1K2FA

Siah, seven in absentia homolog
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
190
structure length
190
Chain Sequence
SVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords siah-1A protein
publication title Siah ubiquitin ligase is structurally related to TRAF and modulates TNF-alpha signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase, protein binding
total genus 39
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 1k2fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1k2fA02
1X4UA 3NG2A 2L5UA 3O33A 2CSYA 4GNGA 5DINA 2LQ6A 1E4UA 3HCSA 2L80A 3N9OA 2HYED 4LLBA 4ZQLA 3LRQA 3ZPV1 1U6GB 4QF2A 2F6NA 1FLKA 1D01A 5C13A 1QSCA 3ZNIA 4NN2A 2FUIA 2H0DA 2F6JA 2K17A 1Z60A 1Z6UA 5B8DA 1X4IA 3ZPVE 1F3VB 3M99A 4S3OB 1WEUA 3RPGB 3DPLR 1CHCA 4P5OB 2CKLB 4YBSA 2MA6A 2F1ZA 1JOCA 2XXNA 3RTRB 2LGGA 2Y43A 3FL2A 2KR4A 3VK6A 4FK5A 1WFKA 1WEOA 4F52B 2EODA 2UZGA 5C11A 2KWOA 3KV5A 5TDRA 3IVBA 4QF3A 4B86C 2LGLA 2FSAA 5G0FA 3T6RA 4FIPA 5FERA 3EB5A 5LKZA 2PUYA 3SHBA 1YZEA 3HTKC 1HYJA 2LN0A 2YHNA 4I7BA 4YADA 4A49A 3GL6A 3V43A 3L11A 1X4JA 1WEEA 1N87A 1ZMSA 3HCTA 1JM7A 2ECGA 2C2VS 1D0JA 2VNFA 3LQJA 5B75A 5G04B 4W4UA 2FOJA 2KREA 3I2DA 2K1JA 1XWHA 2F1YA 2YSJA 2MIQA 2XEUA 4AP4A 2F1WA 2EA6A 1WEWA 3SOWA 4UP5A 3C6WA 2Y1MA 3HQLA 3HU6A 1D00A 3RPGC 2VJEB 4X3GA 3PHDA 3O70A 3IHPA 2KU3A 2FUUA 2KWJA 2KGIA 3HSVA 1WGMA 2K16A 2L0BA 2G6QA 5AITA 3HQIA 1MM3A 4A0CD 4AYCB 1WILA 5G05B 4WA6A 4GB0A 4V3KC 1HYIA 2G43A 4ZUXU 2JMJA 5FB1A 2M1RA 4L58A 2YW8A 4YSIA 3EB6A 5B79A 2YYRA 4WZ2A 4ZDTA 4R8PK 1Z2QA 2ECWA 5FEYA 4I7DA 5LCWB 2G45A 3SOUA 3ZTGA 4BBQA 1LDKC 4LKAA 4M4EA 2MD8C 3DQVR 3PURA 2YREA 2KYUA 4IC2A 4A4CA 3KV6A 1RF3A 4Z8MA 2E6SA 4JJQA 1LDJB 5KH9A 5D1LB 1WEPA 5I3LA 1FP0A 4PTBA 2OXQC 1V87A 2MUMA 4R7EA 3U5PA 5AIUA 3PUQA 3QZVA 3LQHA 2MD7B 2YT5A 1CA9A 3N9NA 2VPBA 2KE1A 5JG6A 1WESA 2CSZA 2VJFB 2VPGA 2JRJA 5J3XA 2M3HA 4N4FA 4K8UA 3C5KA 4O1VA 3ZJBA 2RSDA 5FB0A 5TABA 2MT5A 3MHSA 4FJCA 2E6RA 4YATA 2DX8A 2CKLA 2YHOA 5D1MB 1T1HA 2NAAA 5TDWA 4Q6FA 2LDRA 4LJNA 4O64A 2JMDA 1FLLA 5TRBA 4GJHA 3GV4A 4UP0A 3N9LA 3M63A 1WE9A 1YY6A 2ECJA 2LGVA 2ZETC 2GKWA 4YABA 2KGGA 2KWKA 3MQSC 2ECTA 4UI9B 2EGPA 2CT2A 2YURA 4GHUA 4WZ0A 1L0AA 2JMIA 5TBNA 1LB5A 5H1TA 3LQIA 1VYXA 3L1ZB 2Y1NA 4S3OC 3L1XA 4GNEA 2YQLA 5DKAA 2YSMA 5LKXA 4LK9A 1WEQA 4A4BA 2L43A 2LRIC 3KQIA 2QIZA 1F62A 4BHWA 1G25A 2F42A 4GNFA 1FBVA 4XI1A 1LB6A 2LXPC 1WEMA 3O35A 2MNZA 5KH7A 2MA5A 3SOXA 2FOOA 2H0DB 4N3WA 4V3LC 2KWNA 1MM2A 2VJEA 1RMDA 1IYMA 1CA4A 2I50A 4I7CA 4PPEA 3N9MA 4KG9A 3N9PA 2RI7A 2VP7A 2C2LA 5H9MA 4GWMA 2M6MA 4AYCA 2A25A 2XB1A 4B7YC 4CCGX 1LB4A 5KH3A 1D0AA 2F1XA 5LKUA 2VPDA 2KIZA 3HCUA 3O37A 3ZVZB 2AN6A 2M85A 4C9ZA 1VFYA 5B77A 3HQMA 2QJ0A 5H1VA 1K2FA 3O36A 4MSXA 3T7LA 5EYAF 3ZVYA 1WENA 1VD4A 1JM7B 5LKTA 4L7XA 2LGKA 4CA1A 1CZYA 2QICA 4GWNA 5H1UA 2IDAA 4R2YA 4AUQB 1WIMA 3IVVA 3ZYQA 4TKPB 2D8SA 1CZZA 2L75A 2VJFA 2ECVA 1ZBDB 3M62A 5E1TA 2YQMA 2K4DA 3MQRA 3U5MA 4LADB 2FOPA 4YBMA 5B76A 3IVQA 5D1KB 4AVXA 4IC3A 4MVTA 2HDPA 1WEVA 3U5NA 2VPEA 3U5OA 1BORA 2MNYA 2KFTA 2ECNA 2LXHC 4YAXA 1KZZA 2CR2A 3ASLA 4WZ3B 2YU4A 2PNXA 3O34A 2ECIA 2YUCA 4YC9A 2BAYA 1DVPA 5B78A 4FO9A 3MHHA 3N9QA 3KNVA 3O7AA 2LV9A 4GNDA 4YBTA 3HQHA
chains in the Genus database with same CATH superfamily
1X4UA 3NG2A 2L5UA 3O33A 2CSYA 4GNGA 5DINA 3T9KA 2YVRA 2LQ6A 1E4UA 3HCSA 2L80A 3N9OA 2HYED 4LLBA 2KKXA 4ZQLA 3LRQA 3ZPV1 1U6GB 4QF2A 2F6NA 1FLKA 1D01A 5C13A 1QSCA 3ZNIA 4NN2A 2FUIA 2H0DA 2F6JA 2K17A 1Z60A 1Z6UA 5B8DA 1X4IA 3ZPVE 3H7HA 1F3VB 3M99A 4S3OB 1WEUA 3RPGB 3DPLR 1CHCA 3LDYA 4P5OB 2CKLB 4YBSA 2MA6A 2F1ZA 1JOCA 2XXNA 3RTRB 2LGGA 2Y43A 3FL2A 2KR4A 3VK6A 4FK5A 1WFKA 1WEOA 4F52B 2EODA 2UZGA 5C11A 2KWOA 3KV5A 5TDRA 3IVBA 4QF3A 4B86C 2B0OE 2LGLA 3FM8C 2D8UA 2FSAA 5G0FA 3T6RA 4OGCA 4FIPA 5FERA 3EB5A 5LKZA 2PUYA 3SHBA 1YZEA 2EGMA 3HTKC 1HYJA 2LN0A 2YHNA 4O62A 1MBMA 4I7BA 4YADA 4A49A 3GL6A 3V43A 3L11A 1X4JA 1WEEA 1N87A 1ZMSA 3HCTA 1JM7A 2ECGA 2C2VS 1D0JA 2VNFA 5SVIA 3DDTA 3LQJA 5B75A 5G04B 4W4UA 2FOJA 2KREA 3LVRE 3I2DA 2K1JA 1XWHA 4H9DA 2P57A 2F1YA 2YSJA 2MIQA 2RR4A 2XEUA 4AP4A 2F1WA 2EA6A 1WEWA 3SOWA 4UP5A 3C6WA 2Y1MA 3HQLA 3HU6A 2XP0A 1D00A 3RPGC 2VJEB 4X3GA 3PHDA 3O70A 3IHPA 2KU3A 2FUUA 2KWJA 2KGIA 3HSVA 1WGMA 2K16A 2L0BA 2G6QA 2DJAA 5AITA 3HQIA 1MM3A 4A0CD 4AYCB 1WILA 5G05B 4WA6A 4GB0A 3O47A 4V3KC 1HYIA 2G43A 4ZUXU 2JMJA 5FB1A 2M1RA 1DCQA 4L58A 2YW8A 4YSIA 3EB6A 5B79A 2CRRA 2YYRA 4WZ2A 4ZDTA 4R8PK 1Z2QA 2ECWA 5FEYA 4QQ4A 2XOZA 4I7DA 5LCWB 2G45A 3SOUA 3ZTGA 4BBQA 1LDKC 4M4EA 4LKAA 2MD8C 3DQVR 3PURA 2EXUA 2YREA 2KYUA 4IC2A 4A4CA 3KV6A 1RF3A 4Z8MA 2E61A 2E6SA 4JJQA 3JUEA 1LDJB 5KH9A 5D1LB 1WEPA 5I3LA 2IQJA 1FP0A 4PTBA 2OXQC 1V87A 2MUMA 4R7EA 3U5PA 5AIUA 3PUQA 3QZVA 3LQHA 2MD7B 2YT5A 1CA9A 3N9NA 2VPBA 2KE1A 5JG6A 1WESA 2CSZA 2VJFB 2VPGA 2JRJA 5J3XA 2M3HA 4N4FA 4K8UA 3C5KA 4O1VA 3ZJBA 2RSDA 5FB0A 5TABA 2MT5A 3MHSA 4FJCA 2E6RA 2L7PA 4YATA 2DX8A 2CKLA 2YHOA 5D1MB 1T1HA 2NAAA 3FAOA 5TDWA 2JM3A 4Q6FA 2LDRA 4LJNA 4O64A 2JMDA 1FLLA 5TRBA 4GJHA 3GV4A 4UP0A 3N9LA 3M63A 1WE9A 1YY6A 3MDBC 3FANA 2ECJA 2LGVA 2ZETC 2GKWA 4YABA 2KGGA 2MKEA 2KWKA 3MQSC 2ECTA 4UI9B 2EGPA 2CT2A 2YURA 4GHUA 3FEHA 4WZ0A 1L0AA 2JMIA 2M13A 5TBNA 1LB5A 5H1TA 3LQIA 1VYXA 3L1ZB 2Y1NA 2XOYA 3LJUX 4S3OC 3L1XA 4GNEA 2YQLA 5DKAA 2YSMA 5LKXA 4LK9A 1WEQA 4A4BA 2L43A 2LRIC 3KQIA 2QIZA 1F62A 4BHWA 1G25A 2F42A 4GNFA 1FBVA 4XI1A 1LB6A 2LXPC 1WEMA 3O35A 2MNZA 4F1PA 5KH7A 2MA5A 3SOXA 2JUNA 2FOOA 2H0DB 5K3QA 2CONA 4N3WA 4V3LC 2KWNA 1MM2A 2VJEA 1RMDA 1IYMA 1CA4A 2I50A 4I7CA 4PPEA 3N9MA 4KG9A 3N9PA 3M7KA 2LAUA 2RI7A 2VP7A 2C2LA 5H9MA 4GWMA 2M6MA 4AYCA 2A25A 2XB1A 4B7YC 4CCGX 1LB4A 5KH3A 1D0AA 3SUBA 2F1XA 5LKUA 2VPDA 2KIZA 3HCUA 3O37A 3ZVZB 2AN6A 5SVXA 2M85A 4C9ZA 1VFYA 5B77A 3HQMA 3Q1DA 2KKYA 2QJ0A 5H1VA 1K2FA 3DWDA 3O36A 4MSXA 5SVYA 3T7LA 5EYAF 3ZVYA 4Z0RA 2CSVA 1WENA 3PLWA 4OGEA 1VD4A 1JM7B 5LKTA 5SVIB 4L7XA 2LGKA 4CA1A 1CZYA 2QICA 2OWAA 4GWNA 5H1UA 2IDAA 4R2YA 4AUQB 1WIMA 3IVVA 3ZYQA 4TKPB 2D8SA 1CZZA 2L75A 2FD4A 2VJFA 2ECVA 1ZBDB 3M62A 5E1TA 2YQMA 2K4DA 3MQRA 4Z0OA 3U5MA 4LADB 2FOPA 4YBMA 5B76A 2DSMA 2CRWA 2FFWA 3IVQA 5D1KB 3KDEC 4AVXA 4IC3A 4MVTA 2HDPA 1WEVA 3U5NA 2VPEA 3FJUB 3U5OA 1BORA 2MNYA 2KFTA 2ECNA 2LXHC 4YAXA 3E2DA 1KZZA 2CR2A 3ASLA 4WZ3B 2YU4A 2PNXA 3O34A 2ECIA 2YUCA 4YC9A 2BAYA 1DVPA 5B78A 4FO9A 3MHHA 3N9QA 3KNVA 2XOCA 3LVQE 3O7AA 2LV9A 4GNDA 4YBTA 3HQHA
chains in the Genus database with same CATH topology
1X4UA 3NG2A 2L5UA 3O33A 2CSYA 4GNGA 5DINA 2LQ6A 1E4UA 3HCSA 2L80A 3N9OA 2HYED 4LLBA 4ZQLA 3LRQA 3ZPV1 1U6GB 4QF2A 2F6NA 1FLKA 1D01A 5C13A 1QSCA 3ZNIA 4NN2A 2FUIA 2H0DA 2F6JA 2K17A 1Z60A 1Z6UA 5B8DA 1X4IA 3ZPVE 1F3VB 3M99A 4S3OB 1WEUA 3RPGB 3DPLR 1CHCA 4P5OB 2CKLB 4YBSA 2MA6A 2F1ZA 1JOCA 2XXNA 3RTRB 2LGGA 2Y43A 3FL2A 2KR4A 3VK6A 4FK5A 1WFKA 1WEOA 4F52B 2EODA 2UZGA 5C11A 2KWOA 3KV5A 5TDRA 3IVBA 4QF3A 4B86C 2LGLA 2FSAA 5G0FA 3T6RA 4FIPA 5FERA 3EB5A 5LKZA 2PUYA 3SHBA 1YZEA 3HTKC 1HYJA 2LN0A 2YHNA 4I7BA 4YADA 4A49A 3GL6A 3V43A 3L11A 1X4JA 1WEEA 1N87A 1ZMSA 3HCTA 1JM7A 2ECGA 2C2VS 1D0JA 2VNFA 3LQJA 5B75A 5G04B 4W4UA 2FOJA 2KREA 3I2DA 2K1JA 1XWHA 2F1YA 2YSJA 2MIQA 2XEUA 4AP4A 2F1WA 2EA6A 1WEWA 3SOWA 4UP5A 3C6WA 2Y1MA 3HQLA 3HU6A 1D00A 3RPGC 2VJEB 4X3GA 3PHDA 3O70A 3IHPA 2KU3A 2FUUA 2KWJA 2KGIA 3HSVA 1WGMA 2K16A 2L0BA 2G6QA 5AITA 3HQIA 1MM3A 4A0CD 4AYCB 1WILA 5G05B 4WA6A 4GB0A 4V3KC 1HYIA 2G43A 4ZUXU 2JMJA 5FB1A 2M1RA 4L58A 2YW8A 4YSIA 3EB6A 5B79A 2YYRA 4WZ2A 4ZDTA 4R8PK 1Z2QA 2ECWA 5FEYA 4I7DA 5LCWB 2G45A 3SOUA 3ZTGA 4BBQA 1LDKC 4LKAA 4M4EA 2MD8C 3DQVR 3PURA 2YREA 2KYUA 4IC2A 4A4CA 3KV6A 1RF3A 4Z8MA 2E6SA 4JJQA 1LDJB 5KH9A 5D1LB 1WEPA 5I3LA 1FP0A 4PTBA 2OXQC 1V87A 2MUMA 4R7EA 3U5PA 5AIUA 3PUQA 3QZVA 3LQHA 2MD7B 2YT5A 1CA9A 3N9NA 2VPBA 2KE1A 5JG6A 1WESA 2CSZA 2VJFB 2VPGA 2JRJA 5J3XA 2M3HA 4N4FA 4K8UA 3C5KA 4O1VA 3ZJBA 2RSDA 5FB0A 5TABA 2MT5A 3MHSA 4FJCA 2E6RA 4YATA 2DX8A 2CKLA 2YHOA 5D1MB 1T1HA 2NAAA 5TDWA 4Q6FA 2LDRA 4LJNA 4O64A 2JMDA 1FLLA 5TRBA 4GJHA 3GV4A 4UP0A 3N9LA 3M63A 1WE9A 1YY6A 2ECJA 2LGVA 2ZETC 2GKWA 4YABA 2KGGA 2KWKA 3MQSC 2ECTA 4UI9B 2EGPA 2CT2A 2YURA 4GHUA 4WZ0A 1L0AA 2JMIA 5TBNA 1LB5A 5H1TA 3LQIA 1VYXA 3L1ZB 2Y1NA 4S3OC 3L1XA 4GNEA 2YQLA 5DKAA 2YSMA 5LKXA 4LK9A 1WEQA 4A4BA 2L43A 2LRIC 3KQIA 2QIZA 1F62A 4BHWA 1G25A 2F42A 4GNFA 1FBVA 4XI1A 1LB6A 2LXPC 1WEMA 3O35A 2MNZA 5KH7A 2MA5A 3SOXA 2FOOA 2H0DB 4N3WA 4V3LC 2KWNA 1MM2A 2VJEA 1RMDA 1IYMA 1CA4A 2I50A 4I7CA 4PPEA 3N9MA 4KG9A 3N9PA 2RI7A 2VP7A 2C2LA 5H9MA 4GWMA 2M6MA 4AYCA 2A25A 2XB1A 4B7YC 4CCGX 1LB4A 5KH3A 1D0AA 2F1XA 5LKUA 2VPDA 2KIZA 3HCUA 3O37A 3ZVZB 2AN6A 2M85A 4C9ZA 1VFYA 5B77A 3HQMA 2QJ0A 5H1VA 1K2FA 3O36A 4MSXA 3T7LA 5EYAF 3ZVYA 1WENA 1VD4A 1JM7B 5LKTA 4L7XA 2LGKA 4CA1A 1CZYA 2QICA 4GWNA 5H1UA 2IDAA 4R2YA 4AUQB 1WIMA 3IVVA 3ZYQA 4TKPB 2D8SA 1CZZA 2L75A 2VJFA 2ECVA 1ZBDB 3M62A 5E1TA 2YQMA 2K4DA 3MQRA 3U5MA 4LADB 2FOPA 4YBMA 5B76A 3IVQA 5D1KB 4AVXA 4IC3A 4MVTA 2HDPA 1WEVA 3U5NA 2VPEA 3U5OA 1BORA 2MNYA 2KFTA 2ECNA 2LXHC 4YAXA 1KZZA 2CR2A 3ASLA 4WZ3B 2YU4A 2PNXA 3O34A 2ECIA 2YUCA 4YC9A 2BAYA 1DVPA 5B78A 4FO9A 3MHHA 3N9QA 3KNVA 3O7AA 2LV9A 4GNDA 4YBTA 3HQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4U A;  3NG2 A;  2L5U A;  3O33 A;  2CSY A;  4GNG A;  5DIN A;  2LQ6 A;  1E4U A;  3HCS A;  2L80 A;  3N9O A;  2HYE D;  4LLB A;  4ZQL A;  3LRQ A;  3ZPV 1;  1U6G B;  4QF2 A;  2F6N A;  1FLK A;  1D01 A;  5C13 A;  1QSC A;  3ZNI A;  4NN2 A;  2FUI A;  2H0D A;  2F6J A;  2K17 A;  1Z60 A;  1Z6U A;  5B8D A;  1X4I A;  3ZPV E;  1F3V B;  3M99 A;  4S3O B;  1WEU A;  3RPG B;  3DPL R;  1CHC A;  4P5O B;  2CKL B;  4YBS A;  2MA6 A;  2F1Z A;  1JOC A;  2XXN A;  3RTR B;  2LGG A;  2Y43 A;  3FL2 A;  2KR4 A;  3VK6 A;  4FK5 A;  1WFK A;  1WEO A;  4F52 B;  2EOD A;  2UZG A;  5C11 A;  2KWO A;  3KV5 A;  5TDR A;  3IVB A;  4QF3 A;  4B86 C;  2LGL A;  2FSA A;  5G0F A;  3T6R A;  4FIP A;  5FER A;  3EB5 A;  5LKZ A;  2PUY A;  3SHB A;  1YZE A;  3HTK C;  1HYJ A;  2LN0 A;  2YHN A;  4I7B A;  4YAD A;  4A49 A;  3GL6 A;  3V43 A;  3L11 A;  1X4J A;  1WEE A;  1N87 A;  1ZMS A;  3HCT A;  1JM7 A;  2ECG A;  2C2V S;  1D0J A;  2VNF A;  3LQJ A;  5B75 A;  5G04 B;  4W4U A;  2FOJ A;  2KRE A;  3I2D A;  2K1J A;  1XWH A;  2F1Y A;  2YSJ A;  2MIQ A;  2XEU A;  4AP4 A;  2F1W A;  2EA6 A;  1WEW A;  3SOW A;  4UP5 A;  3C6W A;  2Y1M A;  3HQL A;  3HU6 A;  1D00 A;  3RPG C;  2VJE B;  4X3G A;  3PHD A;  3O70 A;  3IHP A;  2KU3 A;  2FUU A;  2KWJ A;  2KGI A;  3HSV A;  1WGM A;  2K16 A;  2L0B A;  2G6Q A;  5AIT A;  3HQI A;  1MM3 A;  4A0C D;  4AYC B;  1WIL A;  5G05 B;  4WA6 A;  4GB0 A;  4V3K C;  1HYI A;  2G43 A;  4ZUX U;  2JMJ A;  5FB1 A;  2M1R A;  4L58 A;  2YW8 A;  4YSI A;  3EB6 A;  5B79 A;  2YYR A;  4WZ2 A;  4ZDT A;  4R8P K;  1Z2Q A;  2ECW A;  5FEY A;  4I7D A;  5LCW B;  2G45 A;  3SOU A;  3ZTG A;  4BBQ A;  1LDK C;  4LKA A;  4M4E A;  2MD8 C;  3DQV R;  3PUR A;  2YRE A;  2KYU A;  4IC2 A;  4A4C A;  3KV6 A;  1RF3 A;  4Z8M A;  2E6S A;  4JJQ A;  1LDJ B;  5KH9 A;  5D1L B;  1WEP A;  5I3L A;  1FP0 A;  4PTB A;  2OXQ C;  1V87 A;  2MUM A;  4R7E A;  3U5P A;  5AIU A;  3PUQ A;  3QZV A;  3LQH A;  2MD7 B;  2YT5 A;  1CA9 A;  3N9N A;  2VPB A;  2KE1 A;  5JG6 A;  1WES A;  2CSZ A;  2VJF B;  2VPG A;  2JRJ A;  5J3X A;  2M3H A;  4N4F A;  4K8U A;  3C5K A;  4O1V A;  3ZJB A;  2RSD A;  5FB0 A;  5TAB A;  2MT5 A;  3MHS A;  4FJC A;  2E6R A;  4YAT A;  2DX8 A;  2CKL A;  2YHO A;  5D1M B;  1T1H A;  2NAA A;  5TDW A;  4Q6F A;  2LDR A;  4LJN A;  4O64 A;  2JMD A;  1FLL A;  5TRB A;  4GJH A;  3GV4 A;  4UP0 A;  3N9L A;  3M63 A;  1WE9 A;  1YY6 A;  2ECJ A;  2LGV A;  2ZET C;  2GKW A;  4YAB A;  2KGG A;  2KWK A;  3MQS C;  2ECT A;  4UI9 B;  2EGP A;  2CT2 A;  2YUR A;  4GHU A;  4WZ0 A;  1L0A A;  2JMI A;  5TBN A;  1LB5 A;  5H1T A;  3LQI A;  1VYX A;  3L1Z B;  2Y1N A;  4S3O C;  3L1X A;  4GNE A;  2YQL A;  5DKA A;  2YSM A;  5LKX A;  4LK9 A;  1WEQ A;  4A4B A;  2L43 A;  2LRI C;  3KQI A;  2QIZ A;  1F62 A;  4BHW A;  1G25 A;  2F42 A;  4GNF A;  1FBV A;  4XI1 A;  1LB6 A;  2LXP C;  1WEM A;  3O35 A;  2MNZ A;  5KH7 A;  2MA5 A;  3SOX A;  2FOO A;  2H0D B;  4N3W A;  4V3L C;  2KWN A;  1MM2 A;  2VJE A;  1RMD A;  1IYM A;  1CA4 A;  2I50 A;  4I7C A;  4PPE A;  3N9M A;  4KG9 A;  3N9P A;  2RI7 A;  2VP7 A;  2C2L A;  5H9M A;  4GWM A;  2M6M A;  4AYC A;  2A25 A;  2XB1 A;  4B7Y C;  4CCG X;  1LB4 A;  5KH3 A;  1D0A A;  2F1X A;  5LKU A;  2VPD A;  2KIZ A;  3HCU A;  3O37 A;  3ZVZ B;  2AN6 A;  2M85 A;  4C9Z A;  1VFY A;  5B77 A;  3HQM A;  2QJ0 A;  5H1V A;  1K2F A;  3O36 A;  4MSX A;  3T7L A;  5EYA F;  3ZVY A;  1WEN A;  1VD4 A;  1JM7 B;  5LKT A;  4L7X A;  2LGK A;  4CA1 A;  1CZY A;  2QIC A;  4GWN A;  5H1U A;  2IDA A;  4R2Y A;  4AUQ B;  1WIM A;  3IVV A;  3ZYQ A;  4TKP B;  2D8S A;  1CZZ A;  2L75 A;  2VJF A;  2ECV A;  1ZBD B;  3M62 A;  5E1T A;  2YQM A;  2K4D A;  3MQR A;  3U5M A;  4LAD B;  2FOP A;  4YBM A;  5B76 A;  3IVQ A;  5D1K B;  4AVX A;  4IC3 A;  4MVT A;  2HDP A;  1WEV A;  3U5N A;  2VPE A;  3U5O A;  1BOR A;  2MNY A;  2KFT A;  2ECN A;  2LXH C;  4YAX A;  1KZZ A;  2CR2 A;  3ASL A;  4WZ3 B;  2YU4 A;  2PNX A;  3O34 A;  2ECI A;  2YUC A;  4YC9 A;  2BAY A;  1DVP A;  5B78 A;  4FO9 A;  3MHH A;  3N9Q A;  3KNV A;  3O7A A;  2LV9 A;  4GND A;  4YBT A;  3HQH A; 
#chains in the Genus database with same CATH topology
 1X4U A;  3NG2 A;  2L5U A;  3O33 A;  2CSY A;  4GNG A;  5DIN A;  3T9K A;  2YVR A;  2LQ6 A;  1E4U A;  3HCS A;  2L80 A;  3N9O A;  2HYE D;  4LLB A;  2KKX A;  4ZQL A;  3LRQ A;  3ZPV 1;  1U6G B;  4QF2 A;  2F6N A;  1FLK A;  1D01 A;  5C13 A;  1QSC A;  3ZNI A;  4NN2 A;  2FUI A;  2H0D A;  2F6J A;  2K17 A;  1Z60 A;  1Z6U A;  5B8D A;  1X4I A;  3ZPV E;  3H7H A;  1F3V B;  3M99 A;  4S3O B;  1WEU A;  3RPG B;  3DPL R;  1CHC A;  3LDY A;  4P5O B;  2CKL B;  4YBS A;  2MA6 A;  2F1Z A;  1JOC A;  2XXN A;  3RTR B;  2LGG A;  2Y43 A;  3FL2 A;  2KR4 A;  3VK6 A;  4FK5 A;  1WFK A;  1WEO A;  4F52 B;  2EOD A;  2UZG A;  5C11 A;  2KWO A;  3KV5 A;  5TDR A;  3IVB A;  4QF3 A;  4B86 C;  2B0O E;  2LGL A;  3FM8 C;  2D8U A;  2FSA A;  5G0F A;  3T6R A;  4OGC A;  4FIP A;  5FER A;  3EB5 A;  5LKZ A;  2PUY A;  3SHB A;  1YZE A;  2EGM A;  3HTK C;  1HYJ A;  2LN0 A;  2YHN A;  4O62 A;  1MBM A;  4I7B A;  4YAD A;  4A49 A;  3GL6 A;  3V43 A;  3L11 A;  1X4J A;  1WEE A;  1N87 A;  1ZMS A;  3HCT A;  1JM7 A;  2ECG A;  2C2V S;  1D0J A;  2VNF A;  5SVI A;  3DDT A;  3LQJ A;  5B75 A;  5G04 B;  4W4U A;  2FOJ A;  2KRE A;  3LVR E;  3I2D A;  2K1J A;  1XWH A;  4H9D A;  2P57 A;  2F1Y A;  2YSJ A;  2MIQ A;  2RR4 A;  2XEU A;  4AP4 A;  2F1W A;  2EA6 A;  1WEW A;  3SOW A;  4UP5 A;  3C6W A;  2Y1M A;  3HQL A;  3HU6 A;  2XP0 A;  1D00 A;  3RPG C;  2VJE B;  4X3G A;  3PHD A;  3O70 A;  3IHP A;  2KU3 A;  2FUU A;  2KWJ A;  2KGI A;  3HSV A;  1WGM A;  2K16 A;  2L0B A;  2G6Q A;  2DJA A;  5AIT A;  3HQI A;  1MM3 A;  4A0C D;  4AYC B;  1WIL A;  5G05 B;  4WA6 A;  4GB0 A;  3O47 A;  4V3K C;  1HYI A;  2G43 A;  4ZUX U;  2JMJ A;  5FB1 A;  2M1R A;  1DCQ A;  4L58 A;  2YW8 A;  4YSI A;  3EB6 A;  5B79 A;  2CRR A;  2YYR A;  4WZ2 A;  4ZDT A;  4R8P K;  1Z2Q A;  2ECW A;  5FEY A;  4QQ4 A;  2XOZ A;  4I7D A;  5LCW B;  2G45 A;  3SOU A;  3ZTG A;  4BBQ A;  1LDK C;  4M4E A;  4LKA A;  2MD8 C;  3DQV R;  3PUR A;  2EXU A;  2YRE A;  2KYU A;  4IC2 A;  4A4C A;  3KV6 A;  1RF3 A;  4Z8M A;  2E61 A;  2E6S A;  4JJQ A;  3JUE A;  1LDJ B;  5KH9 A;  5D1L B;  1WEP A;  5I3L A;  2IQJ A;  1FP0 A;  4PTB A;  2OXQ C;  1V87 A;  2MUM A;  4R7E A;  3U5P A;  5AIU A;  3PUQ A;  3QZV A;  3LQH A;  2MD7 B;  2YT5 A;  1CA9 A;  3N9N A;  2VPB A;  2KE1 A;  5JG6 A;  1WES A;  2CSZ A;  2VJF B;  2VPG A;  2JRJ A;  5J3X A;  2M3H A;  4N4F A;  4K8U A;  3C5K A;  4O1V A;  3ZJB A;  2RSD A;  5FB0 A;  5TAB A;  2MT5 A;  3MHS A;  4FJC A;  2E6R A;  2L7P A;  4YAT A;  2DX8 A;  2CKL A;  2YHO A;  5D1M B;  1T1H A;  2NAA A;  3FAO A;  5TDW A;  2JM3 A;  4Q6F A;  2LDR A;  4LJN A;  4O64 A;  2JMD A;  1FLL A;  5TRB A;  4GJH A;  3GV4 A;  4UP0 A;  3N9L A;  3M63 A;  1WE9 A;  1YY6 A;  3MDB C;  3FAN A;  2ECJ A;  2LGV A;  2ZET C;  2GKW A;  4YAB A;  2KGG A;  2MKE A;  2KWK A;  3MQS C;  2ECT A;  4UI9 B;  2EGP A;  2CT2 A;  2YUR A;  4GHU A;  3FEH A;  4WZ0 A;  1L0A A;  2JMI A;  2M13 A;  5TBN A;  1LB5 A;  5H1T A;  3LQI A;  1VYX A;  3L1Z B;  2Y1N A;  2XOY A;  3LJU X;  4S3O C;  3L1X A;  4GNE A;  2YQL A;  5DKA A;  2YSM A;  5LKX A;  4LK9 A;  1WEQ A;  4A4B A;  2L43 A;  2LRI C;  3KQI A;  2QIZ A;  1F62 A;  4BHW A;  1G25 A;  2F42 A;  4GNF A;  1FBV A;  4XI1 A;  1LB6 A;  2LXP C;  1WEM A;  3O35 A;  2MNZ A;  4F1P A;  5KH7 A;  2MA5 A;  3SOX A;  2JUN A;  2FOO A;  2H0D B;  5K3Q A;  2CON A;  4N3W A;  4V3L C;  2KWN A;  1MM2 A;  2VJE A;  1RMD A;  1IYM A;  1CA4 A;  2I50 A;  4I7C A;  4PPE A;  3N9M A;  4KG9 A;  3N9P A;  3M7K A;  2LAU A;  2RI7 A;  2VP7 A;  2C2L A;  5H9M A;  4GWM A;  2M6M A;  4AYC A;  2A25 A;  2XB1 A;  4B7Y C;  4CCG X;  1LB4 A;  5KH3 A;  1D0A A;  3SUB A;  2F1X A;  5LKU A;  2VPD A;  2KIZ A;  3HCU A;  3O37 A;  3ZVZ B;  2AN6 A;  5SVX A;  2M85 A;  4C9Z A;  1VFY A;  5B77 A;  3HQM A;  3Q1D A;  2KKY A;  2QJ0 A;  5H1V A;  1K2F A;  3DWD A;  3O36 A;  4MSX A;  5SVY A;  3T7L A;  5EYA F;  3ZVY A;  4Z0R A;  2CSV A;  1WEN A;  3PLW A;  4OGE A;  1VD4 A;  1JM7 B;  5LKT A;  5SVI B;  4L7X A;  2LGK A;  4CA1 A;  1CZY A;  2QIC A;  2OWA A;  4GWN A;  5H1U A;  2IDA A;  4R2Y A;  4AUQ B;  1WIM A;  3IVV A;  3ZYQ A;  4TKP B;  2D8S A;  1CZZ A;  2L75 A;  2FD4 A;  2VJF A;  2ECV A;  1ZBD B;  3M62 A;  5E1T A;  2YQM A;  2K4D A;  3MQR A;  4Z0O A;  3U5M A;  4LAD B;  2FOP A;  4YBM A;  5B76 A;  2DSM A;  2CRW A;  2FFW A;  3IVQ A;  5D1K B;  3KDE C;  4AVX A;  4IC3 A;  4MVT A;  2HDP A;  1WEV A;  3U5N A;  2VPE A;  3FJU B;  3U5O A;  1BOR A;  2MNY A;  2KFT A;  2ECN A;  2LXH C;  4YAX A;  3E2D A;  1KZZ A;  2CR2 A;  3ASL A;  4WZ3 B;  2YU4 A;  2PNX A;  3O34 A;  2ECI A;  2YUC A;  4YC9 A;  2BAY A;  1DVP A;  5B78 A;  4FO9 A;  3MHH A;  3N9Q A;  3KNV A;  2XOC A;  3LVQ E;  3O7A A;  2LV9 A;  4GND A;  4YBT A;  3HQH A; 
#chains in the Genus database with same CATH homology
 1X4U A;  3NG2 A;  2L5U A;  3O33 A;  2CSY A;  4GNG A;  5DIN A;  2LQ6 A;  1E4U A;  3HCS A;  2L80 A;  3N9O A;  2HYE D;  4LLB A;  4ZQL A;  3LRQ A;  3ZPV 1;  1U6G B;  4QF2 A;  2F6N A;  1FLK A;  1D01 A;  5C13 A;  1QSC A;  3ZNI A;  4NN2 A;  2FUI A;  2H0D A;  2F6J A;  2K17 A;  1Z60 A;  1Z6U A;  5B8D A;  1X4I A;  3ZPV E;  1F3V B;  3M99 A;  4S3O B;  1WEU A;  3RPG B;  3DPL R;  1CHC A;  4P5O B;  2CKL B;  4YBS A;  2MA6 A;  2F1Z A;  1JOC A;  2XXN A;  3RTR B;  2LGG A;  2Y43 A;  3FL2 A;  2KR4 A;  3VK6 A;  4FK5 A;  1WFK A;  1WEO A;  4F52 B;  2EOD A;  2UZG A;  5C11 A;  2KWO A;  3KV5 A;  5TDR A;  3IVB A;  4QF3 A;  4B86 C;  2LGL A;  2FSA A;  5G0F A;  3T6R A;  4FIP A;  5FER A;  3EB5 A;  5LKZ A;  2PUY A;  3SHB A;  1YZE A;  3HTK C;  1HYJ A;  2LN0 A;  2YHN A;  4I7B A;  4YAD A;  4A49 A;  3GL6 A;  3V43 A;  3L11 A;  1X4J A;  1WEE A;  1N87 A;  1ZMS A;  3HCT A;  1JM7 A;  2ECG A;  2C2V S;  1D0J A;  2VNF A;  3LQJ A;  5B75 A;  5G04 B;  4W4U A;  2FOJ A;  2KRE A;  3I2D A;  2K1J A;  1XWH A;  2F1Y A;  2YSJ A;  2MIQ A;  2XEU A;  4AP4 A;  2F1W A;  2EA6 A;  1WEW A;  3SOW A;  4UP5 A;  3C6W A;  2Y1M A;  3HQL A;  3HU6 A;  1D00 A;  3RPG C;  2VJE B;  4X3G A;  3PHD A;  3O70 A;  3IHP A;  2KU3 A;  2FUU A;  2KWJ A;  2KGI A;  3HSV A;  1WGM A;  2K16 A;  2L0B A;  2G6Q A;  5AIT A;  3HQI A;  1MM3 A;  4A0C D;  4AYC B;  1WIL A;  5G05 B;  4WA6 A;  4GB0 A;  4V3K C;  1HYI A;  2G43 A;  4ZUX U;  2JMJ A;  5FB1 A;  2M1R A;  4L58 A;  2YW8 A;  4YSI A;  3EB6 A;  5B79 A;  2YYR A;  4WZ2 A;  4ZDT A;  4R8P K;  1Z2Q A;  2ECW A;  5FEY A;  4I7D A;  5LCW B;  2G45 A;  3SOU A;  3ZTG A;  4BBQ A;  1LDK C;  4LKA A;  4M4E A;  2MD8 C;  3DQV R;  3PUR A;  2YRE A;  2KYU A;  4IC2 A;  4A4C A;  3KV6 A;  1RF3 A;  4Z8M A;  2E6S A;  4JJQ A;  1LDJ B;  5KH9 A;  5D1L B;  1WEP A;  5I3L A;  1FP0 A;  4PTB A;  2OXQ C;  1V87 A;  2MUM A;  4R7E A;  3U5P A;  5AIU A;  3PUQ A;  3QZV A;  3LQH A;  2MD7 B;  2YT5 A;  1CA9 A;  3N9N A;  2VPB A;  2KE1 A;  5JG6 A;  1WES A;  2CSZ A;  2VJF B;  2VPG A;  2JRJ A;  5J3X A;  2M3H A;  4N4F A;  4K8U A;  3C5K A;  4O1V A;  3ZJB A;  2RSD A;  5FB0 A;  5TAB A;  2MT5 A;  3MHS A;  4FJC A;  2E6R A;  4YAT A;  2DX8 A;  2CKL A;  2YHO A;  5D1M B;  1T1H A;  2NAA A;  5TDW A;  4Q6F A;  2LDR A;  4LJN A;  4O64 A;  2JMD A;  1FLL A;  5TRB A;  4GJH A;  3GV4 A;  4UP0 A;  3N9L A;  3M63 A;  1WE9 A;  1YY6 A;  2ECJ A;  2LGV A;  2ZET C;  2GKW A;  4YAB A;  2KGG A;  2KWK A;  3MQS C;  2ECT A;  4UI9 B;  2EGP A;  2CT2 A;  2YUR A;  4GHU A;  4WZ0 A;  1L0A A;  2JMI A;  5TBN A;  1LB5 A;  5H1T A;  3LQI A;  1VYX A;  3L1Z B;  2Y1N A;  4S3O C;  3L1X A;  4GNE A;  2YQL A;  5DKA A;  2YSM A;  5LKX A;  4LK9 A;  1WEQ A;  4A4B A;  2L43 A;  2LRI C;  3KQI A;  2QIZ A;  1F62 A;  4BHW A;  1G25 A;  2F42 A;  4GNF A;  1FBV A;  4XI1 A;  1LB6 A;  2LXP C;  1WEM A;  3O35 A;  2MNZ A;  5KH7 A;  2MA5 A;  3SOX A;  2FOO A;  2H0D B;  4N3W A;  4V3L C;  2KWN A;  1MM2 A;  2VJE A;  1RMD A;  1IYM A;  1CA4 A;  2I50 A;  4I7C A;  4PPE A;  3N9M A;  4KG9 A;  3N9P A;  2RI7 A;  2VP7 A;  2C2L A;  5H9M A;  4GWM A;  2M6M A;  4AYC A;  2A25 A;  2XB1 A;  4B7Y C;  4CCG X;  1LB4 A;  5KH3 A;  1D0A A;  2F1X A;  5LKU A;  2VPD A;  2KIZ A;  3HCU A;  3O37 A;  3ZVZ B;  2AN6 A;  2M85 A;  4C9Z A;  1VFY A;  5B77 A;  3HQM A;  2QJ0 A;  5H1V A;  1K2F A;  3O36 A;  4MSX A;  3T7L A;  5EYA F;  3ZVY A;  1WEN A;  1VD4 A;  1JM7 B;  5LKT A;  4L7X A;  2LGK A;  4CA1 A;  1CZY A;  2QIC A;  4GWN A;  5H1U A;  2IDA A;  4R2Y A;  4AUQ B;  1WIM A;  3IVV A;  3ZYQ A;  4TKP B;  2D8S A;  1CZZ A;  2L75 A;  2VJF A;  2ECV A;  1ZBD B;  3M62 A;  5E1T A;  2YQM A;  2K4D A;  3MQR A;  3U5M A;  4LAD B;  2FOP A;  4YBM A;  5B76 A;  3IVQ A;  5D1K B;  4AVX A;  4IC3 A;  4MVT A;  2HDP A;  1WEV A;  3U5N A;  2VPE A;  3U5O A;  1BOR A;  2MNY A;  2KFT A;  2ECN A;  2LXH C;  4YAX A;  1KZZ A;  2CR2 A;  3ASL A;  4WZ3 B;  2YU4 A;  2PNX A;  3O34 A;  2ECI A;  2YUC A;  4YC9 A;  2BAY A;  1DVP A;  5B78 A;  4FO9 A;  3MHH A;  3N9Q A;  3KNV A;  3O7A A;  2LV9 A;  4GND A;  4YBT A;  3HQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...