2A25A

Crystal structure of siah1 sbd bound to the peptide ekpaavvapittg from sip
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
146
Chain Sequence
PYSCPCPSCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINVDWVMMQSCFGFHFMLVLEKQQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin ligase SIAH1
publication title Structural Analysis of Siah1-Siah-interacting Protein Interactions and Insights into the Assembly of an E3 Ligase Multiprotein Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 33
structure length 146
sequence length 158
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2a25A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2a25A01
2EOJA 2EN1A 1ZMSA 2EMHA 2EN3A 2ENHA 2WBTA 4JJQA 2WBUA 1QSCA 2YTOA 3MHSC 1YY6A 4GJHA 1BB8A 1A1IA 4GWMA 2WBSA 1A1JA 2E72A 2EMGA 3IVVA 4WSGA 1YSAC 1X6FA 2EOOA 1FLLA 1UN6B 5KL2A 5KL6A 2EMAA 2EN6A 2AN6A 1CA4A 2M9AA 3MQRA 2MKDA 4R2AA 1WJPA 1ZR9A 2EOQA 4I7BA 2DLQA 1D01A 4I7CA 2EM2A 2LO3A 2YRHA 3UK3C 1UBDC 2EL5A 2EOIA 2GHFA 2EQ1A 2YRMA 4R2DA 4R2QA 2EMLA 2EPXA 4KG9A 2YU5A 3ZJBA 1D0JA 2EMXA 2EE8A 2EMKA 2EPPA 1B69A 1TF6A 2I13A 2EPZA 2YTPA 1L0AA 2EP3A 4X9JA 2LV2A 1NCSA 2DGCA 4R2CA 2EMZA 2FOJA 2EM5A 1AAYA 4M9VC 2CSHA 2EM3A 1KJKA 2VRDA 2EMWA 3M99B 1A1LA 2CR2A 2FOOA 3HQHA 2JP9A 1CA9A 2PRTA 4IS1C 2EM8A 2EL4A 4O1VA 1ZU1A 2D9HA 4C9ZA 1G2FC 1TN9A 1CZYA 1LB4A 1JK2A 3VHTB 2YTFA 2FOPA 2DMIA 2YRKA 2CTDA 2ENCA 4R2EA 4F2JC 2JPAA 3MHHC 1K2FA 4K8UA 4GWNA 4M4EA 2F1ZA 2YTIA 2YTJA 2GLIA 2F1WA 5E1TA 3EPHA 2CT1A 2EMIA 2EQ0A 2EN7A 3IVBA 2ADRA 2EM4A 1D0AA 2YTNA 2EMCA 2YSPA 3EPKA 2EJ4A 2ENAA 4X3GA 2RPCA 2BB8A 1A1KA 2EM6A 1FLKA 1LLMC 4CA1A 3HQMA 1YUIA 1A1GA 4YSIA 3EPJA 2F1YA 4Z8MA 2YSOA 4R2RA 1D00A 2DLKA 2EN8A 2R1FA 4IJDA 2YU8A 2EOFA 2EOSA 2EPCA 1P47A 4GZNC 1JK1A 2MKNA 5KL5A 2A25A 2MDGA 1X3CA 1X6HA 2EOHA 2J7JA 5KL4A 1YUJA 3HQIA 2XXNA 2EOEA 2WCC3 3IVQA 1A1HA 2EMBA 2EOZA 2YTDA 4F6MA 1BBOA 1RF3A 2EN2A 2EOYA 2EPRA 1Z1BA 2ELYA 4R2PA 1F3VB 1MEYC 5KL3A 1TF3A 4R2SA 1RMDA 2ELZA 2EM9A 2RSIA 2YTQA 4GHUA 2EM7A 1KZZA 3HU6A 2EQ3A 2EMYA 2EM0A 2EPUA 2YTEA 2LVHA 1F2IG 2YTGA 1LB5A 5H9MA 4I7DA 1X5WA 2EN4A 1G2DC 2EOXA 2EORA 2HGHA 4FK5C 1LB6A 3HSVA 1DGCA 2LCEA 2F1XA 3HQLA 2NABA 4F6NA 1X6EA 2LT7A 2EMFA 2GKWA 2EPAA 1ZAAC 2DRPA 1YZEA 3MQSC 3EPLA 2EOMA 5KL7A 1CZZA 2EL6A 1A1FA
chains in the Genus database with same CATH superfamily
4NXNE 3H09A 5F3WA 1YY6A 4GJHA 4MLVA 2FGGA 2DSYA 4BBYA 1BB8A 1A1IA 2WBSA 2IHR1 2KOUA 1A1JA 3HQ1A 5CFFE 3RMPA 2UXCE 1FLLA 3IWBA 3IWCA 5KL2A 4L8NA 4O4KA 2MDRA 4R03A 1J5EE 1CA4A 1NEIA 5AE3A 4BHCA 2L3JA 4I7BA 5LLQA 1D01A 2EM2A 2LO3A 4ZYDA 4B3SE 2YRHA 4F9AB 4GKKE 4R2DA 2GHFA 2EMLA 2YU5A 3BGHA 1D0JA 2EE8A 2FV4B 2RTXA 2YTPA 1L0AA 5AASA 4X9JA 2BBGA 2LV2A 4WYQB 1X48A 2LE2A 4JI7E 1KJKA 5LMUE 2CR2A 2FOOA 2M4IA 4R8OA 4IS1C 2EL4A 1ZU1A 4WFTA 2E5LE 3ADJA 2L33A 2YTFA 4WPYA 1J26A 2DMIA 2L3CA 2JY9A 2UU9E 2DMYA 4M4EA 1O0WA 2YZTA 4WSPA 2K7IA 1YFHA 2GLIA 2F1WA 3LLHA 1PKPA 2RSMA 2YTNA 1D0AA 3F6HA 3L00A 5A6KA 2ENAA 4F9CB 2WZOA 1YPNA 1FLKA 4DV3E 1UILA 4YSIA 2HC5A 4JI1E 3EPJA 2YSOA 1SR9A 1D00A 2EPLX 1WHQA 2N3HA 2VF1A 1QNTA 2L92A 5A2QC 2YU8A 1JK1A 2EPCA 4DR3E 2A25A 2J7JA 2XXNA 2V85A 3IVQA 2YTDA 1IBME 1KYQA 1RF3A 4LF8E 2B7VA 2EPRA 1IBKE 3KZZA 4JYAE 2HJJA 4K0KE 2I9IA 2EWLA 2EM9A 2RSIA 1KZZA 2EQ3A 2NUFA 2LVHA 3VK6A 2EORA 2RQLA 1LB6A 3EQ1A 2VQFE 1DGCA 2LCEA 3BBGA 2FTXB 2UUBE 2DIXA 4Q28A 4F6NA 3FIGA 2DRPA 2YPNA 2GKWA 3JTZA 1ZBQA 4O24A 3T1HE 3EPLA 3C4BA 2EOMA 4LF5E 2EN3A 2WBTA 2WBUA 1QSCA 4I8OA 4DMIA 4RHBB 2JXPA 2YWQA 3JU0A 1FJGE 1EH6A 3IVVA 4WSGA 5DNYA 4GEQB 4DV2E 2EN6A 2M9AA 2MKDA 2JYAA 3MQRA 4R2AA 1YZ9A 1HNWE 4J8ZA 4I7CA 4N4RB 3UK3C 2YRMA 2EQ1A 5A69A 1HR0E 2EMXA 3MSWA 5T6JA 4JI4E 2LTSA 2EP3A 2DGCA 1GZ6A 4R2CA 4NHRA 3ADIA 1AAYA 2EM3A 4DV6E 3M99B 3HQHA 1X49A 1EH8A 2PRTA 2EM8A 3HPSA 2D9HA 4C9ZA 2UUAE 4JI8E 2EZ6A 5ADZA 2YRKA 4LF9E 2GPIA 2V86A 1K2FA 2JOBA 4K8UA 2LUQA 4ZYGA 3J80C 4GWNA 3C6MA 4JV5E 3J81C 4F54A 1WHNA 4LTYA 4AQYE 2EMIA 1UHZA 2EN7A 5TSEA 2ADRA 2EM4A 3C6KA 3EPKA 2YSPA 2BB8A 1A1KA 4CA1A 1YUIA 2EN8A 4WX9A 4IJDA 1PJQA 4Q35B 2EOFA 3DJWA 1P47A 2MKNA 2LJHA 3OMLA 1QU6A 1X3CA 5IWAE 2UUCE 4LF4E 5AE2A 2N8XA 5A6BA 5IXMB 5A6JA 4B3ME 4B3RE 2LJUA 4MLQA 1EKZA 4R2PA 4O43A 5KL3A 1RMDA 2B7TA 3THOB 2JWOA 4GHUA 2EM7A 2EMYA 2EM0A 2EPUA 2G7HA 1DQ3A 1G2DC 4HTGA 5LL6R 2F1XA 2NABA 4X65E 1IBLE 1X6EA 3KWRA 2LT7A 4JI0E 1ZAAC 1T39A 3MQSC 3ZOQB 1X47A 2EPXA 2EL6A 1WXRA 1N36E 2EOJA 1MGTA 1ZMSA 2EN1A 2ENHA 5AC4A 1SFEA 2YTOA 3JAMC 4LFCE 2MC5A 2RS7A 1WRJA 4GWMA 1T38A 4LU9A 2EMGA 2L2NA 1XMOE 4OX9E 1YSAC 1X6FA 2EOOA 2JOXA 1UN6B 1HNXE 2EMAA 3P1XA 3TQMA 4ZYEA 1WJPA 1ZR9A 2EOQA 3KZYA 3VYXA 3C4TA 5AC5A 1UBDC 2EL5A 3T1YE 2F4VE 4GKJE 2NUGA 1TF6A 2B3TB 2EPPA 2I13A 2EPOA 4DR1E 1IMUA 3J7Yp 1I94E 3HXLA 2M7QA 2CSHA 2M1SA 4LF6E 1ZBTA 2VRDA 2H36X 2LUPB 1A1LA 4X64E 3J7AG 2CPNA 1PJTA 4O1VA 1G2FC 1TN9A 1CZYA 1JK2A 3VHTB 4F9BB 1T4LB 2UXBE 4R2EA 2F1ZA 2KHXA 2YTJA 3F6GA 5E1TA 3EPHA 4BHBA 2JVAA 4LF7E 4DV1E 4BS9A 2RPCA 4X3GA 4YHHE 3HQMA 4L5NC 1IQOA 2V88A 2F1YA 4Z8MA 2EPKX 2L2MA 4BCAA 2R1FA 4X62E 4RH8A 2V83A 4DV5E 2EOSA 1L4SA 3LMLA 5KL5A 4DKKA 4YY3E 2MDGA 1X6HA 1GQEA 2EOHA 4DUZE 4F6MA 1BBOA 3ECRA 4ZYHA 1Z1BA 2ELYA 1F3VB 1MEYC 1TF3A 4KZSA 2R76A 1PDAA 1T4NA 2YTQA 3AUZA 4X8WA 3OTOE 5IT9C 1F2IG 1LB5A 5H9MA 4TUGA 4DUYE 1X5WA 2HGHA 2EOXA 5A6AA 3HQLA 4B3TE 1HNZE 2MC6A 2ODRC 4DV0E 2V89A 4DV4E 5KL7A 1RC7A 4NXME 1CZZA 1XNRE 1A1FA 1EH7A 2EMHA 4JJQA 2EPNA 4NZVA 2NUEA 2KONA 4DR6E 3MHSC 3THNA 4P7DA 4M2ZA 2E72A 3HTXA 2RS6A 1STUA 1AH5A 4WXDA 4JI3E 5KL6A 1BBGA 2AN6A 1RQ0A 2DLQA 4DR7E 2EPMX 1PJSA 4JI2E 2EOIA 4R2QA 4KG9A 5AE1A 3ZJBA 2HHHE 2L6MA 1B69A 2EMKA 2B9DA 2EPZA 4BC7A 1NCSA 1N32E 2EMZA 2FOJA 2EM5A 4M9VC 2EMWA 2F8BA 2JP9A 2ZM6E 1CA9A 1T4OA 2LRSA 4DR4E 1YYOA 4OOGC 1LB4A 2L8TA 3QG5C 4M30A 1YYWA 1N33E 2FOPA 1N3GA 2CTDA 2DB2A 2ENCA 2JR1A 3MHHC 4F2JC 2JPAA 3ADLA 1DI2A 2E1MA 1IQSA 1FKAE 3HPZA 2YTIA 4X66E 2ODRD 2LMZA 2CT1A 4DR5E 2EQ0A 2VQEE 3IVBA 3AV0A 4HEIA 2NA2A 2EMCA 4LFBE 2EJ4A 4LFAE 5FLXC 2EM6A 5IV8B 1LLMC 1A1GA 2YT4A 3ADGA 4R2RA 2V8QB 2DLKA 4BC9A 2V87A 4GZNC 5A6BD 2LTRA 2K4VA 4P78A 5KL4A 1YUJA 3HQIA 2EOEA 2WCC3 1A1HA 2EMBA 2EOZA 3K6QA 2EN2A 3DF6A 2EOYA 4M0VA 3VYYA 5BR8E 4DR2E 2N3GA 2Q8UA 1XNQE 4WXCA 4JI5E 4R2SA 2ELZA 4DV7E 4O5GA 4JI6E 4KWYA 3HU6A 2VE7C 2UXDE 1N34E 2LBSB 3BF2A 2YTEA 2YTGA 4I7DA 2EN4A 4TUIA 4FK5C 3HSVA 3BIDA 1XMQE 1YYKA 3IWDA 2EMFA 2EPAA 2L2KB 1YZEA 4KHPE 5LMNE 1GTKA 4BMJA
chains in the Genus database with same CATH topology
2EOJA 2EN1A 1ZMSA 2EMHA 2EN3A 2ENHA 2WBTA 4JJQA 2WBUA 1QSCA 2YTOA 3MHSC 1YY6A 4GJHA 1BB8A 1A1IA 4GWMA 2WBSA 1A1JA 2E72A 2EMGA 3IVVA 4WSGA 1YSAC 1X6FA 2EOOA 1FLLA 1UN6B 5KL2A 5KL6A 2EMAA 2EN6A 2AN6A 1CA4A 2M9AA 3MQRA 2MKDA 4R2AA 1WJPA 1ZR9A 2EOQA 4I7BA 2DLQA 1D01A 4I7CA 2EM2A 2LO3A 2YRHA 3UK3C 1UBDC 2EL5A 2EOIA 2GHFA 2EQ1A 2YRMA 4R2DA 4R2QA 2EMLA 2EPXA 4KG9A 2YU5A 3ZJBA 1D0JA 2EMXA 2EE8A 2EMKA 2EPPA 1B69A 1TF6A 2I13A 2EPZA 2YTPA 1L0AA 2EP3A 4X9JA 2LV2A 1NCSA 2DGCA 4R2CA 2EMZA 2FOJA 2EM5A 1AAYA 4M9VC 2CSHA 2EM3A 1KJKA 2VRDA 2EMWA 3M99B 1A1LA 2CR2A 2FOOA 3HQHA 2JP9A 1CA9A 2PRTA 4IS1C 2EM8A 2EL4A 4O1VA 1ZU1A 2D9HA 4C9ZA 1G2FC 1TN9A 1CZYA 1LB4A 1JK2A 3VHTB 2YTFA 2FOPA 2DMIA 2YRKA 2CTDA 2ENCA 4R2EA 4F2JC 2JPAA 3MHHC 1K2FA 4K8UA 4GWNA 4M4EA 2F1ZA 2YTIA 2YTJA 2GLIA 2F1WA 5E1TA 3EPHA 2CT1A 2EMIA 2EQ0A 2EN7A 3IVBA 2ADRA 2EM4A 1D0AA 2YTNA 2EMCA 2YSPA 3EPKA 2EJ4A 2ENAA 4X3GA 2RPCA 2BB8A 1A1KA 2EM6A 1FLKA 1LLMC 4CA1A 3HQMA 1YUIA 1A1GA 4YSIA 3EPJA 2F1YA 4Z8MA 2YSOA 4R2RA 1D00A 2DLKA 2EN8A 2R1FA 4IJDA 2YU8A 2EOFA 2EOSA 2EPCA 1P47A 4GZNC 1JK1A 2MKNA 5KL5A 2A25A 2MDGA 1X3CA 1X6HA 2EOHA 2J7JA 5KL4A 1YUJA 3HQIA 2XXNA 2EOEA 2WCC3 3IVQA 1A1HA 2EMBA 2EOZA 2YTDA 4F6MA 1BBOA 1RF3A 2EN2A 2EOYA 2EPRA 1Z1BA 2ELYA 4R2PA 1F3VB 1MEYC 5KL3A 1TF3A 4R2SA 1RMDA 2ELZA 2EM9A 2RSIA 2YTQA 4GHUA 2EM7A 1KZZA 3HU6A 2EQ3A 2EMYA 2EM0A 2EPUA 2YTEA 2LVHA 1F2IG 2YTGA 1LB5A 5H9MA 4I7DA 1X5WA 2EN4A 1G2DC 2EOXA 2EORA 2HGHA 4FK5C 1LB6A 3HSVA 1DGCA 2LCEA 2F1XA 3HQLA 2NABA 4F6NA 1X6EA 2LT7A 2EMFA 2GKWA 2EPAA 1ZAAC 2DRPA 1YZEA 3MQSC 3EPLA 2EOMA 5KL7A 1CZZA 2EL6A 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOJ A;  2EN1 A;  1ZMS A;  2EMH A;  2EN3 A;  2ENH A;  2WBT A;  4JJQ A;  2WBU A;  1QSC A;  2YTO A;  3MHS C;  1YY6 A;  4GJH A;  1BB8 A;  1A1I A;  4GWM A;  2WBS A;  1A1J A;  2E72 A;  2EMG A;  3IVV A;  4WSG A;  1YSA C;  1X6F A;  2EOO A;  1FLL A;  1UN6 B;  5KL2 A;  5KL6 A;  2EMA A;  2EN6 A;  2AN6 A;  1CA4 A;  2M9A A;  3MQR A;  2MKD A;  4R2A A;  1WJP A;  1ZR9 A;  2EOQ A;  4I7B A;  2DLQ A;  1D01 A;  4I7C A;  2EM2 A;  2LO3 A;  2YRH A;  3UK3 C;  1UBD C;  2EL5 A;  2EOI A;  2GHF A;  2EQ1 A;  2YRM A;  4R2D A;  4R2Q A;  2EML A;  2EPX A;  4KG9 A;  2YU5 A;  3ZJB A;  1D0J A;  2EMX A;  2EE8 A;  2EMK A;  2EPP A;  1B69 A;  1TF6 A;  2I13 A;  2EPZ A;  2YTP A;  1L0A A;  2EP3 A;  4X9J A;  2LV2 A;  1NCS A;  2DGC A;  4R2C A;  2EMZ A;  2FOJ A;  2EM5 A;  1AAY A;  4M9V C;  2CSH A;  2EM3 A;  1KJK A;  2VRD A;  2EMW A;  3M99 B;  1A1L A;  2CR2 A;  2FOO A;  3HQH A;  2JP9 A;  1CA9 A;  2PRT A;  4IS1 C;  2EM8 A;  2EL4 A;  4O1V A;  1ZU1 A;  2D9H A;  4C9Z A;  1G2F C;  1TN9 A;  1CZY A;  1LB4 A;  1JK2 A;  3VHT B;  2YTF A;  2FOP A;  2DMI A;  2YRK A;  2CTD A;  2ENC A;  4R2E A;  4F2J C;  2JPA A;  3MHH C;  1K2F A;  4K8U A;  4GWN A;  4M4E A;  2F1Z A;  2YTI A;  2YTJ A;  2GLI A;  2F1W A;  5E1T A;  3EPH A;  2CT1 A;  2EMI A;  2EQ0 A;  2EN7 A;  3IVB A;  2ADR A;  2EM4 A;  1D0A A;  2YTN A;  2EMC A;  2YSP A;  3EPK A;  2EJ4 A;  2ENA A;  4X3G A;  2RPC A;  2BB8 A;  1A1K A;  2EM6 A;  1FLK A;  1LLM C;  4CA1 A;  3HQM A;  1YUI A;  1A1G A;  4YSI A;  3EPJ A;  2F1Y A;  4Z8M A;  2YSO A;  4R2R A;  1D00 A;  2DLK A;  2EN8 A;  2R1F A;  4IJD A;  2YU8 A;  2EOF A;  2EOS A;  2EPC A;  1P47 A;  4GZN C;  1JK1 A;  2MKN A;  5KL5 A;  2A25 A;  2MDG A;  1X3C A;  1X6H A;  2EOH A;  2J7J A;  5KL4 A;  1YUJ A;  3HQI A;  2XXN A;  2EOE A;  2WCC 3;  3IVQ A;  1A1H A;  2EMB A;  2EOZ A;  2YTD A;  4F6M A;  1BBO A;  1RF3 A;  2EN2 A;  2EOY A;  2EPR A;  1Z1B A;  2ELY A;  4R2P A;  1F3V B;  1MEY C;  5KL3 A;  1TF3 A;  4R2S A;  1RMD A;  2ELZ A;  2EM9 A;  2RSI A;  2YTQ A;  4GHU A;  2EM7 A;  1KZZ A;  3HU6 A;  2EQ3 A;  2EMY A;  2EM0 A;  2EPU A;  2YTE A;  2LVH A;  1F2I G;  2YTG A;  1LB5 A;  5H9M A;  4I7D A;  1X5W A;  2EN4 A;  1G2D C;  2EOX A;  2EOR A;  2HGH A;  4FK5 C;  1LB6 A;  3HSV A;  1DGC A;  2LCE A;  2F1X A;  3HQL A;  2NAB A;  4F6N A;  1X6E A;  2LT7 A;  2EMF A;  2GKW A;  2EPA A;  1ZAA C;  2DRP A;  1YZE A;  3MQS C;  3EPL A;  2EOM A;  5KL7 A;  1CZZ A;  2EL6 A;  1A1F A; 
#chains in the Genus database with same CATH topology
 4NXN E;  3H09 A;  5F3W A;  1YY6 A;  4GJH A;  4MLV A;  2FGG A;  2DSY A;  4BBY A;  1BB8 A;  1A1I A;  2WBS A;  2IHR 1;  2KOU A;  1A1J A;  3HQ1 A;  5CFF E;  3RMP A;  2UXC E;  1FLL A;  3IWB A;  3IWC A;  5KL2 A;  4L8N A;  4O4K A;  2MDR A;  4R03 A;  1J5E E;  1CA4 A;  1NEI A;  5AE3 A;  4BHC A;  2L3J A;  4I7B A;  5LLQ A;  1D01 A;  2EM2 A;  2LO3 A;  4ZYD A;  4B3S E;  2YRH A;  4F9A B;  4GKK E;  4R2D A;  2GHF A;  2EML A;  2YU5 A;  3BGH A;  1D0J A;  2EE8 A;  2FV4 B;  2RTX A;  2YTP A;  1L0A A;  5AAS A;  4X9J A;  2BBG A;  2LV2 A;  4WYQ B;  1X48 A;  2LE2 A;  4JI7 E;  1KJK A;  5LMU E;  2CR2 A;  2FOO A;  2M4I A;  4R8O A;  4IS1 C;  2EL4 A;  1ZU1 A;  4WFT A;  2E5L E;  3ADJ A;  2L33 A;  2YTF A;  4WPY A;  1J26 A;  2DMI A;  2L3C A;  2JY9 A;  2UU9 E;  2DMY A;  4M4E A;  1O0W A;  2YZT A;  4WSP A;  2K7I A;  1YFH A;  2GLI A;  2F1W A;  3LLH A;  1PKP A;  2RSM A;  2YTN A;  1D0A A;  3F6H A;  3L00 A;  5A6K A;  2ENA A;  4F9C B;  2WZO A;  1YPN A;  1FLK A;  4DV3 E;  1UIL A;  4YSI A;  2HC5 A;  4JI1 E;  3EPJ A;  2YSO A;  1SR9 A;  1D00 A;  2EPL X;  1WHQ A;  2N3H A;  2VF1 A;  1QNT A;  2L92 A;  5A2Q C;  2YU8 A;  1JK1 A;  2EPC A;  4DR3 E;  2A25 A;  2J7J A;  2XXN A;  2V85 A;  3IVQ A;  2YTD A;  1IBM E;  1KYQ A;  1RF3 A;  4LF8 E;  2B7V A;  2EPR A;  1IBK E;  3KZZ A;  4JYA E;  2HJJ A;  4K0K E;  2I9I A;  2EWL A;  2EM9 A;  2RSI A;  1KZZ A;  2EQ3 A;  2NUF A;  2LVH A;  3VK6 A;  2EOR A;  2RQL A;  1LB6 A;  3EQ1 A;  2VQF E;  1DGC A;  2LCE A;  3BBG A;  2FTX B;  2UUB E;  2DIX A;  4Q28 A;  4F6N A;  3FIG A;  2DRP A;  2YPN A;  2GKW A;  3JTZ A;  1ZBQ A;  4O24 A;  3T1H E;  3EPL A;  3C4B A;  2EOM A;  4LF5 E;  2EN3 A;  2WBT A;  2WBU A;  1QSC A;  4I8O A;  4DMI A;  4RHB B;  2JXP A;  2YWQ A;  3JU0 A;  1FJG E;  1EH6 A;  3IVV A;  4WSG A;  5DNY A;  4GEQ B;  4DV2 E;  2EN6 A;  2M9A A;  2MKD A;  2JYA A;  3MQR A;  4R2A A;  1YZ9 A;  1HNW E;  4J8Z A;  4I7C A;  4N4R B;  3UK3 C;  2YRM A;  2EQ1 A;  5A69 A;  1HR0 E;  2EMX A;  3MSW A;  5T6J A;  4JI4 E;  2LTS A;  2EP3 A;  2DGC A;  1GZ6 A;  4R2C A;  4NHR A;  3ADI A;  1AAY A;  2EM3 A;  4DV6 E;  3M99 B;  3HQH A;  1X49 A;  1EH8 A;  2PRT A;  2EM8 A;  3HPS A;  2D9H A;  4C9Z A;  2UUA E;  4JI8 E;  2EZ6 A;  5ADZ A;  2YRK A;  4LF9 E;  2GPI A;  2V86 A;  1K2F A;  2JOB A;  4K8U A;  2LUQ A;  4ZYG A;  3J80 C;  4GWN A;  3C6M A;  4JV5 E;  3J81 C;  4F54 A;  1WHN A;  4LTY A;  4AQY E;  2EMI A;  1UHZ A;  2EN7 A;  5TSE A;  2ADR A;  2EM4 A;  3C6K A;  3EPK A;  2YSP A;  2BB8 A;  1A1K A;  4CA1 A;  1YUI A;  2EN8 A;  4WX9 A;  4IJD A;  1PJQ A;  4Q35 B;  2EOF A;  3DJW A;  1P47 A;  2MKN A;  2LJH A;  3OML A;  1QU6 A;  1X3C A;  5IWA E;  2UUC E;  4LF4 E;  5AE2 A;  2N8X A;  5A6B A;  5IXM B;  5A6J A;  4B3M E;  4B3R E;  2LJU A;  4MLQ A;  1EKZ A;  4R2P A;  4O43 A;  5KL3 A;  1RMD A;  2B7T A;  3THO B;  2JWO A;  4GHU A;  2EM7 A;  2EMY A;  2EM0 A;  2EPU A;  2G7H A;  1DQ3 A;  1G2D C;  4HTG A;  5LL6 R;  2F1X A;  2NAB A;  4X65 E;  1IBL E;  1X6E A;  3KWR A;  2LT7 A;  4JI0 E;  1ZAA C;  1T39 A;  3MQS C;  3ZOQ B;  1X47 A;  2EPX A;  2EL6 A;  1WXR A;  1N36 E;  2EOJ A;  1MGT A;  1ZMS A;  2EN1 A;  2ENH A;  5AC4 A;  1SFE A;  2YTO A;  3JAM C;  4LFC E;  2MC5 A;  2RS7 A;  1WRJ A;  4GWM A;  1T38 A;  4LU9 A;  2EMG A;  2L2N A;  1XMO E;  4OX9 E;  1YSA C;  1X6F A;  2EOO A;  2JOX A;  1UN6 B;  1HNX E;  2EMA A;  3P1X A;  3TQM A;  4ZYE A;  1WJP A;  1ZR9 A;  2EOQ A;  3KZY A;  3VYX A;  3C4T A;  5AC5 A;  1UBD C;  2EL5 A;  3T1Y E;  2F4V E;  4GKJ E;  2NUG A;  1TF6 A;  2B3T B;  2EPP A;  2I13 A;  2EPO A;  4DR1 E;  1IMU A;  3J7Y p;  1I94 E;  3HXL A;  2M7Q A;  2CSH A;  2M1S A;  4LF6 E;  1ZBT A;  2VRD A;  2H36 X;  2LUP B;  1A1L A;  4X64 E;  3J7A G;  2CPN A;  1PJT A;  4O1V A;  1G2F C;  1TN9 A;  1CZY A;  1JK2 A;  3VHT B;  4F9B B;  1T4L B;  2UXB E;  4R2E A;  2F1Z A;  2KHX A;  2YTJ A;  3F6G A;  5E1T A;  3EPH A;  4BHB A;  2JVA A;  4LF7 E;  4DV1 E;  4BS9 A;  2RPC A;  4X3G A;  4YHH E;  3HQM A;  4L5N C;  1IQO A;  2V88 A;  2F1Y A;  4Z8M A;  2EPK X;  2L2M A;  4BCA A;  2R1F A;  4X62 E;  4RH8 A;  2V83 A;  4DV5 E;  2EOS A;  1L4S A;  3LML A;  5KL5 A;  4DKK A;  4YY3 E;  2MDG A;  1X6H A;  1GQE A;  2EOH A;  4DUZ E;  4F6M A;  1BBO A;  3ECR A;  4ZYH A;  1Z1B A;  2ELY A;  1F3V B;  1MEY C;  1TF3 A;  4KZS A;  2R76 A;  1PDA A;  1T4N A;  2YTQ A;  3AUZ A;  4X8W A;  3OTO E;  5IT9 C;  1F2I G;  1LB5 A;  5H9M A;  4TUG A;  4DUY E;  1X5W A;  2HGH A;  2EOX A;  5A6A A;  3HQL A;  4B3T E;  1HNZ E;  2MC6 A;  2ODR C;  4DV0 E;  2V89 A;  4DV4 E;  5KL7 A;  1RC7 A;  4NXM E;  1CZZ A;  1XNR E;  1A1F A;  1EH7 A;  2EMH A;  4JJQ A;  2EPN A;  4NZV A;  2NUE A;  2KON A;  4DR6 E;  3MHS C;  3THN A;  4P7D A;  4M2Z A;  2E72 A;  3HTX A;  2RS6 A;  1STU A;  1AH5 A;  4WXD A;  4JI3 E;  5KL6 A;  1BBG A;  2AN6 A;  1RQ0 A;  2DLQ A;  4DR7 E;  2EPM X;  1PJS A;  4JI2 E;  2EOI A;  4R2Q A;  4KG9 A;  5AE1 A;  3ZJB A;  2HHH E;  2L6M A;  1B69 A;  2EMK A;  2B9D A;  2EPZ A;  4BC7 A;  1NCS A;  1N32 E;  2EMZ A;  2FOJ A;  2EM5 A;  4M9V C;  2EMW A;  2F8B A;  2JP9 A;  2ZM6 E;  1CA9 A;  1T4O A;  2LRS A;  4DR4 E;  1YYO A;  4OOG C;  1LB4 A;  2L8T A;  3QG5 C;  4M30 A;  1YYW A;  1N33 E;  2FOP A;  1N3G A;  2CTD A;  2DB2 A;  2ENC A;  2JR1 A;  3MHH C;  4F2J C;  2JPA A;  3ADL A;  1DI2 A;  2E1M A;  1IQS A;  1FKA E;  3HPZ A;  2YTI A;  4X66 E;  2ODR D;  2LMZ A;  2CT1 A;  4DR5 E;  2EQ0 A;  2VQE E;  3IVB A;  3AV0 A;  4HEI A;  2NA2 A;  2EMC A;  4LFB E;  2EJ4 A;  4LFA E;  5FLX C;  2EM6 A;  5IV8 B;  1LLM C;  1A1G A;  2YT4 A;  3ADG A;  4R2R A;  2V8Q B;  2DLK A;  4BC9 A;  2V87 A;  4GZN C;  5A6B D;  2LTR A;  2K4V A;  4P78 A;  5KL4 A;  1YUJ A;  3HQI A;  2EOE A;  2WCC 3;  1A1H A;  2EMB A;  2EOZ A;  3K6Q A;  2EN2 A;  3DF6 A;  2EOY A;  4M0V A;  3VYY A;  5BR8 E;  4DR2 E;  2N3G A;  2Q8U A;  1XNQ E;  4WXC A;  4JI5 E;  4R2S A;  2ELZ A;  4DV7 E;  4O5G A;  4JI6 E;  4KWY A;  3HU6 A;  2VE7 C;  2UXD E;  1N34 E;  2LBS B;  3BF2 A;  2YTE A;  2YTG A;  4I7D A;  2EN4 A;  4TUI A;  4FK5 C;  3HSV A;  3BID A;  1XMQ E;  1YYK A;  3IWD A;  2EMF A;  2EPA A;  2L2K B;  1YZE A;  4KHP E;  5LMN E;  1GTK A;  4BMJ A; 
#chains in the Genus database with same CATH homology
 2EOJ A;  2EN1 A;  1ZMS A;  2EMH A;  2EN3 A;  2ENH A;  2WBT A;  4JJQ A;  2WBU A;  1QSC A;  2YTO A;  3MHS C;  1YY6 A;  4GJH A;  1BB8 A;  1A1I A;  4GWM A;  2WBS A;  1A1J A;  2E72 A;  2EMG A;  3IVV A;  4WSG A;  1YSA C;  1X6F A;  2EOO A;  1FLL A;  1UN6 B;  5KL2 A;  5KL6 A;  2EMA A;  2EN6 A;  2AN6 A;  1CA4 A;  2M9A A;  3MQR A;  2MKD A;  4R2A A;  1WJP A;  1ZR9 A;  2EOQ A;  4I7B A;  2DLQ A;  1D01 A;  4I7C A;  2EM2 A;  2LO3 A;  2YRH A;  3UK3 C;  1UBD C;  2EL5 A;  2EOI A;  2GHF A;  2EQ1 A;  2YRM A;  4R2D A;  4R2Q A;  2EML A;  2EPX A;  4KG9 A;  2YU5 A;  3ZJB A;  1D0J A;  2EMX A;  2EE8 A;  2EMK A;  2EPP A;  1B69 A;  1TF6 A;  2I13 A;  2EPZ A;  2YTP A;  1L0A A;  2EP3 A;  4X9J A;  2LV2 A;  1NCS A;  2DGC A;  4R2C A;  2EMZ A;  2FOJ A;  2EM5 A;  1AAY A;  4M9V C;  2CSH A;  2EM3 A;  1KJK A;  2VRD A;  2EMW A;  3M99 B;  1A1L A;  2CR2 A;  2FOO A;  3HQH A;  2JP9 A;  1CA9 A;  2PRT A;  4IS1 C;  2EM8 A;  2EL4 A;  4O1V A;  1ZU1 A;  2D9H A;  4C9Z A;  1G2F C;  1TN9 A;  1CZY A;  1LB4 A;  1JK2 A;  3VHT B;  2YTF A;  2FOP A;  2DMI A;  2YRK A;  2CTD A;  2ENC A;  4R2E A;  4F2J C;  2JPA A;  3MHH C;  1K2F A;  4K8U A;  4GWN A;  4M4E A;  2F1Z A;  2YTI A;  2YTJ A;  2GLI A;  2F1W A;  5E1T A;  3EPH A;  2CT1 A;  2EMI A;  2EQ0 A;  2EN7 A;  3IVB A;  2ADR A;  2EM4 A;  1D0A A;  2YTN A;  2EMC A;  2YSP A;  3EPK A;  2EJ4 A;  2ENA A;  4X3G A;  2RPC A;  2BB8 A;  1A1K A;  2EM6 A;  1FLK A;  1LLM C;  4CA1 A;  3HQM A;  1YUI A;  1A1G A;  4YSI A;  3EPJ A;  2F1Y A;  4Z8M A;  2YSO A;  4R2R A;  1D00 A;  2DLK A;  2EN8 A;  2R1F A;  4IJD A;  2YU8 A;  2EOF A;  2EOS A;  2EPC A;  1P47 A;  4GZN C;  1JK1 A;  2MKN A;  5KL5 A;  2A25 A;  2MDG A;  1X3C A;  1X6H A;  2EOH A;  2J7J A;  5KL4 A;  1YUJ A;  3HQI A;  2XXN A;  2EOE A;  2WCC 3;  3IVQ A;  1A1H A;  2EMB A;  2EOZ A;  2YTD A;  4F6M A;  1BBO A;  1RF3 A;  2EN2 A;  2EOY A;  2EPR A;  1Z1B A;  2ELY A;  4R2P A;  1F3V B;  1MEY C;  5KL3 A;  1TF3 A;  4R2S A;  1RMD A;  2ELZ A;  2EM9 A;  2RSI A;  2YTQ A;  4GHU A;  2EM7 A;  1KZZ A;  3HU6 A;  2EQ3 A;  2EMY A;  2EM0 A;  2EPU A;  2YTE A;  2LVH A;  1F2I G;  2YTG A;  1LB5 A;  5H9M A;  4I7D A;  1X5W A;  2EN4 A;  1G2D C;  2EOX A;  2EOR A;  2HGH A;  4FK5 C;  1LB6 A;  3HSV A;  1DGC A;  2LCE A;  2F1X A;  3HQL A;  2NAB A;  4F6N A;  1X6E A;  2LT7 A;  2EMF A;  2GKW A;  2EPA A;  1ZAA C;  2DRP A;  1YZE A;  3MQS C;  3EPL A;  2EOM A;  5KL7 A;  1CZZ A;  2EL6 A;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...