2A25A

Crystal structure of siah1 sbd bound to the peptide ekpaavvapittg from sip
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
146
Chain Sequence
PYSCPCPSCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINVDWVMMQSCFGFHFMLVLEKQQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Siah1-Siah-interacting Protein Interactions and Insights into the Assembly of an E3 Ligase Multiprotein Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin ligase SIAH1
total genus 33
structure length 146
sequence length 158
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2a25A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2a25A01
2ELYA 1NCSA 3IVBA 1X5WA 2E72A 2EMHA 1RF3A 3HQMA 2F1ZA 1TN9A 2GKWA 2I13A 2EM6A 1ZAAC 1CZZA 2EMKA 1YY6A 1KZZA 4GWNA 2WBUA 2WBTA 1G2FC 1Z1BA 4R2CA 3EPHA 2EQ3A 1ZU1A 2YTIA 1JK1A 2EOQA 2EM0A 2BB8A 2EM7A 2RSIA 1D00A 1FLKA 1X3CA 2EM5A 1FLLA 2MDGA 5KL3A 2LV2A 1YSAC 2DLKA 2JPAA 1BB8A 2FOOA 2EMXA 1YZEA 2EPCA 1UN6B 3EPJA 1JK2A 2HGHA 2LVHA 1TF6A 2CT1A 2EQ1A 1G2DC 2YRMA 4R2QA 4F6NA 1A1JA 2EN3A 4C9ZA 2EE8A 1CA9A 2MKNA 2EPAA 3HSVA 4O1VA 1A1HA 2YRKA 2EOHA 1A1LA 2CTDA 2EN4A 2EOXA 2PRTA 4CA1A 2EM8A 2LCEA 2VRDA 1UBDC 4F6MA 1K2FA 1L0AA 5KL5A 2YTOA 1D01A 2J7JA 4R2AA 4IS1C 1CA4A 1CZYA 2A25A 2FOPA 4GHUA 4I7DA 4WSGA 5H9MA 5KL7A 3UK3C 4F2JC 2EORA 3M99B 2ENHA 2EN6A 1MEYC 1YUIA 2MKDA 2EMLA 2EPZA 2YSOA 2EMWA 3IVVA 2EOMA 2LO3A 2F1YA 2WCC3 2ELZA 1A1KA 2EN7A 2EOYA 2YTDA 1LB5A 2EL5A 2ENAA 4GZNC 1LLMC 4KG9A 2YTFA 1X6HA 2EOSA 4X9JA 3HQIA 1D0JA 2YTGA 3HQLA 1BBOA 2YTPA 2YU8A 2F1WA 2EPUA 2YSPA 1AAYA 2DLQA 4R2DA 2M9AA 3MQRA 2EP3A 1A1IA 4YSIA 4R2PA 2EN8A 4I7CA 1LB4A 2EJ4A 2EN1A 2ENCA 2EMGA 2EOFA 2EL4A 1WJPA 2DGCA 2EM3A 2EPXA 2GHFA 1F3VB 2YU5A 1KJKA 2LT7A 4M9VC 2ADRA 2EOOA 2EPRA 4R2RA 2EMFA 3ZJBA 3VHTB 1A1GA 3HU6A 4GJHA 2YTNA 2EMZA 2JP9A 4I7BA 1B69A 1A1FA 1ZMSA 4GWMA 1QSCA 5KL6A 5KL4A 2YTQA 5KL2A 2EL6A 4R2SA 1LB6A 2R1FA 3MHHC 5E1TA 2FOJA 2EOJA 2WBSA 2YTJA 1YUJA 2D9HA 4Z8MA 4JJQA 1D0AA 2EPPA 1DGCA 1ZR9A 1TF3A 1X6EA 2EMBA 2EOIA 2NABA 1X6FA 2EN2A 2F1XA 4K8UA 4R2EA 4IJDA 2EOZA 4X3GA 2EM2A 2EMAA 2EM9A 2EMCA 2XXNA 2EMIA 3MHSC 1RMDA 2YRHA 3EPLA 2CSHA 4M4EA 2EMYA 2YTEA 3EPKA 1F2IG 2DRPA 2GLIA 2CR2A 4FK5C 2EM4A 2AN6A 2DMIA 2EOEA 2RPCA 3MQSC 3IVQA 3HQHA 1P47A 2EQ0A
chains in the Genus database with same CATH superfamily
3HQMA 1YYOA 5AE1A 4JI1E 1J5EE 1KZZA 4GWNA 2EQ0A 4X66E 3EPHA 4BS9A 3KZZA 4WPYA 4R2CA 3BBGA 2BB8A 4KWYA 1EH6A 2M7QA 2MDGA 1YSAC 5A2QC 4GKJE 4DR4E 1X47A 3EPJA 2MC6A 1YYWA 2UUAE 4DUZE 1TF6A 1ZBTA 4BMJA 2EQ1A 2YRMA 1A1JA 2HHHE 4C9ZA 2MC5A 4M30A 2MKNA 2NA2A 2MDRA 2NUGA 4L8NA 1A1HA 2EOHA 3DF6A 4RHBB 4CA1A 2LUPB 3ZOQB 3JAMC 5KL5A 1DI2A 1PKPA 2LJUA 3IWDA 4WX9A 2A25A 4I7DA 1GTKA 2ENHA 2EN6A 4LTYA 1YZ9A 2EMLA 2F1YA 4ZYHA 1A1KA 4X8WA 2F8BA 1SR9A 2LJHA 2EL5A 4GZNC 5AC5A 4KG9A 4LF6E 4X9JA 1HNWE 1D0JA 2L92A 2UUBE 1AH5A 2LUQA 2JYAA 4ZYEA 1A1IA 4YSIA 1YYKA 4R2PA 4DV7E 1LB4A 1UILA 3KWRA 2EPXA 2HJJA 1F3VB 3AV0A 4O24A 2YU5A 4OX9E 3BF2A 4R2RA 2UXDE 2YZTA 2EMFA 3ZJBA 3ECRA 1DQ3A 4ZYDA 4BC7A 4GEQB 1A1FA 1WHNA 1EH7A 3FIGA 4BC9A 4Q35B 5KL2A 2N3GA 4DR2E 4R2SA 1LB6A 2R1FA 3MHHC 2WBSA 5AE3A 2YTJA 2NUEA 2V87A 1YUJA 1D0AA 2VQEE 3JTZA 1X6EA 1N33E 5A6KA 1X6FA 2EN2A 2F1XA 2KHXA 4BBYA 4IJDA 5TSEA 2EM2A 2JR1A 2EMAA 4LF4E 1N34E 1O0WA 2G7HA 2YRHA 2CSHA 2EMYA 2EWLA 1F2IG 2GLIA 2EPOA 1RC7A 2NUFA 3P1XA 2RPCA 1QNTA 4F9CB 4I8OA 3VK6A 2LBSB 2ELYA 3ADLA 2E5LE 2EMHA 1RF3A 1T39A 1TN9A 2UXCE 1QU6A 2R76A 1ZAAC 1CZZA 3THNA 4JI4E 2ODRD 2V86A 2EQ3A 1ZU1A 3EQ1A 4DKKA 2EM5A 4TUIA 4M2ZA 4WXDA 2L33A 2FGGA 1JK2A 3T1YE 1N32E 2EZ6A 2LVHA 4AQYE 5AC4A 1G2DC 3JU0A 4F9AB 2LTSA 1PJSA 4B3TE 4BCAA 2DSYA 3HQ1A 4TUGA 1PJQA 1STUA 2I9IA 2PRTA 4RH8A 5AASA 4JI7E 4DR6E 1RQ0A 3KZYA 2J7JA 2UXBE 4DR3E 5KL7A 2KONA 4WSGA 3UK3C 5LMNE 5H9MA 4F2JC 1HNXE 1PJTA 1YUIA 1MEYC 2EPZA 4HTGA 2LO3A 1EH8A 2ELZA 1XMQE 4K0KE 2V89A 4KZSA 3HPZA 1IQSA 2EPMX 1X6HA 3HQLA 1BBOA 5LL6R 2YSPA 1BBGA 2VQFE 4LFCE 2M9AA 1WRJA 3MQRA 2EP3A 5A6BD 2K4VA 2L2NA 4I7CA 3C4BA 2EN1A 2VE7C 1N3GA 2L2MA 2EM3A 2N3HA 2GHFA 2M4IA 2FTXB 1IBKE 2HC5A 2EOOA 2EPRA 4JI8E 4OOGC 2DB2A 4L5NC 4O4KA 2DIXA 4I7BA 1ZMSA 3HTXA 4GWMA 2EL6A 2LMZA 4O5GA 2FOJA 5AE2A 5A6JA 4DV3E 4Z8MA 4JJQA 2JWOA 1ZR9A 1IBME 2EOIA 4DV1E 4JI5E 4K8UA 4R2EA 5ADZA 2L3CA 2EOZA 2UU9E 2EMCA 2UUCE 1KJKA 4DMIA 2YTEA 3EPKA 1FJGE 2RSMA 4X65E 2EPKX 3HQHA 1KYQA 2EPNA 3C6MA 1NCSA 3IVBA 1X5WA 2E72A 1T4LB 4JV5E 2F1ZA 5IXMB 1WXRA 2I13A 2EM6A 1T4OA 2L2KB 2L6MA 1YY6A 3ADIA 4LFAE 1Z1BA 2M1SA 1JK1A 1NEIA 2EOQA 5DNYA 2EM7A 4LF7E 2LV2A 2JPAA 1PDAA 1BB8A 2FOOA 2EMXA 1UN6B 2Q8UA 2YWQA 2EPLX 2F4VE 2V83A 2HGHA 1L4SA 4NXME 3VYXA 1XNRE 2JOBA 4F6NA 2H36X 4R2QA 5A6AA 3AUZA 3J7AG 2EPAA 3J80C 3HSVA 1GQEA 5A69A 1A1LA 2VRDA 5BR8E 1UBDC 3ADJA 2YTOA 2JOXA 4IS1C 4DV2E 4GKKE 1CA4A 2FOPA 4B3ME 4GHUA 1X48A 4F54A 4BHBA 3M99B 2LTRA 4JI3E 2EMWA 2WCC3 2EN7A 2EOYA 4HEIA 2V88A 1LLMC 1LB5A 2ENAA 2V85A 2YTFA 5FLXC 2EOSA 3HQIA 2YTGA 2YU8A 2F1WA 2EPUA 1AAYA 2RS6A 2V8QB 3BIDA 4Q28A 1I94E 2B3TB 1XNQE 2B9DA 2ENCA 2EJ4A 2JVAA 2EMGA 1T38A 1WJPA 4JI6E 4M9VC 3BGHA 2IHR1 3VHTB 3MSWA 3F6HA 2CPNA 4GJHA 2B7TA 2EMZA 2JP9A 1B69A 5T6JA 5KL6A 2L3JA 5IWAE 5KL4A 3J81C 2YTQA 4P78A 4DR7E 4LF9E 3F6GA 4LU9A 2D9HA 1DGCA 1TF3A 2EMBA 2LRSA 2NABA 4X3GA 2EM9A 2ZM6E 2XXNA 4DV4E 1YFHA 1FKAE 1RMDA 4R8OA 2DRPA 4WXCA 2CR2A 4FK5C 4NZVA 2EM4A 4JYAE 2AN6A 2DMIA 2EOEA 3MQSC 1ZBQA 3C6KA 3J7Yp 2EN3A 4WSPA 1T4NA 4M0VA 4JI0E 2GKWA 2KOUA 4DV6E 5CFFE 2DMYA 2EMKA 2E1MA 2WBUA 4B3RE 2WBTA 1G2FC 4LF5E 2YTIA 3VYYA 4NXNE 2RSIA 2EM0A 4NHRA 4JI2E 1D00A 1FLKA 1X3CA 1FLLA 5KL3A 2N8XA 2DLKA 5IT9C 4DV0E 4ZYGA 1YZEA 1WHQA 2EPCA 4MLVA 5LLQA 4X62E 4WFTA 2CT1A 2B7VA 1YPNA 2EE8A 1CA9A 4MLQA 3H09A 4O1VA 2YT4A 2YRKA 4LFBE 1IMUA 2CTDA 2EN4A 2EOXA 3ADGA 2EM8A 2LCEA 4F6MA 1K2FA 1L0AA 3HXLA 1D01A 4R2AA 4DR1E 1CZYA 3DJWA 3QG5C 4F9BB 2EORA 2JY9A 2K7IA 1SFEA 2JXPA 2MKDA 2YSOA 2EOMA 3IVVA 1GZ6A 4N4RB 1UHZA 3K6QA 2WZOA 2YTDA 2FV4B 3LLHA 3OMLA 4R03A 4DV5E 2ODRC 3LMLA 2YPNA 3RMPA 2YTPA 5A6BA 2DLQA 4BHCA 4R2DA 1IQOA 4LF8E 5IV8B 3T1HE 2RS7A 2EN8A 3THOB 2EOFA 2EL4A 2RTXA 2DGCA 1N36E 2LT7A 4J8ZA 2ADRA 1X49A 1A1GA 3HU6A 3L00A 2YTNA 2GPIA 3TQMA 4YY3E 1HNZE 5F3WA 1QSCA 4O43A 5LMUE 1J26A 2LE2A 1MGTA 2BBGA 5E1TA 2EOJA 2RQLA 3IWBA 2EPPA 4X64E 4P7DA 4YHHE 3C4TA 1IBLE 1HR0E 3IWCA 2VF1A 2EMIA 3MHSC 4WYQB 1XMOE 4DUYE 3EPLA 4M4EA 1EKZA 4KHPE 4B3SE 3IVQA 3OTOE 4DR5E 1P47A 2L8TA 3HPSA
chains in the Genus database with same CATH topology
2ELYA 1NCSA 3IVBA 1X5WA 2E72A 2EMHA 1RF3A 3HQMA 2F1ZA 1TN9A 2GKWA 2I13A 2EM6A 1ZAAC 1CZZA 2EMKA 1YY6A 1KZZA 4GWNA 2WBUA 2WBTA 1G2FC 1Z1BA 4R2CA 3EPHA 2EQ3A 1ZU1A 2YTIA 1JK1A 2EOQA 2EM0A 2BB8A 2EM7A 2RSIA 1D00A 1FLKA 1X3CA 2EM5A 1FLLA 2MDGA 5KL3A 2LV2A 1YSAC 2DLKA 2JPAA 1BB8A 2FOOA 2EMXA 1YZEA 2EPCA 1UN6B 3EPJA 1JK2A 2HGHA 2LVHA 1TF6A 2CT1A 2EQ1A 1G2DC 2YRMA 4R2QA 4F6NA 1A1JA 2EN3A 4C9ZA 2EE8A 1CA9A 2MKNA 2EPAA 3HSVA 4O1VA 1A1HA 2YRKA 2EOHA 1A1LA 2CTDA 2EN4A 2EOXA 2PRTA 4CA1A 2EM8A 2LCEA 2VRDA 1UBDC 4F6MA 1K2FA 1L0AA 5KL5A 2YTOA 1D01A 2J7JA 4R2AA 4IS1C 1CA4A 1CZYA 2A25A 2FOPA 4GHUA 4I7DA 4WSGA 5H9MA 5KL7A 3UK3C 4F2JC 2EORA 3M99B 2ENHA 2EN6A 1MEYC 1YUIA 2MKDA 2EMLA 2EPZA 2YSOA 2EMWA 3IVVA 2EOMA 2LO3A 2F1YA 2WCC3 2ELZA 1A1KA 2EN7A 2EOYA 2YTDA 1LB5A 2EL5A 2ENAA 4GZNC 1LLMC 4KG9A 2YTFA 1X6HA 2EOSA 4X9JA 3HQIA 1D0JA 2YTGA 3HQLA 1BBOA 2YTPA 2YU8A 2F1WA 2EPUA 2YSPA 1AAYA 2DLQA 4R2DA 2M9AA 3MQRA 2EP3A 1A1IA 4YSIA 4R2PA 2EN8A 4I7CA 1LB4A 2EJ4A 2EN1A 2ENCA 2EMGA 2EOFA 2EL4A 1WJPA 2DGCA 2EM3A 2EPXA 2GHFA 1F3VB 2YU5A 1KJKA 2LT7A 4M9VC 2ADRA 2EOOA 2EPRA 4R2RA 2EMFA 3ZJBA 3VHTB 1A1GA 3HU6A 4GJHA 2YTNA 2EMZA 2JP9A 4I7BA 1B69A 1A1FA 1ZMSA 4GWMA 1QSCA 5KL6A 5KL4A 2YTQA 5KL2A 2EL6A 4R2SA 1LB6A 2R1FA 3MHHC 5E1TA 2FOJA 2EOJA 2WBSA 2YTJA 1YUJA 2D9HA 4Z8MA 4JJQA 1D0AA 2EPPA 1DGCA 1ZR9A 1TF3A 1X6EA 2EMBA 2EOIA 2NABA 1X6FA 2EN2A 2F1XA 4K8UA 4R2EA 4IJDA 2EOZA 4X3GA 2EM2A 2EMAA 2EM9A 2EMCA 2XXNA 2EMIA 3MHSC 1RMDA 2YRHA 3EPLA 2CSHA 4M4EA 2EMYA 2YTEA 3EPKA 1F2IG 2DRPA 2GLIA 2CR2A 4FK5C 2EM4A 2AN6A 2DMIA 2EOEA 2RPCA 3MQSC 3IVQA 3HQHA 1P47A 2EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELY A;  1NCS A;  3IVB A;  1X5W A;  2E72 A;  2EMH A;  1RF3 A;  3HQM A;  2F1Z A;  1TN9 A;  2GKW A;  2I13 A;  2EM6 A;  1ZAA C;  1CZZ A;  2EMK A;  1YY6 A;  1KZZ A;  4GWN A;  2WBU A;  2WBT A;  1G2F C;  1Z1B A;  4R2C A;  3EPH A;  2EQ3 A;  1ZU1 A;  2YTI A;  1JK1 A;  2EOQ A;  2EM0 A;  2BB8 A;  2EM7 A;  2RSI A;  1D00 A;  1FLK A;  1X3C A;  2EM5 A;  1FLL A;  2MDG A;  5KL3 A;  2LV2 A;  1YSA C;  2DLK A;  2JPA A;  1BB8 A;  2FOO A;  2EMX A;  1YZE A;  2EPC A;  1UN6 B;  3EPJ A;  1JK2 A;  2HGH A;  2LVH A;  1TF6 A;  2CT1 A;  2EQ1 A;  1G2D C;  2YRM A;  4R2Q A;  4F6N A;  1A1J A;  2EN3 A;  4C9Z A;  2EE8 A;  1CA9 A;  2MKN A;  2EPA A;  3HSV A;  4O1V A;  1A1H A;  2YRK A;  2EOH A;  1A1L A;  2CTD A;  2EN4 A;  2EOX A;  2PRT A;  4CA1 A;  2EM8 A;  2LCE A;  2VRD A;  1UBD C;  4F6M A;  1K2F A;  1L0A A;  5KL5 A;  2YTO A;  1D01 A;  2J7J A;  4R2A A;  4IS1 C;  1CA4 A;  1CZY A;  2A25 A;  2FOP A;  4GHU A;  4I7D A;  4WSG A;  5H9M A;  5KL7 A;  3UK3 C;  4F2J C;  2EOR A;  3M99 B;  2ENH A;  2EN6 A;  1MEY C;  1YUI A;  2MKD A;  2EML A;  2EPZ A;  2YSO A;  2EMW A;  3IVV A;  2EOM A;  2LO3 A;  2F1Y A;  2WCC 3;  2ELZ A;  1A1K A;  2EN7 A;  2EOY A;  2YTD A;  1LB5 A;  2EL5 A;  2ENA A;  4GZN C;  1LLM C;  4KG9 A;  2YTF A;  1X6H A;  2EOS A;  4X9J A;  3HQI A;  1D0J A;  2YTG A;  3HQL A;  1BBO A;  2YTP A;  2YU8 A;  2F1W A;  2EPU A;  2YSP A;  1AAY A;  2DLQ A;  4R2D A;  2M9A A;  3MQR A;  2EP3 A;  1A1I A;  4YSI A;  4R2P A;  2EN8 A;  4I7C A;  1LB4 A;  2EJ4 A;  2EN1 A;  2ENC A;  2EMG A;  2EOF A;  2EL4 A;  1WJP A;  2DGC A;  2EM3 A;  2EPX A;  2GHF A;  1F3V B;  2YU5 A;  1KJK A;  2LT7 A;  4M9V C;  2ADR A;  2EOO A;  2EPR A;  4R2R A;  2EMF A;  3ZJB A;  3VHT B;  1A1G A;  3HU6 A;  4GJH A;  2YTN A;  2EMZ A;  2JP9 A;  4I7B A;  1B69 A;  1A1F A;  1ZMS A;  4GWM A;  1QSC A;  5KL6 A;  5KL4 A;  2YTQ A;  5KL2 A;  2EL6 A;  4R2S A;  1LB6 A;  2R1F A;  3MHH C;  5E1T A;  2FOJ A;  2EOJ A;  2WBS A;  2YTJ A;  1YUJ A;  2D9H A;  4Z8M A;  4JJQ A;  1D0A A;  2EPP A;  1DGC A;  1ZR9 A;  1TF3 A;  1X6E A;  2EMB A;  2EOI A;  2NAB A;  1X6F A;  2EN2 A;  2F1X A;  4K8U A;  4R2E A;  4IJD A;  2EOZ A;  4X3G A;  2EM2 A;  2EMA A;  2EM9 A;  2EMC A;  2XXN A;  2EMI A;  3MHS C;  1RMD A;  2YRH A;  3EPL A;  2CSH A;  4M4E A;  2EMY A;  2YTE A;  3EPK A;  1F2I G;  2DRP A;  2GLI A;  2CR2 A;  4FK5 C;  2EM4 A;  2AN6 A;  2DMI A;  2EOE A;  2RPC A;  3MQS C;  3IVQ A;  3HQH A;  1P47 A;  2EQ0 A; 
#chains in the Genus database with same CATH topology
 3HQM A;  1YYO A;  5AE1 A;  4JI1 E;  1J5E E;  1KZZ A;  4GWN A;  2EQ0 A;  4X66 E;  3EPH A;  4BS9 A;  3KZZ A;  4WPY A;  4R2C A;  3BBG A;  2BB8 A;  4KWY A;  1EH6 A;  2M7Q A;  2MDG A;  1YSA C;  5A2Q C;  4GKJ E;  4DR4 E;  1X47 A;  3EPJ A;  2MC6 A;  1YYW A;  2UUA E;  4DUZ E;  1TF6 A;  1ZBT A;  4BMJ A;  2EQ1 A;  2YRM A;  1A1J A;  2HHH E;  4C9Z A;  2MC5 A;  4M30 A;  2MKN A;  2NA2 A;  2MDR A;  2NUG A;  4L8N A;  1A1H A;  2EOH A;  3DF6 A;  4RHB B;  4CA1 A;  2LUP B;  3ZOQ B;  3JAM C;  5KL5 A;  1DI2 A;  1PKP A;  2LJU A;  3IWD A;  4WX9 A;  2A25 A;  4I7D A;  1GTK A;  2ENH A;  2EN6 A;  4LTY A;  1YZ9 A;  2EML A;  2F1Y A;  4ZYH A;  1A1K A;  4X8W A;  2F8B A;  1SR9 A;  2LJH A;  2EL5 A;  4GZN C;  5AC5 A;  4KG9 A;  4LF6 E;  4X9J A;  1HNW E;  1D0J A;  2L92 A;  2UUB E;  1AH5 A;  2LUQ A;  2JYA A;  4ZYE A;  1A1I A;  4YSI A;  1YYK A;  4R2P A;  4DV7 E;  1LB4 A;  1UIL A;  3KWR A;  2EPX A;  2HJJ A;  1F3V B;  3AV0 A;  4O24 A;  2YU5 A;  4OX9 E;  3BF2 A;  4R2R A;  2UXD E;  2YZT A;  2EMF A;  3ZJB A;  3ECR A;  1DQ3 A;  4ZYD A;  4BC7 A;  4GEQ B;  1A1F A;  1WHN A;  1EH7 A;  3FIG A;  4BC9 A;  4Q35 B;  5KL2 A;  2N3G A;  4DR2 E;  4R2S A;  1LB6 A;  2R1F A;  3MHH C;  2WBS A;  5AE3 A;  2YTJ A;  2NUE A;  2V87 A;  1YUJ A;  1D0A A;  2VQE E;  3JTZ A;  1X6E A;  1N33 E;  5A6K A;  1X6F A;  2EN2 A;  2F1X A;  2KHX A;  4BBY A;  4IJD A;  5TSE A;  2EM2 A;  2JR1 A;  2EMA A;  4LF4 E;  1N34 E;  1O0W A;  2G7H A;  2YRH A;  2CSH A;  2EMY A;  2EWL A;  1F2I G;  2GLI A;  2EPO A;  1RC7 A;  2NUF A;  3P1X A;  2RPC A;  1QNT A;  4F9C B;  4I8O A;  3VK6 A;  2LBS B;  2ELY A;  3ADL A;  2E5L E;  2EMH A;  1RF3 A;  1T39 A;  1TN9 A;  2UXC E;  1QU6 A;  2R76 A;  1ZAA C;  1CZZ A;  3THN A;  4JI4 E;  2ODR D;  2V86 A;  2EQ3 A;  1ZU1 A;  3EQ1 A;  4DKK A;  2EM5 A;  4TUI A;  4M2Z A;  4WXD A;  2L33 A;  2FGG A;  1JK2 A;  3T1Y E;  1N32 E;  2EZ6 A;  2LVH A;  4AQY E;  5AC4 A;  1G2D C;  3JU0 A;  4F9A B;  2LTS A;  1PJS A;  4B3T E;  4BCA A;  2DSY A;  3HQ1 A;  4TUG A;  1PJQ A;  1STU A;  2I9I A;  2PRT A;  4RH8 A;  5AAS A;  4JI7 E;  4DR6 E;  1RQ0 A;  3KZY A;  2J7J A;  2UXB E;  4DR3 E;  5KL7 A;  2KON A;  4WSG A;  3UK3 C;  5LMN E;  5H9M A;  4F2J C;  1HNX E;  1PJT A;  1YUI A;  1MEY C;  2EPZ A;  4HTG A;  2LO3 A;  1EH8 A;  2ELZ A;  1XMQ E;  4K0K E;  2V89 A;  4KZS A;  3HPZ A;  1IQS A;  2EPM X;  1X6H A;  3HQL A;  1BBO A;  5LL6 R;  2YSP A;  1BBG A;  2VQF E;  4LFC E;  2M9A A;  1WRJ A;  3MQR A;  2EP3 A;  5A6B D;  2K4V A;  2L2N A;  4I7C A;  3C4B A;  2EN1 A;  2VE7 C;  1N3G A;  2L2M A;  2EM3 A;  2N3H A;  2GHF A;  2M4I A;  2FTX B;  1IBK E;  2HC5 A;  2EOO A;  2EPR A;  4JI8 E;  4OOG C;  2DB2 A;  4L5N C;  4O4K A;  2DIX A;  4I7B A;  1ZMS A;  3HTX A;  4GWM A;  2EL6 A;  2LMZ A;  4O5G A;  2FOJ A;  5AE2 A;  5A6J A;  4DV3 E;  4Z8M A;  4JJQ A;  2JWO A;  1ZR9 A;  1IBM E;  2EOI A;  4DV1 E;  4JI5 E;  4K8U A;  4R2E A;  5ADZ A;  2L3C A;  2EOZ A;  2UU9 E;  2EMC A;  2UUC E;  1KJK A;  4DMI A;  2YTE A;  3EPK A;  1FJG E;  2RSM A;  4X65 E;  2EPK X;  3HQH A;  1KYQ A;  2EPN A;  3C6M A;  1NCS A;  3IVB A;  1X5W A;  2E72 A;  1T4L B;  4JV5 E;  2F1Z A;  5IXM B;  1WXR A;  2I13 A;  2EM6 A;  1T4O A;  2L2K B;  2L6M A;  1YY6 A;  3ADI A;  4LFA E;  1Z1B A;  2M1S A;  1JK1 A;  1NEI A;  2EOQ A;  5DNY A;  2EM7 A;  4LF7 E;  2LV2 A;  2JPA A;  1PDA A;  1BB8 A;  2FOO A;  2EMX A;  1UN6 B;  2Q8U A;  2YWQ A;  2EPL X;  2F4V E;  2V83 A;  2HGH A;  1L4S A;  4NXM E;  3VYX A;  1XNR E;  2JOB A;  4F6N A;  2H36 X;  4R2Q A;  5A6A A;  3AUZ A;  3J7A G;  2EPA A;  3J80 C;  3HSV A;  1GQE A;  5A69 A;  1A1L A;  2VRD A;  5BR8 E;  1UBD C;  3ADJ A;  2YTO A;  2JOX A;  4IS1 C;  4DV2 E;  4GKK E;  1CA4 A;  2FOP A;  4B3M E;  4GHU A;  1X48 A;  4F54 A;  4BHB A;  3M99 B;  2LTR A;  4JI3 E;  2EMW A;  2WCC 3;  2EN7 A;  2EOY A;  4HEI A;  2V88 A;  1LLM C;  1LB5 A;  2ENA A;  2V85 A;  2YTF A;  5FLX C;  2EOS A;  3HQI A;  2YTG A;  2YU8 A;  2F1W A;  2EPU A;  1AAY A;  2RS6 A;  2V8Q B;  3BID A;  4Q28 A;  1I94 E;  2B3T B;  1XNQ E;  2B9D A;  2ENC A;  2EJ4 A;  2JVA A;  2EMG A;  1T38 A;  1WJP A;  4JI6 E;  4M9V C;  3BGH A;  2IHR 1;  3VHT B;  3MSW A;  3F6H A;  2CPN A;  4GJH A;  2B7T A;  2EMZ A;  2JP9 A;  1B69 A;  5T6J A;  5KL6 A;  2L3J A;  5IWA E;  5KL4 A;  3J81 C;  2YTQ A;  4P78 A;  4DR7 E;  4LF9 E;  3F6G A;  4LU9 A;  2D9H A;  1DGC A;  1TF3 A;  2EMB A;  2LRS A;  2NAB A;  4X3G A;  2EM9 A;  2ZM6 E;  2XXN A;  4DV4 E;  1YFH A;  1FKA E;  1RMD A;  4R8O A;  2DRP A;  4WXC A;  2CR2 A;  4FK5 C;  4NZV A;  2EM4 A;  4JYA E;  2AN6 A;  2DMI A;  2EOE A;  3MQS C;  1ZBQ A;  3C6K A;  3J7Y p;  2EN3 A;  4WSP A;  1T4N A;  4M0V A;  4JI0 E;  2GKW A;  2KOU A;  4DV6 E;  5CFF E;  2DMY A;  2EMK A;  2E1M A;  2WBU A;  4B3R E;  2WBT A;  1G2F C;  4LF5 E;  2YTI A;  3VYY A;  4NXN E;  2RSI A;  2EM0 A;  4NHR A;  4JI2 E;  1D00 A;  1FLK A;  1X3C A;  1FLL A;  5KL3 A;  2N8X A;  2DLK A;  5IT9 C;  4DV0 E;  4ZYG A;  1YZE A;  1WHQ A;  2EPC A;  4MLV A;  5LLQ A;  4X62 E;  4WFT A;  2CT1 A;  2B7V A;  1YPN A;  2EE8 A;  1CA9 A;  4MLQ A;  3H09 A;  4O1V A;  2YT4 A;  2YRK A;  4LFB E;  1IMU A;  2CTD A;  2EN4 A;  2EOX A;  3ADG A;  2EM8 A;  2LCE A;  4F6M A;  1K2F A;  1L0A A;  3HXL A;  1D01 A;  4R2A A;  4DR1 E;  1CZY A;  3DJW A;  3QG5 C;  4F9B B;  2EOR A;  2JY9 A;  2K7I A;  1SFE A;  2JXP A;  2MKD A;  2YSO A;  2EOM A;  3IVV A;  1GZ6 A;  4N4R B;  1UHZ A;  3K6Q A;  2WZO A;  2YTD A;  2FV4 B;  3LLH A;  3OML A;  4R03 A;  4DV5 E;  2ODR C;  3LML A;  2YPN A;  3RMP A;  2YTP A;  5A6B A;  2DLQ A;  4BHC A;  4R2D A;  1IQO A;  4LF8 E;  5IV8 B;  3T1H E;  2RS7 A;  2EN8 A;  3THO B;  2EOF A;  2EL4 A;  2RTX A;  2DGC A;  1N36 E;  2LT7 A;  4J8Z A;  2ADR A;  1X49 A;  1A1G A;  3HU6 A;  3L00 A;  2YTN A;  2GPI A;  3TQM A;  4YY3 E;  1HNZ E;  5F3W A;  1QSC A;  4O43 A;  5LMU E;  1J26 A;  2LE2 A;  1MGT A;  2BBG A;  5E1T A;  2EOJ A;  2RQL A;  3IWB A;  2EPP A;  4X64 E;  4P7D A;  4YHH E;  3C4T A;  1IBL E;  1HR0 E;  3IWC A;  2VF1 A;  2EMI A;  3MHS C;  4WYQ B;  1XMO E;  4DUY E;  3EPL A;  4M4E A;  1EKZ A;  4KHP E;  4B3S E;  3IVQ A;  3OTO E;  4DR5 E;  1P47 A;  2L8T A;  3HPS A; 
#chains in the Genus database with same CATH homology
 2ELY A;  1NCS A;  3IVB A;  1X5W A;  2E72 A;  2EMH A;  1RF3 A;  3HQM A;  2F1Z A;  1TN9 A;  2GKW A;  2I13 A;  2EM6 A;  1ZAA C;  1CZZ A;  2EMK A;  1YY6 A;  1KZZ A;  4GWN A;  2WBU A;  2WBT A;  1G2F C;  1Z1B A;  4R2C A;  3EPH A;  2EQ3 A;  1ZU1 A;  2YTI A;  1JK1 A;  2EOQ A;  2EM0 A;  2BB8 A;  2EM7 A;  2RSI A;  1D00 A;  1FLK A;  1X3C A;  2EM5 A;  1FLL A;  2MDG A;  5KL3 A;  2LV2 A;  1YSA C;  2DLK A;  2JPA A;  1BB8 A;  2FOO A;  2EMX A;  1YZE A;  2EPC A;  1UN6 B;  3EPJ A;  1JK2 A;  2HGH A;  2LVH A;  1TF6 A;  2CT1 A;  2EQ1 A;  1G2D C;  2YRM A;  4R2Q A;  4F6N A;  1A1J A;  2EN3 A;  4C9Z A;  2EE8 A;  1CA9 A;  2MKN A;  2EPA A;  3HSV A;  4O1V A;  1A1H A;  2YRK A;  2EOH A;  1A1L A;  2CTD A;  2EN4 A;  2EOX A;  2PRT A;  4CA1 A;  2EM8 A;  2LCE A;  2VRD A;  1UBD C;  4F6M A;  1K2F A;  1L0A A;  5KL5 A;  2YTO A;  1D01 A;  2J7J A;  4R2A A;  4IS1 C;  1CA4 A;  1CZY A;  2A25 A;  2FOP A;  4GHU A;  4I7D A;  4WSG A;  5H9M A;  5KL7 A;  3UK3 C;  4F2J C;  2EOR A;  3M99 B;  2ENH A;  2EN6 A;  1MEY C;  1YUI A;  2MKD A;  2EML A;  2EPZ A;  2YSO A;  2EMW A;  3IVV A;  2EOM A;  2LO3 A;  2F1Y A;  2WCC 3;  2ELZ A;  1A1K A;  2EN7 A;  2EOY A;  2YTD A;  1LB5 A;  2EL5 A;  2ENA A;  4GZN C;  1LLM C;  4KG9 A;  2YTF A;  1X6H A;  2EOS A;  4X9J A;  3HQI A;  1D0J A;  2YTG A;  3HQL A;  1BBO A;  2YTP A;  2YU8 A;  2F1W A;  2EPU A;  2YSP A;  1AAY A;  2DLQ A;  4R2D A;  2M9A A;  3MQR A;  2EP3 A;  1A1I A;  4YSI A;  4R2P A;  2EN8 A;  4I7C A;  1LB4 A;  2EJ4 A;  2EN1 A;  2ENC A;  2EMG A;  2EOF A;  2EL4 A;  1WJP A;  2DGC A;  2EM3 A;  2EPX A;  2GHF A;  1F3V B;  2YU5 A;  1KJK A;  2LT7 A;  4M9V C;  2ADR A;  2EOO A;  2EPR A;  4R2R A;  2EMF A;  3ZJB A;  3VHT B;  1A1G A;  3HU6 A;  4GJH A;  2YTN A;  2EMZ A;  2JP9 A;  4I7B A;  1B69 A;  1A1F A;  1ZMS A;  4GWM A;  1QSC A;  5KL6 A;  5KL4 A;  2YTQ A;  5KL2 A;  2EL6 A;  4R2S A;  1LB6 A;  2R1F A;  3MHH C;  5E1T A;  2FOJ A;  2EOJ A;  2WBS A;  2YTJ A;  1YUJ A;  2D9H A;  4Z8M A;  4JJQ A;  1D0A A;  2EPP A;  1DGC A;  1ZR9 A;  1TF3 A;  1X6E A;  2EMB A;  2EOI A;  2NAB A;  1X6F A;  2EN2 A;  2F1X A;  4K8U A;  4R2E A;  4IJD A;  2EOZ A;  4X3G A;  2EM2 A;  2EMA A;  2EM9 A;  2EMC A;  2XXN A;  2EMI A;  3MHS C;  1RMD A;  2YRH A;  3EPL A;  2CSH A;  4M4E A;  2EMY A;  2YTE A;  3EPK A;  1F2I G;  2DRP A;  2GLI A;  2CR2 A;  4FK5 C;  2EM4 A;  2AN6 A;  2DMI A;  2EOE A;  2RPC A;  3MQS C;  3IVQ A;  3HQH A;  1P47 A;  2EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...