 3U5OA 3ZPV1 1LDJB 4M4EA 3L1ZB 2ECIA 1QSCA 4PTBA 5B78A 4ZDTA 4CCGX 4GNDA 1CZYA 3T9KA 1MM3A 4WZ3B 4WZ0A 1JM7A 4I7DA 2LGLA 2YUCA 1ZBDB 2PNXA 3O33A 4Z0RA 1VD4A 1DCQA 5TRBA 2KWJA 4ZQLA 3KQIA 2JMJA 2E6RA 3FL2A 2FOJA 3MHHA 4C9ZA 3EB6A 4AVXA 2JUNA 2K1JA 2YW8A 3GL6A 3IVVA 4TKPB 5FERA 2H0DA 3HQMA 2LGKA 3O47A 3DPLR 3HQIA 4AYCB 1CA9A 2LGGA 4KG9A 4F1PA 2L75A 5EYAF 1HYIA 3FEHA 3FANA 1WEWA 1WFKA 4AYCA 2LGVA 2KWKA 3QZVA 2YHOA 3HSVA 2FUIA 2XB1A 4OGEA 5AIUA 2LDRA 4Q6FA 5FEYA 1MM2A 4IC3A 4YATA 4FK5A 2F6NA 3HU6A 1WEQA 2L43A 1LB6A 2L5UA 5LCWB 3M99A 3RPGC 4H9DA 1WGMA 2RI7A 2LN0A 2CONA 3MQRA 2EGPA 4GNEA 3O35A 2ECTA 1LDKC 2IQJA 5E1TA 5I3LA 1G25A 2MT5A 3ZJBA 3HCUA 3VK6A 2KGIA 2YURA 2VPEA 3NG2A 2FOOA 4GHUA 2G6QA 1FBVA 2VPDA 5H1TA 3U5MA 3LQHA 2QJ0A 2MKEA 2ECVA 2XOYA 2KYUA 3PURA 3MDBC 4LKAA 4UP5A 2G45A 3HCTA 2VPBA 3IVQA 4YBMA 4R8PK 4NN2A 5C11A 5D1KB 1FLKA 1WEPA 2YSJA 3E2DA 4IC2A 4K8UA 2FFWA 3KNVA 1ZMSA 4N4FA 4V3LC 3HQHA 4XI1A 3LVRE 1V87A 4OGCA 4LADB 2RR4A 2I50A 5C13A 1JM7B 1Z2QA 3MHSA 4GNGA 4UP0A 2F1YA 1U6GB 3H7HA 4B86C 4LK9A 2MNZA 2LXHC 1XWHA 1LB5A 5B79A 2E61A 2K4DA 3LDYA 3O36A 5H1UA 2A25A 3L1XA 2EGMA 1LB4A 3GV4A 2JM3A 2YYRA 2F1ZA 4YBTA 3LRQA 4A49A 3N9LA 2JMIA 2YVRA 2ECWA 2H0DB 1RF3A 3L11A 2LXPC 5FB1A 2YT5A 2EA6A 1D00A 5LKZA 5TBNA 5G04B 1N87A 1WEMA 5SVYA 3N9QA 3HCSA 1MBMA 4JJQA 4S3OC 1JOCA 3I2DA 5SVXA 2HYED 1FLLA 4LLBA 4ZUXU 5J3XA 3LQJA 4MSXA 3FJUB 2CKLA 3LJUX 3SOWA 2Y1NA 4I7BA 4YSIA 2VJEB 3ZVYA 1YY6A 5DKAA 3DDTA 1WENA 4A0CD 2OXQC 4X3GA 3O70A 2ECGA 4LJNA 2VJEA 5KH7A 2FD4A 2YQMA 2YSMA 2ECJA 4PPEA 2JRJA 2KKXA 5SVIA 1RMDA 3SOXA 4P5OB 3N9PA 1WE9A 1F3VB 3IHPA 2Y43A 2YHNA 2B0OE 1FP0A 2KWOA 2CSVA 5B75A 4YBSA 1WEOA 2BAYA 3O34A 3FAOA 5TDRA 4I7CA 4V3KC 4YAXA 1WEVA 5KH9A 5B8DA 2C2LA 3T7LA 4A4BA 4GWMA 2D8UA 2QICA 3SOUA 2P57A 2EODA 3ZPVE 4YADA 3ZTGA 1Z60A 2EXUA 2CT2A 4YC9A 2K17A 3C5KA 3LVQE 5G0FA 1WESA 4WZ2A 3Q1DA 1VFYA 2KREA 2KFTA 3RPGB 2ZETC 2L0BA 2MD7B 3N9NA 2L80A 2KKYA 2CR2A 2GKWA 1BORA 1K2FA 3U5PA 2E6SA 4FO9A 2XEUA 1CHCA 3SHBA 3M63A 5AITA 3PHDA 2KWNA 3MQSC 1YZEA 3N9OA 1D0JA 4GWNA 1HYJA 1WIMA 3LQIA 4Z0OA 2FSAA 5KH3A 2LV9A 2AN6A
chains in the Genus database with same CATH topology
2LQ6A 5LKTA 4W4UA 3HQLA 1WEUA 5FB0A 3KV5A 2M1RA 2DX8A 4O64A 5B76A 2CKLB 2M3HA 3O37A 3ASLA 4O1VA 1Z6UA 4AUQB 2VJFB 2G43A 2KIZA 2MA5A 2VPGA 2YREA 2FOPA 5D1MB 4L7XA 2VJFA 3C6WA 5H1VA 2ECNA 4UI9B 4WA6A 1L0AA 2LRIC 4QF2A 4FIPA 1WEEA 4R2YA 1CZZA 4S3OB 3KV6A 4GB0A 2HDPA 2KE1A 4YABA 5LKXA 5LKUA 2XXNA 4QF3A 1T1HA 2IDAA 1X4IA 3HTKC 2JMDA 2MNYA 2KU3A 5G05B 2F1XA 4R7EA 2YQLA 5JG6A 2D8SA 4GJHA 3ZYQA 2M85A 4F52B 2CSYA 2F1WA 1F62A 3ZVZB 2PUYA 5TDWA 2M6MA 4N3WA 2YU4A 2UZGA 2VP7A 4B7YC 5B77A 2CSZA 2VNFA 3T6RA 3DQVR 4BHWA 1VYXA 4CA1A 2QIZA 1D0AA 3PUQA 2RSDA 4L58A 2MD8C 1DVPA 3U5NA 2NAAA 2C2VS 1E4UA 4BBQA 3EB5A 2KR4A 1KZZA 5DINA 2F6JA 4FJCA 3V43A 1IYMA 5H9MA 1X4JA 2MUMA 3IVBA 4A4CA 2K16A 2F42A 3ZNIA 2MIQA 1CA4A 1D01A 4MVTA 3RTRB 2FUUA 3N9MA 2MA6A 4Z8MA 3O7AA 4AP4A 1WILA 1X4UA 5TABA 4GNFA 3M62A 2KGGA 2Y1MA 5D1LB 3U5OA 3ZPV1 1LDJB 4M4EA 3L1ZB 2ECIA 1QSCA 4PTBA 5B78A 4ZDTA 4CCGX 4GNDA 1CZYA 1MM3A 4WZ3B 4WZ0A 1JM7A 4I7DA 2LGLA 2YUCA 1ZBDB 2PNXA 3O33A 1VD4A 5TRBA 2KWJA 4ZQLA 3KQIA 2JMJA 2E6RA 3FL2A 2FOJA 3MHHA 4C9ZA 3EB6A 4AVXA 2K1JA 2YW8A 3GL6A 3IVVA 4TKPB 5FERA 2H0DA 3HQMA 2LGKA 3DPLR 3HQIA 4AYCB 1CA9A 2LGGA 4KG9A 2L75A 5EYAF 1HYIA 1WEWA 1WFKA 4AYCA 2LGVA 2KWKA 3QZVA 2YHOA 3HSVA 2FUIA 2XB1A 5AIUA 2LDRA 4Q6FA 5FEYA 1MM2A 4IC3A 4YATA 4FK5A 2F6NA 3HU6A 1WEQA 2L43A 1LB6A 2L5UA 5LCWB 3M99A 3RPGC 1WGMA 2RI7A 2LN0A 3MQRA 2EGPA 4GNEA 3O35A 2ECTA 1LDKC 5E1TA 5I3LA 1G25A 2MT5A 3ZJBA 3HCUA 3VK6A 2KGIA 2YURA 2VPEA 3NG2A 2FOOA 4GHUA 2G6QA 1FBVA 2VPDA 5H1TA 3U5MA 3LQHA 2QJ0A 2ECVA 2KYUA 3PURA 4LKAA 4UP5A 2G45A 3HCTA 2VPBA 3IVQA 4YBMA 4R8PK 4NN2A 5C11A 5D1KB 1FLKA 1WEPA 2YSJA 4IC2A 4K8UA 3KNVA 1ZMSA 4N4FA 4V3LC 3HQHA 4XI1A 1V87A 4LADB 2I50A 5C13A 1JM7B 1Z2QA 3MHSA 4GNGA 4UP0A 2F1YA 1U6GB 4B86C 4LK9A 2MNZA 2LXHC 1XWHA 1LB5A 5B79A 2K4DA 3O36A 5H1UA 2A25A 3L1XA 1LB4A 2YYRA 3GV4A 2F1ZA 4YBTA 3LRQA 4A49A 3N9LA 2JMIA 2ECWA 2H0DB 1RF3A 3L11A 2LXPC 5FB1A 2YT5A 2EA6A 1D00A 5LKZA 5TBNA 5G04B 1N87A 1WEMA 3N9QA 3HCSA 4JJQA 4S3OC 1JOCA 3I2DA 2HYED 1FLLA 4LLBA 4ZUXU 5J3XA 3LQJA 4MSXA 2CKLA 3SOWA 2Y1NA 4I7BA 4YSIA 2VJEB 3ZVYA 1YY6A 5DKAA 1WENA 4A0CD 2OXQC 4X3GA 3O70A 2ECGA 4LJNA 2VJEA 5KH7A 2YQMA 2YSMA 2ECJA 4PPEA 2JRJA 1RMDA 3SOXA 4P5OB 3N9PA 1WE9A 1F3VB 3IHPA 2Y43A 2YHNA 1FP0A 2KWOA 5B75A 4YBSA 1WEOA 2BAYA 3O34A 5TDRA 4I7CA 4V3KC 4YAXA 1WEVA 5KH9A 5B8DA 2C2LA 3T7LA 4A4BA 4GWMA 2QICA 3SOUA 2EODA 3ZPVE 4YADA 3ZTGA 1Z60A 2CT2A 4YC9A 2K17A 3C5KA 5G0FA 1WESA 4WZ2A 1VFYA 2KREA 2KFTA 3RPGB 2ZETC 2L0BA 2MD7B 3N9NA 2L80A 2CR2A 2GKWA 1BORA 1K2FA 3U5PA 2E6SA 4FO9A 2XEUA 1CHCA 3SHBA 3M63A 5AITA 3PHDA 2KWNA 3MQSC 1YZEA 3N9OA 1D0JA 4GWNA 1HYJA 1WIMA 3LQIA 2FSAA 5KH3A 2LV9A 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQ6 A;  5LKT A;  4W4U A;  3HQL A;  1WEU A;  5FB0 A;  3KV5 A;  2M1R A;  2DX8 A;  4O64 A;  5B76 A;  2CKL B;  2M3H A;  3O37 A;  3ASL A;  4O1V A;  1Z6U A;  4AUQ B;  2VJF B;  2G43 A;  2KIZ A;  2MA5 A;  2VPG A;  2YRE A;  2FOP A;  5D1M B;  4L7X A;  2VJF A;  3C6W A;  5H1V A;  2ECN A;  4UI9 B;  4WA6 A;  1L0A A;  2LRI C;  4QF2 A;  4FIP A;  1WEE A;  4R2Y A;  1CZZ A;  4S3O B;  3KV6 A;  4GB0 A;  2HDP A;  2KE1 A;  4YAB A;  5LKX A;  5LKU A;  2XXN A;  4QF3 A;  1T1H A;  2IDA A;  1X4I A;  3HTK C;  2JMD A;  2MNY A;  2KU3 A;  5G05 B;  2F1X A;  4R7E A;  2YQL A;  5JG6 A;  2D8S A;  4GJH A;  3ZYQ A;  2M85 A;  4F52 B;  2CSY A;  2F1W A;  1F62 A;  3ZVZ B;  2PUY A;  5TDW A;  2M6M A;  4N3W A;  2YU4 A;  2UZG A;  2VP7 A;  4B7Y C;  5B77 A;  2CSZ A;  2VNF A;  3T6R A;  3DQV R;  4BHW A;  1VYX A;  4CA1 A;  2QIZ A;  1D0A A;  3PUQ A;  2RSD A;  4L58 A;  2MD8 C;  1DVP A;  3U5N A;  2NAA A;  2C2V S;  1E4U A;  4BBQ A;  3EB5 A;  2KR4 A;  1KZZ A;  5DIN A;  2F6J A;  4FJC A;  3V43 A;  1IYM A;  5H9M A;  1X4J A;  2MUM A;  3IVB A;  4A4C A;  2K16 A;  2F42 A;  3ZNI A;  2MIQ A;  1CA4 A;  1D01 A;  4MVT A;  3RTR B;  2FUU A;  3N9M A;  2MA6 A;  4Z8M A;  3O7A A;  4AP4 A;  1WIL A;  1X4U A;  5TAB A;  4GNF A;  3M62 A;  2KGG A;  2Y1M A;  5D1L B;  3U5O A;  3ZPV 1;  1LDJ B;  4M4E A;  3L1Z B;  2ECI A;  1QSC A;  4PTB A;  5B78 A;  4ZDT A;  4CCG X;  4GND A;  1CZY A;  1MM3 A;  4WZ3 B;  4WZ0 A;  1JM7 A;  4I7D A;  2LGL A;  2YUC A;  1ZBD B;  2PNX A;  3O33 A;  1VD4 A;  5TRB A;  2KWJ A;  4ZQL A;  3KQI A;  2JMJ A;  2E6R A;  3FL2 A;  2FOJ A;  3MHH A;  4C9Z A;  3EB6 A;  4AVX A;  2K1J A;  2YW8 A;  3GL6 A;  3IVV A;  4TKP B;  5FER A;  2H0D A;  3HQM A;  2LGK A;  3DPL R;  3HQI A;  4AYC B;  1CA9 A;  2LGG A;  4KG9 A;  2L75 A;  5EYA F;  1HYI A;  1WEW A;  1WFK A;  4AYC A;  2LGV A;  2KWK A;  3QZV A;  2YHO A;  3HSV A;  2FUI A;  2XB1 A;  5AIU A;  2LDR A;  4Q6F A;  5FEY A;  1MM2 A;  4IC3 A;  4YAT A;  4FK5 A;  2F6N A;  3HU6 A;  1WEQ A;  2L43 A;  1LB6 A;  2L5U A;  5LCW B;  3M99 A;  3RPG C;  1WGM A;  2RI7 A;  2LN0 A;  3MQR A;  2EGP A;  4GNE A;  3O35 A;  2ECT A;  1LDK C;  5E1T A;  5I3L A;  1G25 A;  2MT5 A;  3ZJB A;  3HCU A;  3VK6 A;  2KGI A;  2YUR A;  2VPE A;  3NG2 A;  2FOO A;  4GHU A;  2G6Q A;  1FBV A;  2VPD A;  5H1T A;  3U5M A;  3LQH A;  2QJ0 A;  2ECV A;  2KYU A;  3PUR A;  4LKA A;  4UP5 A;  2G45 A;  3HCT A;  2VPB A;  3IVQ A;  4YBM A;  4R8P K;  4NN2 A;  5C11 A;  5D1K B;  1FLK A;  1WEP A;  2YSJ A;  4IC2 A;  4K8U A;  3KNV A;  1ZMS A;  4N4F A;  4V3L C;  3HQH A;  4XI1 A;  1V87 A;  4LAD B;  2I50 A;  5C13 A;  1JM7 B;  1Z2Q A;  3MHS A;  4GNG A;  4UP0 A;  2F1Y A;  1U6G B;  4B86 C;  4LK9 A;  2MNZ A;  2LXH C;  1XWH A;  1LB5 A;  5B79 A;  2K4D A;  3O36 A;  5H1U A;  2A25 A;  3L1X A;  1LB4 A;  2YYR A;  3GV4 A;  2F1Z A;  4YBT A;  3LRQ A;  4A49 A;  3N9L A;  2JMI A;  2ECW A;  2H0D B;  1RF3 A;  3L11 A;  2LXP C;  5FB1 A;  2YT5 A;  2EA6 A;  1D00 A;  5LKZ A;  5TBN A;  5G04 B;  1N87 A;  1WEM A;  3N9Q A;  3HCS A;  4JJQ A;  4S3O C;  1JOC A;  3I2D A;  2HYE D;  1FLL A;  4LLB A;  4ZUX U;  5J3X A;  3LQJ A;  4MSX A;  2CKL A;  3SOW A;  2Y1N A;  4I7B A;  4YSI A;  2VJE B;  3ZVY A;  1YY6 A;  5DKA A;  1WEN A;  4A0C D;  2OXQ C;  4X3G A;  3O70 A;  2ECG A;  4LJN A;  2VJE A;  5KH7 A;  2YQM A;  2YSM A;  2ECJ A;  4PPE A;  2JRJ A;  1RMD A;  3SOX A;  4P5O B;  3N9P A;  1WE9 A;  1F3V B;  3IHP A;  2Y43 A;  2YHN A;  1FP0 A;  2KWO A;  5B75 A;  4YBS A;  1WEO A;  2BAY A;  3O34 A;  5TDR A;  4I7C A;  4V3K C;  4YAX A;  1WEV A;  5KH9 A;  5B8D A;  2C2L A;  3T7L A;  4A4B A;  4GWM A;  2QIC A;  3SOU A;  2EOD A;  3ZPV E;  4YAD A;  3ZTG A;  1Z60 A;  2CT2 A;  4YC9 A;  2K17 A;  3C5K A;  5G0F A;  1WES A;  4WZ2 A;  1VFY A;  2KRE A;  2KFT A;  3RPG B;  2ZET C;  2L0B A;  2MD7 B;  3N9N A;  2L80 A;  2CR2 A;  2GKW A;  1BOR A;  1K2F A;  3U5P A;  2E6S A;  4FO9 A;  2XEU A;  1CHC A;  3SHB A;  3M63 A;  5AIT A;  3PHD A;  2KWN A;  3MQS C;  1YZE A;  3N9O A;  1D0J A;  4GWN A;  1HYJ A;  1WIM A;  3LQI A;  2FSA A;  5KH3 A;  2LV9 A;  2AN6 A; 
#chains in the Genus database with same CATH topology
 2LQ6 A;  5LKT A;  3PLW A;  3M7K A;  5K3Q A;  4W4U A;  3HQL A;  2M13 A;  1WEU A;  5FB0 A;  3FM8 C;  3KV5 A;  2M1R A;  2DX8 A;  4O64 A;  5B76 A;  2CKL B;  2M3H A;  3O37 A;  3ASL A;  4O1V A;  1Z6U A;  4AUQ B;  2VJF B;  2G43 A;  2KIZ A;  2LAU A;  2MA5 A;  2VPG A;  2YRE A;  2FOP A;  5D1M B;  4L7X A;  2L7P A;  2VJF A;  3C6W A;  5H1V A;  2ECN A;  4UI9 B;  4WA6 A;  1L0A A;  2LRI C;  5SVI B;  4QF2 A;  4FIP A;  4QQ4 A;  1WEE A;  4R2Y A;  1CZZ A;  4S3O B;  3KV6 A;  4GB0 A;  2HDP A;  2KE1 A;  4YAB A;  5LKX A;  5LKU A;  2CRR A;  2XOC A;  2XXN A;  2OWA A;  4QF3 A;  1T1H A;  2IDA A;  1X4I A;  3HTK C;  2JMD A;  2MNY A;  2KU3 A;  5G05 B;  2F1X A;  4R7E A;  2YQL A;  5JG6 A;  2D8S A;  4GJH A;  3ZYQ A;  2M85 A;  4F52 B;  2CSY A;  2F1W A;  4O62 A;  1F62 A;  3DWD A;  2PUY A;  3ZVZ B;  5TDW A;  2XP0 A;  2M6M A;  4N3W A;  2YU4 A;  2UZG A;  2VP7 A;  4B7Y C;  5B77 A;  2CSZ A;  2VNF A;  3T6R A;  3DQV R;  4BHW A;  1VYX A;  3SUB A;  4CA1 A;  2QIZ A;  1D0A A;  3PUQ A;  2RSD A;  4L58 A;  2MD8 C;  1DVP A;  3U5N A;  2NAA A;  2C2V S;  1E4U A;  4BBQ A;  3EB5 A;  2DSM A;  2KR4 A;  1KZZ A;  5DIN A;  2F6J A;  3KDE C;  4FJC A;  3V43 A;  1IYM A;  5H9M A;  1X4J A;  2MUM A;  3IVB A;  4A4C A;  2K16 A;  2CRW A;  2F42 A;  3ZNI A;  2MIQ A;  1CA4 A;  1D01 A;  4MVT A;  3RTR B;  3JUE A;  2FUU A;  3N9M A;  2MA6 A;  4Z8M A;  3O7A A;  4AP4 A;  1WIL A;  1X4U A;  5TAB A;  2DJA A;  4GNF A;  3M62 A;  2KGG A;  2Y1M A;  5D1L B;  2XOZ A;  3U5O A;  3ZPV 1;  1LDJ B;  4M4E A;  3L1Z B;  2ECI A;  1QSC A;  4PTB A;  5B78 A;  4ZDT A;  4CCG X;  4GND A;  1CZY A;  3T9K A;  1MM3 A;  4WZ3 B;  4WZ0 A;  1JM7 A;  4I7D A;  2LGL A;  2YUC A;  1ZBD B;  2PNX A;  3O33 A;  4Z0R A;  1VD4 A;  1DCQ A;  5TRB A;  2KWJ A;  4ZQL A;  3KQI A;  2JMJ A;  2E6R A;  3FL2 A;  2FOJ A;  3MHH A;  4C9Z A;  3EB6 A;  4AVX A;  2JUN A;  2K1J A;  2YW8 A;  3GL6 A;  3IVV A;  4TKP B;  5FER A;  2H0D A;  3HQM A;  2LGK A;  3O47 A;  3DPL R;  3HQI A;  4AYC B;  1CA9 A;  2LGG A;  4KG9 A;  4F1P A;  2L75 A;  5EYA F;  1HYI A;  3FEH A;  3FAN A;  1WEW A;  1WFK A;  4AYC A;  2LGV A;  2KWK A;  3QZV A;  2YHO A;  3HSV A;  2FUI A;  2XB1 A;  4OGE A;  5AIU A;  2LDR A;  4Q6F A;  5FEY A;  1MM2 A;  4IC3 A;  4YAT A;  4FK5 A;  2F6N A;  3HU6 A;  1WEQ A;  2L43 A;  1LB6 A;  2L5U A;  5LCW B;  3M99 A;  3RPG C;  4H9D A;  1WGM A;  2RI7 A;  2LN0 A;  2CON A;  3MQR A;  2EGP A;  4GNE A;  3O35 A;  2ECT A;  1LDK C;  2IQJ A;  5E1T A;  5I3L A;  1G25 A;  2MT5 A;  3ZJB A;  3HCU A;  3VK6 A;  2KGI A;  2YUR A;  2VPE A;  3NG2 A;  2FOO A;  4GHU A;  2G6Q A;  1FBV A;  2VPD A;  5H1T A;  3U5M A;  3LQH A;  2QJ0 A;  2MKE A;  2ECV A;  2XOY A;  2KYU A;  3PUR A;  3MDB C;  4LKA A;  4UP5 A;  2G45 A;  3HCT A;  2VPB A;  3IVQ A;  4YBM A;  4R8P K;  4NN2 A;  5C11 A;  5D1K B;  1FLK A;  1WEP A;  2YSJ A;  3E2D A;  4IC2 A;  4K8U A;  2FFW A;  3KNV A;  1ZMS A;  4N4F A;  4V3L C;  3HQH A;  4XI1 A;  3LVR E;  1V87 A;  4OGC A;  4LAD B;  2RR4 A;  2I50 A;  5C13 A;  1JM7 B;  1Z2Q A;  3MHS A;  4GNG A;  4UP0 A;  2F1Y A;  1U6G B;  3H7H A;  4B86 C;  4LK9 A;  2MNZ A;  2LXH C;  1XWH A;  1LB5 A;  5B79 A;  2E61 A;  2K4D A;  3LDY A;  3O36 A;  5H1U A;  2A25 A;  3L1X A;  2EGM A;  1LB4 A;  3GV4 A;  2JM3 A;  2YYR A;  2F1Z A;  4YBT A;  3LRQ A;  4A49 A;  3N9L A;  2JMI A;  2YVR A;  2ECW A;  2H0D B;  1RF3 A;  3L11 A;  2LXP C;  5FB1 A;  2YT5 A;  2EA6 A;  1D00 A;  5LKZ A;  5TBN A;  5G04 B;  1N87 A;  1WEM A;  5SVY A;  3N9Q A;  3HCS A;  1MBM A;  4JJQ A;  4S3O C;  1JOC A;  3I2D A;  5SVX A;  2HYE D;  1FLL A;  4LLB A;  4ZUX U;  5J3X A;  3LQJ A;  4MSX A;  3FJU B;  2CKL A;  3LJU X;  3SOW A;  2Y1N A;  4I7B A;  4YSI A;  2VJE B;  3ZVY A;  1YY6 A;  5DKA A;  3DDT A;  1WEN A;  4A0C D;  2OXQ C;  4X3G A;  3O70 A;  2ECG A;  4LJN A;  2VJE A;  5KH7 A;  2FD4 A;  2YQM A;  2YSM A;  2ECJ A;  4PPE A;  2JRJ A;  2KKX A;  5SVI A;  1RMD A;  3SOX A;  4P5O B;  3N9P A;  1WE9 A;  1F3V B;  3IHP A;  2Y43 A;  2YHN A;  2B0O E;  1FP0 A;  2KWO A;  2CSV A;  5B75 A;  4YBS A;  1WEO A;  2BAY A;  3O34 A;  3FAO A;  5TDR A;  4I7C A;  4V3K C;  4YAX A;  1WEV A;  5KH9 A;  5B8D A;  2C2L A;  3T7L A;  4A4B A;  4GWM A;  2D8U A;  2QIC A;  3SOU A;  2P57 A;  2EOD A;  3ZPV E;  4YAD A;  3ZTG A;  1Z60 A;  2EXU A;  2CT2 A;  4YC9 A;  2K17 A;  3C5K A;  3LVQ E;  5G0F A;  1WES A;  4WZ2 A;  3Q1D A;  1VFY A;  2KRE A;  2KFT A;  3RPG B;  2ZET C;  2L0B A;  2MD7 B;  3N9N A;  2L80 A;  2KKY A;  2CR2 A;  2GKW A;  1BOR A;  1K2F A;  3U5P A;  2E6S A;  4FO9 A;  2XEU A;  1CHC A;  3SHB A;  3M63 A;  5AIT A;  3PHD A;  2KWN A;  3MQS C;  1YZE A;  3N9O A;  1D0J A;  4GWN A;  1HYJ A;  1WIM A;  3LQI A;  4Z0O A;  2FSA A;  5KH3 A;  2LV9 A;  2AN6 A; 
#chains in the Genus database with same CATH homology
 2LQ6 A;  5LKT A;  4W4U A;  3HQL A;  1WEU A;  5FB0 A;  3KV5 A;  2M1R A;  2DX8 A;  4O64 A;  5B76 A;  2CKL B;  2M3H A;  3O37 A;  3ASL A;  4O1V A;  1Z6U A;  4AUQ B;  2VJF B;  2G43 A;  2KIZ A;  2MA5 A;  2VPG A;  2YRE A;  2FOP A;  5D1M B;  4L7X A;  2VJF A;  3C6W A;  5H1V A;  2ECN A;  4UI9 B;  4WA6 A;  1L0A A;  2LRI C;  4QF2 A;  4FIP A;  1WEE A;  4R2Y A;  1CZZ A;  4S3O B;  3KV6 A;  4GB0 A;  2HDP A;  2KE1 A;  4YAB A;  5LKX A;  5LKU A;  2XXN A;  4QF3 A;  1T1H A;  2IDA A;  1X4I A;  3HTK C;  2JMD A;  2MNY A;  2KU3 A;  5G05 B;  2F1X A;  4R7E A;  2YQL A;  5JG6 A;  2D8S A;  4GJH A;  3ZYQ A;  2M85 A;  4F52 B;  2CSY A;  2F1W A;  1F62 A;  3ZVZ B;  2PUY A;  5TDW A;  2M6M A;  4N3W A;  2YU4 A;  2UZG A;  2VP7 A;  4B7Y C;  5B77 A;  2CSZ A;  2VNF A;  3T6R A;  3DQV R;  4BHW A;  1VYX A;  4CA1 A;  2QIZ A;  1D0A A;  3PUQ A;  2RSD A;  4L58 A;  2MD8 C;  1DVP A;  3U5N A;  2NAA A;  2C2V S;  1E4U A;  4BBQ A;  3EB5 A;  2KR4 A;  1KZZ A;  5DIN A;  2F6J A;  4FJC A;  3V43 A;  1IYM A;  5H9M A;  1X4J A;  2MUM A;  3IVB A;  4A4C A;  2K16 A;  2F42 A;  3ZNI A;  2MIQ A;  1CA4 A;  1D01 A;  4MVT A;  3RTR B;  2FUU A;  3N9M A;  2MA6 A;  4Z8M A;  3O7A A;  4AP4 A;  1WIL A;  1X4U A;  5TAB A;  4GNF A;  3M62 A;  2KGG A;  2Y1M A;  5D1L B;  3U5O A;  3ZPV 1;  1LDJ B;  4M4E A;  3L1Z B;  2ECI A;  1QSC A;  4PTB A;  5B78 A;  4ZDT A;  4CCG X;  4GND A;  1CZY A;  1MM3 A;  4WZ3 B;  4WZ0 A;  1JM7 A;  4I7D A;  2LGL A;  2YUC A;  1ZBD B;  2PNX A;  3O33 A;  1VD4 A;  5TRB A;  2KWJ A;  4ZQL A;  3KQI A;  2JMJ A;  2E6R A;  3FL2 A;  2FOJ A;  3MHH A;  4C9Z A;  3EB6 A;  4AVX A;  2K1J A;  2YW8 A;  3GL6 A;  3IVV A;  4TKP B;  5FER A;  2H0D A;  3HQM A;  2LGK A;  3DPL R;  3HQI A;  4AYC B;  1CA9 A;  2LGG A;  4KG9 A;  2L75 A;  5EYA F;  1HYI A;  1WEW A;  1WFK A;  4AYC A;  2LGV A;  2KWK A;  3QZV A;  2YHO A;  3HSV A;  2FUI A;  2XB1 A;  5AIU A;  2LDR A;  4Q6F A;  5FEY A;  1MM2 A;  4IC3 A;  4YAT A;  4FK5 A;  2F6N A;  3HU6 A;  1WEQ A;  2L43 A;  1LB6 A;  2L5U A;  5LCW B;  3M99 A;  3RPG C;  1WGM A;  2RI7 A;  2LN0 A;  3MQR A;  2EGP A;  4GNE A;  3O35 A;  2ECT A;  1LDK C;  5E1T A;  5I3L A;  1G25 A;  2MT5 A;  3ZJB A;  3HCU A;  3VK6 A;  2KGI A;  2YUR A;  2VPE A;  3NG2 A;  2FOO A;  4GHU A;  2G6Q A;  1FBV A;  2VPD A;  5H1T A;  3U5M A;  3LQH A;  2QJ0 A;  2ECV A;  2KYU A;  3PUR A;  4LKA A;  4UP5 A;  2G45 A;  3HCT A;  2VPB A;  3IVQ A;  4YBM A;  4R8P K;  4NN2 A;  5C11 A;  5D1K B;  1FLK A;  1WEP A;  2YSJ A;  4IC2 A;  4K8U A;  3KNV A;  1ZMS A;  4N4F A;  4V3L C;  3HQH A;  4XI1 A;  1V87 A;  4LAD B;  2I50 A;  5C13 A;  1JM7 B;  1Z2Q A;  3MHS A;  4GNG A;  4UP0 A;  2F1Y A;  1U6G B;  4B86 C;  4LK9 A;  2MNZ A;  2LXH C;  1XWH A;  1LB5 A;  5B79 A;  2K4D A;  3O36 A;  5H1U A;  2A25 A;  3L1X A;  1LB4 A;  2YYR A;  3GV4 A;  2F1Z A;  4YBT A;  3LRQ A;  4A49 A;  3N9L A;  2JMI A;  2ECW A;  2H0D B;  1RF3 A;  3L11 A;  2LXP C;  5FB1 A;  2YT5 A;  2EA6 A;  1D00 A;  5LKZ A;  5TBN A;  5G04 B;  1N87 A;  1WEM A;  3N9Q A;  3HCS A;  4JJQ A;  4S3O C;  1JOC A;  3I2D A;  2HYE D;  1FLL A;  4LLB A;  4ZUX U;  5J3X A;  3LQJ A;  4MSX A;  2CKL A;  3SOW A;  2Y1N A;  4I7B A;  4YSI A;  2VJE B;  3ZVY A;  1YY6 A;  5DKA A;  1WEN A;  4A0C D;  2OXQ C;  4X3G A;  3O70 A;  2ECG A;  4LJN A;  2VJE A;  5KH7 A;  2YQM A;  2YSM A;  2ECJ A;  4PPE A;  2JRJ A;  1RMD A;  3SOX A;  4P5O B;  3N9P A;  1WE9 A;  1F3V B;  3IHP A;  2Y43 A;  2YHN A;  1FP0 A;  2KWO A;  5B75 A;  4YBS A;  1WEO A;  2BAY A;  3O34 A;  5TDR A;  4I7C A;  4V3K C;  4YAX A;  1WEV A;  5KH9 A;  5B8D A;  2C2L A;  3T7L A;  4A4B A;  4GWM A;  2QIC A;  3SOU A;  2EOD A;  3ZPV E;  4YAD A;  3ZTG A;  1Z60 A;  2CT2 A;  4YC9 A;  2K17 A;  3C5K A;  5G0F A;  1WES A;  4WZ2 A;  1VFY A;  2KRE A;  2KFT A;  3RPG B;  2ZET C;  2L0B A;  2MD7 B;  3N9N A;  2L80 A;  2CR2 A;  2GKW A;  1BOR A;  1K2F A;  3U5P A;  2E6S A;  4FO9 A;  2XEU A;  1CHC A;  3SHB A;  3M63 A;  5AIT A;  3PHD A;  2KWN A;  3MQS C;  1YZE A;  3N9O A;  1D0J A;  4GWN A;  1HYJ A;  1WIM A;  3LQI A;  2FSA A;  5KH3 A;  2LV9 A;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...