2A25A

Crystal structure of siah1 sbd bound to the peptide ekpaavvapittg from sip
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
146
Chain Sequence
PYSCPCPSCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINVDWVMMQSCFGFHFMLVLEKQQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin ligase SIAH1
publication title Structural Analysis of Siah1-Siah-interacting Protein Interactions and Insights into the Assembly of an E3 Ligase Multiprotein Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 146
sequence length 158
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2a25A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2a25A01
4K8UA 2BB8A 3HQMA 2YSOA 3M99B 2EOJA 1D00A 2LVHA 4KG9A 1G2FC 5H9MA 1A1JA 4GZNC 2EORA 2EPRA 1ZAAC 2EPCA 4I7CA 2F1YA 4GJHA 1A1KA 1K2FA 1YZEA 2YTEA 1A1FA 4GWNA 4O1VA 2GKWA 2YTIA 3HQLA 4R2PA 3HQHA 2EQ1A 1LB4A 1D0JA 1QSCA 2EMYA 2EMHA 2CSHA 1CA9A 1RF3A 3EPJA 2MKNA 2YU5A 2EOHA 2EM6A 4M4EA 1X6FA 2ENAA 2F1ZA 2EL4A 2EMGA 2ELYA 2WBTA 2AN6A 2DRPA 3ZJBA 2LCEA 2EOZA 2EOEA 1BB8A 2YTDA 3IVVA 1AAYA 2EM9A 2EPUA 1FLKA 1ZU1A 1L0AA 3HU6A 2YTGA 1MEYC 4WSGA 2PRTA 2F1WA 2YRKA 1A1HA 2EL5A 2FOJA 1YY6A 2XXNA 2YRHA 1A1IA 2EM0A 1DGCA 1TN9A 4M9VC 1FLLA 2WBSA 1Z1BA 2EMKA 2EOSA 3HSVA 1KJKA 2DMIA 3EPHA 2EPAA 2YTPA 2EM7A 2EMAA 1A1LA 2EE8A 1CZYA 2LV2A 2EOOA 4R2CA 2ADRA 2YRMA 1LLMC 1YUJA 2EQ0A 5KL2A 1X5WA 2EOMA 2YU8A 4GWMA 4I7BA 1B69A 1KZZA 2CR2A 2EPPA 2F1XA 5KL3A 2EMXA 2EMBA 3MQRA 5KL5A 4R2RA 1CA4A 2A25A 2MDGA 2EN1A 2YTJA 2EQ3A 3HQIA 2YTQA 2EOFA 2EMLA 2J7JA 2EPXA 4F2JC 2YTNA 1JK2A 1YSAC 1UN6B 2EOXA 3EPKA 2YTFA 2DLKA 2DLQA 1F3VB 2EMWA 2EM8A 1UBDC 2LO3A 1BBOA 2ENCA 4X9JA 2FOOA 4YSIA 2ENHA 2EOIA 2D9HA 4Z8MA 2EMIA 3MHSC 1P47A 1A1GA 1X6EA 2EN2A 2EM5A 2YTOA 4R2EA 3IVBA 2WBUA 4F6MA 2EMCA 2EN3A 3EPLA 4IJDA 1D0AA 4C9ZA 3MQSC 4R2QA 2RPCA 2EPZA 2EOQA 2YSPA 4GHUA 2EN8A 1WJPA 1ZMSA 3MHHC 5KL4A 2NABA 3UK3C 2HGHA 2WCC3 2E72A 1X6HA 4R2AA 2GHFA 2EMZA 1D01A 4I7DA 2RSIA 2GLIA 2EN7A 2I13A 2EMFA 1X3CA 5KL7A 2EM4A 4F6NA 2EN6A 4CA1A 1RMDA 2EM2A 2EP3A 2EN4A 1YUIA 2EM3A 2DGCA 2JP9A 1TF3A 4JJQA 5E1TA 3IVQA 2EOYA 4X3GA 1ZR9A 4R2SA 2JPAA 2FOPA 1JK1A 2VRDA 4FK5C 4R2DA 2ELZA 2LT7A 1LB5A 2EJ4A 1F2IG 5KL6A 2M9AA 1TF6A 1NCSA 1LB6A 3VHTB 1G2DC 2MKDA 2CT1A 1CZZA 2EL6A 4IS1C 2R1FA 2CTDA
chains in the Genus database with same CATH superfamily
3M99B 1D00A 2LRSA 1MGTA 4KG9A 5BR8E 4WSPA 3KWRA 1RQ0A 2VF1A 4ZYDA 4I7CA 1EH7A 2L2KB 1A1KA 1YZEA 4LFBE 2GKWA 1QSCA 2EMYA 2EMHA 1WHQA 3EPJA 2EOHA 3C6MA 2Q8UA 3J7AG 3J80C 1YPNA 4M4EA 2L2MA 4X66E 2ENAA 2UUBE 2AN6A 2N3GA 2RS6A 1AAYA 1L0AA 3T1HE 4X65E 2YRKA 4WX9A 1UHZA 2DMYA 4JI7E 1A1IA 1TN9A 1X47A 2V85A 1KJKA 3HSVA 2V88A 2IHR1 4TUIA 4DV4E 1A1LA 2EE8A 1CZYA 4I8OA 2EPLX 4R2CA 1LLMC 5KL2A 2EOMA 2YWQA 1HNXE 4O4KA 3JU0A 4BHBA 1DQ3A 4GEQB 2LTRA 1YYWA 4DR1E 2YTJA 1T4LB 2EQ3A 1YYOA 3VYXA 2FGGA 4K0KE 4F2JC 2ODRC 2EOXA 2LBSB 2DLQA 2EMWA 2EM8A 4LF7E 2F4VE 2V86A 4RH8A 2ENHA 2L3JA 4DR6E 2EOIA 2D9HA 4Z8MA 2EMIA 3C4TA 3MHSC 1P47A 4JI1E 5A6KA 2L6MA 1X6EA 2EN2A 1WHNA 2RTXA 4NHRA 5A6BD 2WBUA 4F6MA 1T4NA 4IJDA 2LJHA 4C9ZA 3MQSC 4R2QA 2YSPA 1ZMSA 2M4IA 4HEIA 2E72A 3H09A 4R2AA 1XNRE 4B3SE 4KWYA 2RSIA 4LF8E 2EN7A 1EH8A 2I13A 4L5NC 2EMFA 2EM4A 4NXNE 2JVAA 1XMQE 4BHCA 1TF3A 2EWLA 2JWOA 2EOYA 2E1MA 3C6KA 2JPAA 1J26A 4NXME 2VRDA 1NEIA 4JI2E 2L3CA 1LB5A 5KL6A 2N8XA 1G2DC 3THOB 3KZYA 4JI8E 4DV5E 4J8ZA 3AUZA 5AASA 2B7TA 1K2FA 1SFEA 1GTKA 1N3GA 2YTIA 2M1SA 4OX9E 1LB4A 3ADGA 3F6HA 3VK6A 1BBGA 1DI2A 1RF3A 2YU5A 4P7DA 4LFAE 3TQMA 4BBYA 2B3TB 2G7HA 2EMGA 2ELYA 4DV0E 1IBKE 3EQ1A 2EOZA 5AE3A 4F9AB 2YTDA 3THNA 1PDAA 1YYKA 4BS9A 1FKAE 5AC4A 1MEYC 2F1WA 1HNWE 4X8WA 3OTOE 1YY6A 3BIDA 2YRHA 2RS7A 2ODRD 1QNTA 1Z1BA 2EMKA 5F3WA 1WRJA 1WXRA 3FIGA 2EPAA 2YTPA 4F9BB 2LV2A 2ADRA 2YRMA 3IWCA 2EQ0A 4DV7E 1X5WA 5KL3A 3MQRA 4R2RA 3C4BA 2A25A 1YZ9A 4O43A 4LFCE 4JI4E 2YTQA 2L8TA 1STUA 2EMLA 2EPXA 3ADJA 5DNYA 1JK2A 4BCAA 2DLKA 1F3VB 2F8BA 2JY9A 1UBDC 2LO3A 1BBOA 2ENCA 1KYQA 4JI5E 3J81C 4YSIA 3BGHA 4GKKE 1AH5A 4LF6E 1CZZA 3IVBA 4KZSA 2HJJA 3EPLA 2I9IA 5IV8B 1T4OA 3DJWA 4P78A 5IXMB 1X6HA 4Q28A 2GHFA 1D01A 4I7DA 3J7Yp 2GLIA 1X3CA 4F6NA 3HPZA 2EM2A 1YUIA 2DGCA 4WXCA 1N32E 1EH6A 5A2QC 4N4RB 3IVQA 1IBME 4MLQA 4OOGC 1ZR9A 5CFFE 4YY3E 2NUEA 2UUCE 1JK1A 2K7IA 3ECRA 3MSWA 2EJ4A 1F2IG 2DSYA 3DF6A 4R03A 2MKDA 4TUGA 4RHBB 4M30A 5LL6R 1YFHA 2BB8A 2YSOA 3HQMA 2VE7C 2B7VA 2LVHA 2UXDE 1G2FC 3VYYA 1A1JA 2R76A 4ZYHA 4GZNC 2EORA 1L4SA 2EPRA 1ZAAC 2EPCA 4DV6E 4GJHA 1A1FA 4O1VA 1T39A 4KHPE 4R2PA 3HQHA 2EQ1A 1IMUA 3ZOQB 4X64E 2CSHA 2HC5A 2MKNA 3HPSA 3K6QA 4JI3E 2EM6A 2LUPB 4F9CB 2EL4A 1EKZA 1T38A 1X49A 2UXBE 5LMUE 4BMJA 2LCEA 2EOEA 1FJGE 3LMLA 2NUGA 2LJUA 2UUAE 4DR2E 4DR7E 2EPUA 2JOBA 1ZU1A 2MDRA 3HU6A 4M2ZA 1A1HA 2E5LE 2FOJA 4L8NA 1DGCA 4M9VC 2BBGA 2DB2A 2KONA 2NUFA 2EOSA 2DMIA 3F6GA 4WXDA 2EZ6A 1N36E 2EM7A 2EMAA 2JXPA 4B3TE 3LLHA 2YU8A 4I7BA 1B69A 1KZZA 2EPPA 1ZBQA 2F1XA 2EMXA 2EMBA 2VQEE 1I94E 1CA4A 2JYAA 2EN1A 5AC5A 5IWAE 4LTYA 4ZYEA 5LMNE 4DV1E 2NA2A 3P1XA 4LF5E 4NZVA 2UXCE 3IWBA 4DUZE 2EPOA 1GQEA 2FOOA 1PJTA 4YHHE 4DUYE 2L33A 5ADZA 5A6AA 3KZZA 2EMCA 4B3ME 3QG5C 2V8QB 2EPZA 2EOQA 4GHUA 2YPNA 2EN8A 2RQLA 5KL4A 1PJSA 2NABA 2WCC3 2RSMA 5FLXC 4WYQB 2EMZA 4JYAE 2DIXA 5KL7A 1XNQE 2EN6A 1RMDA 4M0VA 5AE2A 2EM3A 3JAMC 4JJQA 5E1TA 2GPIA 1J5EE 2M7QA 2MC6A 4DR4E 5TSEA 3OMLA 4WFTA 2FTXB 5A69A 2V87A 2M9AA 1TF6A 2YT4A 1LB6A 4DV2E 2HHHE 2EL6A 2CTDA 4K8UA 2EOJA 5IT9C 5H9MA 2CPNA 5A6BA 1N33E 2F1YA 4X62E 2L2NA 5LLQA 2YTEA 3BBGA 5A6JA 4O24A 4GWNA 4F54A 3HQLA 1D0JA 4BC9A 1CA9A 2EPKX 1X48A 4WPYA 2H36X 1X6FA 4LF4E 2F1ZA 4GKJE 2WBTA 4AQYE 2DRPA 3ZJBA 4LU9A 1BB8A 3HXLA 2KHXA 3IVVA 2EM9A 2WZOA 2JR1A 1FLKA 2EPNA 2YTGA 4WSGA 2PRTA 2MC5A 2EL5A 2N3HA 1PKPA 2XXNA 2EM0A 1FLLA 2WBSA 1IQOA 1SR9A 3T1YE 2EPMX 3ADLA 2VQFE 3EPHA 3IWDA 1YUJA 2EOOA 3JTZA 1HR0E 2L92A 2LMZA 4GWMA 4B3RE 1HNZE 2CR2A 4ZYGA 5KL5A 4JV5E 2MDGA 2KOUA 4Q35B 2ZM6E 4JI6E 3HQIA 2EOFA 4DR3E 5T6JA 1O0WA 2J7JA 1YSAC 2YTNA 1RC7A 1UN6B 3EPKA 2YTFA 4MLVA 3HQ1A 1ZBTA 3RMPA 4DV3E 1UILA 4X9JA 3L00A 3AV0A 2B9DA 4DMIA 3ADIA 1A1GA 2LE2A 2FV4B 2YTOA 4R2EA 1XMOE 5AE1A 2LUQA 2EN3A 1QU6A 1D0AA 3HTXA 2RPCA 2K4VA 3MHHC 2HGHA 1WJPA 2V89A 4O5GA 3BF2A 3UK3C 1N34E 4LF9E 2YZTA 2JOXA 4R8OA 2UU9E 4CA1A 2EP3A 2EN4A 4DKKA 4HTGA 2JP9A 4X3GA 4R2SA 1PJQA 2FOPA 1IQSA 4FK5C 4R2DA 2ELZA 2LT7A 4JI0E 4BC7A 1GZ6A 1IBLE 1NCSA 3VHTB 4DR5E 2LTSA 2CT1A 2EM5A 4IS1C 2V83A 2R1FA
chains in the Genus database with same CATH topology
4K8UA 2BB8A 3HQMA 2YSOA 3M99B 2EOJA 1D00A 2LVHA 4KG9A 1G2FC 5H9MA 1A1JA 4GZNC 2EORA 2EPRA 1ZAAC 2EPCA 4I7CA 2F1YA 4GJHA 1A1KA 1K2FA 1YZEA 2YTEA 1A1FA 4GWNA 4O1VA 2GKWA 2YTIA 3HQLA 4R2PA 3HQHA 2EQ1A 1LB4A 1D0JA 1QSCA 2EMYA 2EMHA 2CSHA 1CA9A 1RF3A 3EPJA 2MKNA 2YU5A 2EOHA 2EM6A 4M4EA 1X6FA 2ENAA 2F1ZA 2EL4A 2EMGA 2ELYA 2WBTA 2AN6A 2DRPA 3ZJBA 2LCEA 2EOZA 2EOEA 1BB8A 2YTDA 3IVVA 1AAYA 2EM9A 2EPUA 1FLKA 1ZU1A 1L0AA 3HU6A 2YTGA 1MEYC 4WSGA 2PRTA 2F1WA 2YRKA 1A1HA 2EL5A 2FOJA 1YY6A 2XXNA 2YRHA 1A1IA 2EM0A 1DGCA 1TN9A 4M9VC 1FLLA 2WBSA 1Z1BA 2EMKA 2EOSA 3HSVA 1KJKA 2DMIA 3EPHA 2EPAA 2YTPA 2EM7A 2EMAA 1A1LA 2EE8A 1CZYA 2LV2A 2EOOA 4R2CA 2ADRA 2YRMA 1LLMC 1YUJA 2EQ0A 5KL2A 1X5WA 2EOMA 2YU8A 4GWMA 4I7BA 1B69A 1KZZA 2CR2A 2EPPA 2F1XA 5KL3A 2EMXA 2EMBA 3MQRA 5KL5A 4R2RA 1CA4A 2A25A 2MDGA 2EN1A 2YTJA 2EQ3A 3HQIA 2YTQA 2EOFA 2EMLA 2J7JA 2EPXA 4F2JC 2YTNA 1JK2A 1YSAC 1UN6B 2EOXA 3EPKA 2YTFA 2DLKA 2DLQA 1F3VB 2EMWA 2EM8A 1UBDC 2LO3A 1BBOA 2ENCA 4X9JA 2FOOA 4YSIA 2ENHA 2EOIA 2D9HA 4Z8MA 2EMIA 3MHSC 1P47A 1A1GA 1X6EA 2EN2A 2EM5A 2YTOA 4R2EA 3IVBA 2WBUA 4F6MA 2EMCA 2EN3A 3EPLA 4IJDA 1D0AA 4C9ZA 3MQSC 4R2QA 2RPCA 2EPZA 2EOQA 2YSPA 4GHUA 2EN8A 1WJPA 1ZMSA 3MHHC 5KL4A 2NABA 3UK3C 2HGHA 2WCC3 2E72A 1X6HA 4R2AA 2GHFA 2EMZA 1D01A 4I7DA 2RSIA 2GLIA 2EN7A 2I13A 2EMFA 1X3CA 5KL7A 2EM4A 4F6NA 2EN6A 4CA1A 1RMDA 2EM2A 2EP3A 2EN4A 1YUIA 2EM3A 2DGCA 2JP9A 1TF3A 4JJQA 5E1TA 3IVQA 2EOYA 4X3GA 1ZR9A 4R2SA 2JPAA 2FOPA 1JK1A 2VRDA 4FK5C 4R2DA 2ELZA 2LT7A 1LB5A 2EJ4A 1F2IG 5KL6A 2M9AA 1TF6A 1NCSA 1LB6A 3VHTB 1G2DC 2MKDA 2CT1A 1CZZA 2EL6A 4IS1C 2R1FA 2CTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8U A;  2BB8 A;  3HQM A;  2YSO A;  3M99 B;  2EOJ A;  1D00 A;  2LVH A;  4KG9 A;  1G2F C;  5H9M A;  1A1J A;  4GZN C;  2EOR A;  2EPR A;  1ZAA C;  2EPC A;  4I7C A;  2F1Y A;  4GJH A;  1A1K A;  1K2F A;  1YZE A;  2YTE A;  1A1F A;  4GWN A;  4O1V A;  2GKW A;  2YTI A;  3HQL A;  4R2P A;  3HQH A;  2EQ1 A;  1LB4 A;  1D0J A;  1QSC A;  2EMY A;  2EMH A;  2CSH A;  1CA9 A;  1RF3 A;  3EPJ A;  2MKN A;  2YU5 A;  2EOH A;  2EM6 A;  4M4E A;  1X6F A;  2ENA A;  2F1Z A;  2EL4 A;  2EMG A;  2ELY A;  2WBT A;  2AN6 A;  2DRP A;  3ZJB A;  2LCE A;  2EOZ A;  2EOE A;  1BB8 A;  2YTD A;  3IVV A;  1AAY A;  2EM9 A;  2EPU A;  1FLK A;  1ZU1 A;  1L0A A;  3HU6 A;  2YTG A;  1MEY C;  4WSG A;  2PRT A;  2F1W A;  2YRK A;  1A1H A;  2EL5 A;  2FOJ A;  1YY6 A;  2XXN A;  2YRH A;  1A1I A;  2EM0 A;  1DGC A;  1TN9 A;  4M9V C;  1FLL A;  2WBS A;  1Z1B A;  2EMK A;  2EOS A;  3HSV A;  1KJK A;  2DMI A;  3EPH A;  2EPA A;  2YTP A;  2EM7 A;  2EMA A;  1A1L A;  2EE8 A;  1CZY A;  2LV2 A;  2EOO A;  4R2C A;  2ADR A;  2YRM A;  1LLM C;  1YUJ A;  2EQ0 A;  5KL2 A;  1X5W A;  2EOM A;  2YU8 A;  4GWM A;  4I7B A;  1B69 A;  1KZZ A;  2CR2 A;  2EPP A;  2F1X A;  5KL3 A;  2EMX A;  2EMB A;  3MQR A;  5KL5 A;  4R2R A;  1CA4 A;  2A25 A;  2MDG A;  2EN1 A;  2YTJ A;  2EQ3 A;  3HQI A;  2YTQ A;  2EOF A;  2EML A;  2J7J A;  2EPX A;  4F2J C;  2YTN A;  1JK2 A;  1YSA C;  1UN6 B;  2EOX A;  3EPK A;  2YTF A;  2DLK A;  2DLQ A;  1F3V B;  2EMW A;  2EM8 A;  1UBD C;  2LO3 A;  1BBO A;  2ENC A;  4X9J A;  2FOO A;  4YSI A;  2ENH A;  2EOI A;  2D9H A;  4Z8M A;  2EMI A;  3MHS C;  1P47 A;  1A1G A;  1X6E A;  2EN2 A;  2EM5 A;  2YTO A;  4R2E A;  3IVB A;  2WBU A;  4F6M A;  2EMC A;  2EN3 A;  3EPL A;  4IJD A;  1D0A A;  4C9Z A;  3MQS C;  4R2Q A;  2RPC A;  2EPZ A;  2EOQ A;  2YSP A;  4GHU A;  2EN8 A;  1WJP A;  1ZMS A;  3MHH C;  5KL4 A;  2NAB A;  3UK3 C;  2HGH A;  2WCC 3;  2E72 A;  1X6H A;  4R2A A;  2GHF A;  2EMZ A;  1D01 A;  4I7D A;  2RSI A;  2GLI A;  2EN7 A;  2I13 A;  2EMF A;  1X3C A;  5KL7 A;  2EM4 A;  4F6N A;  2EN6 A;  4CA1 A;  1RMD A;  2EM2 A;  2EP3 A;  2EN4 A;  1YUI A;  2EM3 A;  2DGC A;  2JP9 A;  1TF3 A;  4JJQ A;  5E1T A;  3IVQ A;  2EOY A;  4X3G A;  1ZR9 A;  4R2S A;  2JPA A;  2FOP A;  1JK1 A;  2VRD A;  4FK5 C;  4R2D A;  2ELZ A;  2LT7 A;  1LB5 A;  2EJ4 A;  1F2I G;  5KL6 A;  2M9A A;  1TF6 A;  1NCS A;  1LB6 A;  3VHT B;  1G2D C;  2MKD A;  2CT1 A;  1CZZ A;  2EL6 A;  4IS1 C;  2R1F A;  2CTD A; 
#chains in the Genus database with same CATH topology
 3M99 B;  1D00 A;  2LRS A;  1MGT A;  4KG9 A;  5BR8 E;  4WSP A;  3KWR A;  1RQ0 A;  2VF1 A;  4ZYD A;  4I7C A;  1EH7 A;  2L2K B;  1A1K A;  1YZE A;  4LFB E;  2GKW A;  1QSC A;  2EMY A;  2EMH A;  1WHQ A;  3EPJ A;  2EOH A;  3C6M A;  2Q8U A;  3J7A G;  3J80 C;  1YPN A;  4M4E A;  2L2M A;  4X66 E;  2ENA A;  2UUB E;  2AN6 A;  2N3G A;  2RS6 A;  1AAY A;  1L0A A;  3T1H E;  4X65 E;  2YRK A;  4WX9 A;  1UHZ A;  2DMY A;  4JI7 E;  1A1I A;  1TN9 A;  1X47 A;  2V85 A;  1KJK A;  3HSV A;  2V88 A;  2IHR 1;  4TUI A;  4DV4 E;  1A1L A;  2EE8 A;  1CZY A;  4I8O A;  2EPL X;  4R2C A;  1LLM C;  5KL2 A;  2EOM A;  2YWQ A;  1HNX E;  4O4K A;  3JU0 A;  4BHB A;  1DQ3 A;  4GEQ B;  2LTR A;  1YYW A;  4DR1 E;  2YTJ A;  1T4L B;  2EQ3 A;  1YYO A;  3VYX A;  2FGG A;  4K0K E;  4F2J C;  2ODR C;  2EOX A;  2LBS B;  2DLQ A;  2EMW A;  2EM8 A;  4LF7 E;  2F4V E;  2V86 A;  4RH8 A;  2ENH A;  2L3J A;  4DR6 E;  2EOI A;  2D9H A;  4Z8M A;  2EMI A;  3C4T A;  3MHS C;  1P47 A;  4JI1 E;  5A6K A;  2L6M A;  1X6E A;  2EN2 A;  1WHN A;  2RTX A;  4NHR A;  5A6B D;  2WBU A;  4F6M A;  1T4N A;  4IJD A;  2LJH A;  4C9Z A;  3MQS C;  4R2Q A;  2YSP A;  1ZMS A;  2M4I A;  4HEI A;  2E72 A;  3H09 A;  4R2A A;  1XNR E;  4B3S E;  4KWY A;  2RSI A;  4LF8 E;  2EN7 A;  1EH8 A;  2I13 A;  4L5N C;  2EMF A;  2EM4 A;  4NXN E;  2JVA A;  1XMQ E;  4BHC A;  1TF3 A;  2EWL A;  2JWO A;  2EOY A;  2E1M A;  3C6K A;  2JPA A;  1J26 A;  4NXM E;  2VRD A;  1NEI A;  4JI2 E;  2L3C A;  1LB5 A;  5KL6 A;  2N8X A;  1G2D C;  3THO B;  3KZY A;  4JI8 E;  4DV5 E;  4J8Z A;  3AUZ A;  5AAS A;  2B7T A;  1K2F A;  1SFE A;  1GTK A;  1N3G A;  2YTI A;  2M1S A;  4OX9 E;  1LB4 A;  3ADG A;  3F6H A;  3VK6 A;  1BBG A;  1DI2 A;  1RF3 A;  2YU5 A;  4P7D A;  4LFA E;  3TQM A;  4BBY A;  2B3T B;  2G7H A;  2EMG A;  2ELY A;  4DV0 E;  1IBK E;  3EQ1 A;  2EOZ A;  5AE3 A;  4F9A B;  2YTD A;  3THN A;  1PDA A;  1YYK A;  4BS9 A;  1FKA E;  5AC4 A;  1MEY C;  2F1W A;  1HNW E;  4X8W A;  3OTO E;  1YY6 A;  3BID A;  2YRH A;  2RS7 A;  2ODR D;  1QNT A;  1Z1B A;  2EMK A;  5F3W A;  1WRJ A;  1WXR A;  3FIG A;  2EPA A;  2YTP A;  4F9B B;  2LV2 A;  2ADR A;  2YRM A;  3IWC A;  2EQ0 A;  4DV7 E;  1X5W A;  5KL3 A;  3MQR A;  4R2R A;  3C4B A;  2A25 A;  1YZ9 A;  4O43 A;  4LFC E;  4JI4 E;  2YTQ A;  2L8T A;  1STU A;  2EML A;  2EPX A;  3ADJ A;  5DNY A;  1JK2 A;  4BCA A;  2DLK A;  1F3V B;  2F8B A;  2JY9 A;  1UBD C;  2LO3 A;  1BBO A;  2ENC A;  1KYQ A;  4JI5 E;  3J81 C;  4YSI A;  3BGH A;  4GKK E;  1AH5 A;  4LF6 E;  1CZZ A;  3IVB A;  4KZS A;  2HJJ A;  3EPL A;  2I9I A;  5IV8 B;  1T4O A;  3DJW A;  4P78 A;  5IXM B;  1X6H A;  4Q28 A;  2GHF A;  1D01 A;  4I7D A;  3J7Y p;  2GLI A;  1X3C A;  4F6N A;  3HPZ A;  2EM2 A;  1YUI A;  2DGC A;  4WXC A;  1N32 E;  1EH6 A;  5A2Q C;  4N4R B;  3IVQ A;  1IBM E;  4MLQ A;  4OOG C;  1ZR9 A;  5CFF E;  4YY3 E;  2NUE A;  2UUC E;  1JK1 A;  2K7I A;  3ECR A;  3MSW A;  2EJ4 A;  1F2I G;  2DSY A;  3DF6 A;  4R03 A;  2MKD A;  4TUG A;  4RHB B;  4M30 A;  5LL6 R;  1YFH A;  2BB8 A;  2YSO A;  3HQM A;  2VE7 C;  2B7V A;  2LVH A;  2UXD E;  1G2F C;  3VYY A;  1A1J A;  2R76 A;  4ZYH A;  4GZN C;  2EOR A;  1L4S A;  2EPR A;  1ZAA C;  2EPC A;  4DV6 E;  4GJH A;  1A1F A;  4O1V A;  1T39 A;  4KHP E;  4R2P A;  3HQH A;  2EQ1 A;  1IMU A;  3ZOQ B;  4X64 E;  2CSH A;  2HC5 A;  2MKN A;  3HPS A;  3K6Q A;  4JI3 E;  2EM6 A;  2LUP B;  4F9C B;  2EL4 A;  1EKZ A;  1T38 A;  1X49 A;  2UXB E;  5LMU E;  4BMJ A;  2LCE A;  2EOE A;  1FJG E;  3LML A;  2NUG A;  2LJU A;  2UUA E;  4DR2 E;  4DR7 E;  2EPU A;  2JOB A;  1ZU1 A;  2MDR A;  3HU6 A;  4M2Z A;  1A1H A;  2E5L E;  2FOJ A;  4L8N A;  1DGC A;  4M9V C;  2BBG A;  2DB2 A;  2KON A;  2NUF A;  2EOS A;  2DMI A;  3F6G A;  4WXD A;  2EZ6 A;  1N36 E;  2EM7 A;  2EMA A;  2JXP A;  4B3T E;  3LLH A;  2YU8 A;  4I7B A;  1B69 A;  1KZZ A;  2EPP A;  1ZBQ A;  2F1X A;  2EMX A;  2EMB A;  2VQE E;  1I94 E;  1CA4 A;  2JYA A;  2EN1 A;  5AC5 A;  5IWA E;  4LTY A;  4ZYE A;  5LMN E;  4DV1 E;  2NA2 A;  3P1X A;  4LF5 E;  4NZV A;  2UXC E;  3IWB A;  4DUZ E;  2EPO A;  1GQE A;  2FOO A;  1PJT A;  4YHH E;  4DUY E;  2L33 A;  5ADZ A;  5A6A A;  3KZZ A;  2EMC A;  4B3M E;  3QG5 C;  2V8Q B;  2EPZ A;  2EOQ A;  4GHU A;  2YPN A;  2EN8 A;  2RQL A;  5KL4 A;  1PJS A;  2NAB A;  2WCC 3;  2RSM A;  5FLX C;  4WYQ B;  2EMZ A;  4JYA E;  2DIX A;  5KL7 A;  1XNQ E;  2EN6 A;  1RMD A;  4M0V A;  5AE2 A;  2EM3 A;  3JAM C;  4JJQ A;  5E1T A;  2GPI A;  1J5E E;  2M7Q A;  2MC6 A;  4DR4 E;  5TSE A;  3OML A;  4WFT A;  2FTX B;  5A69 A;  2V87 A;  2M9A A;  1TF6 A;  2YT4 A;  1LB6 A;  4DV2 E;  2HHH E;  2EL6 A;  2CTD A;  4K8U A;  2EOJ A;  5IT9 C;  5H9M A;  2CPN A;  5A6B A;  1N33 E;  2F1Y A;  4X62 E;  2L2N A;  5LLQ A;  2YTE A;  3BBG A;  5A6J A;  4O24 A;  4GWN A;  4F54 A;  3HQL A;  1D0J A;  4BC9 A;  1CA9 A;  2EPK X;  1X48 A;  4WPY A;  2H36 X;  1X6F A;  4LF4 E;  2F1Z A;  4GKJ E;  2WBT A;  4AQY E;  2DRP A;  3ZJB A;  4LU9 A;  1BB8 A;  3HXL A;  2KHX A;  3IVV A;  2EM9 A;  2WZO A;  2JR1 A;  1FLK A;  2EPN A;  2YTG A;  4WSG A;  2PRT A;  2MC5 A;  2EL5 A;  2N3H A;  1PKP A;  2XXN A;  2EM0 A;  1FLL A;  2WBS A;  1IQO A;  1SR9 A;  3T1Y E;  2EPM X;  3ADL A;  2VQF E;  3EPH A;  3IWD A;  1YUJ A;  2EOO A;  3JTZ A;  1HR0 E;  2L92 A;  2LMZ A;  4GWM A;  4B3R E;  1HNZ E;  2CR2 A;  4ZYG A;  5KL5 A;  4JV5 E;  2MDG A;  2KOU A;  4Q35 B;  2ZM6 E;  4JI6 E;  3HQI A;  2EOF A;  4DR3 E;  5T6J A;  1O0W A;  2J7J A;  1YSA C;  2YTN A;  1RC7 A;  1UN6 B;  3EPK A;  2YTF A;  4MLV A;  3HQ1 A;  1ZBT A;  3RMP A;  4DV3 E;  1UIL A;  4X9J A;  3L00 A;  3AV0 A;  2B9D A;  4DMI A;  3ADI A;  1A1G A;  2LE2 A;  2FV4 B;  2YTO A;  4R2E A;  1XMO E;  5AE1 A;  2LUQ A;  2EN3 A;  1QU6 A;  1D0A A;  3HTX A;  2RPC A;  2K4V A;  3MHH C;  2HGH A;  1WJP A;  2V89 A;  4O5G A;  3BF2 A;  3UK3 C;  1N34 E;  4LF9 E;  2YZT A;  2JOX A;  4R8O A;  2UU9 E;  4CA1 A;  2EP3 A;  2EN4 A;  4DKK A;  4HTG A;  2JP9 A;  4X3G A;  4R2S A;  1PJQ A;  2FOP A;  1IQS A;  4FK5 C;  4R2D A;  2ELZ A;  2LT7 A;  4JI0 E;  4BC7 A;  1GZ6 A;  1IBL E;  1NCS A;  3VHT B;  4DR5 E;  2LTS A;  2CT1 A;  2EM5 A;  4IS1 C;  2V83 A;  2R1F A; 
#chains in the Genus database with same CATH homology
 4K8U A;  2BB8 A;  3HQM A;  2YSO A;  3M99 B;  2EOJ A;  1D00 A;  2LVH A;  4KG9 A;  1G2F C;  5H9M A;  1A1J A;  4GZN C;  2EOR A;  2EPR A;  1ZAA C;  2EPC A;  4I7C A;  2F1Y A;  4GJH A;  1A1K A;  1K2F A;  1YZE A;  2YTE A;  1A1F A;  4GWN A;  4O1V A;  2GKW A;  2YTI A;  3HQL A;  4R2P A;  3HQH A;  2EQ1 A;  1LB4 A;  1D0J A;  1QSC A;  2EMY A;  2EMH A;  2CSH A;  1CA9 A;  1RF3 A;  3EPJ A;  2MKN A;  2YU5 A;  2EOH A;  2EM6 A;  4M4E A;  1X6F A;  2ENA A;  2F1Z A;  2EL4 A;  2EMG A;  2ELY A;  2WBT A;  2AN6 A;  2DRP A;  3ZJB A;  2LCE A;  2EOZ A;  2EOE A;  1BB8 A;  2YTD A;  3IVV A;  1AAY A;  2EM9 A;  2EPU A;  1FLK A;  1ZU1 A;  1L0A A;  3HU6 A;  2YTG A;  1MEY C;  4WSG A;  2PRT A;  2F1W A;  2YRK A;  1A1H A;  2EL5 A;  2FOJ A;  1YY6 A;  2XXN A;  2YRH A;  1A1I A;  2EM0 A;  1DGC A;  1TN9 A;  4M9V C;  1FLL A;  2WBS A;  1Z1B A;  2EMK A;  2EOS A;  3HSV A;  1KJK A;  2DMI A;  3EPH A;  2EPA A;  2YTP A;  2EM7 A;  2EMA A;  1A1L A;  2EE8 A;  1CZY A;  2LV2 A;  2EOO A;  4R2C A;  2ADR A;  2YRM A;  1LLM C;  1YUJ A;  2EQ0 A;  5KL2 A;  1X5W A;  2EOM A;  2YU8 A;  4GWM A;  4I7B A;  1B69 A;  1KZZ A;  2CR2 A;  2EPP A;  2F1X A;  5KL3 A;  2EMX A;  2EMB A;  3MQR A;  5KL5 A;  4R2R A;  1CA4 A;  2A25 A;  2MDG A;  2EN1 A;  2YTJ A;  2EQ3 A;  3HQI A;  2YTQ A;  2EOF A;  2EML A;  2J7J A;  2EPX A;  4F2J C;  2YTN A;  1JK2 A;  1YSA C;  1UN6 B;  2EOX A;  3EPK A;  2YTF A;  2DLK A;  2DLQ A;  1F3V B;  2EMW A;  2EM8 A;  1UBD C;  2LO3 A;  1BBO A;  2ENC A;  4X9J A;  2FOO A;  4YSI A;  2ENH A;  2EOI A;  2D9H A;  4Z8M A;  2EMI A;  3MHS C;  1P47 A;  1A1G A;  1X6E A;  2EN2 A;  2EM5 A;  2YTO A;  4R2E A;  3IVB A;  2WBU A;  4F6M A;  2EMC A;  2EN3 A;  3EPL A;  4IJD A;  1D0A A;  4C9Z A;  3MQS C;  4R2Q A;  2RPC A;  2EPZ A;  2EOQ A;  2YSP A;  4GHU A;  2EN8 A;  1WJP A;  1ZMS A;  3MHH C;  5KL4 A;  2NAB A;  3UK3 C;  2HGH A;  2WCC 3;  2E72 A;  1X6H A;  4R2A A;  2GHF A;  2EMZ A;  1D01 A;  4I7D A;  2RSI A;  2GLI A;  2EN7 A;  2I13 A;  2EMF A;  1X3C A;  5KL7 A;  2EM4 A;  4F6N A;  2EN6 A;  4CA1 A;  1RMD A;  2EM2 A;  2EP3 A;  2EN4 A;  1YUI A;  2EM3 A;  2DGC A;  2JP9 A;  1TF3 A;  4JJQ A;  5E1T A;  3IVQ A;  2EOY A;  4X3G A;  1ZR9 A;  4R2S A;  2JPA A;  2FOP A;  1JK1 A;  2VRD A;  4FK5 C;  4R2D A;  2ELZ A;  2LT7 A;  1LB5 A;  2EJ4 A;  1F2I G;  5KL6 A;  2M9A A;  1TF6 A;  1NCS A;  1LB6 A;  3VHT B;  1G2D C;  2MKD A;  2CT1 A;  1CZZ A;  2EL6 A;  4IS1 C;  2R1F A;  2CTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...