2A25A

Crystal structure of siah1 sbd bound to the peptide ekpaavvapittg from sip
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
146
Chain Sequence
b'PYSCPCPSCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINVDWVMMQSCFGFHFMLVLEKQQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin ligase SIAH1
publication title Structural Analysis of Siah1-Siah-interacting Protein Interactions and Insights into the Assembly of an E3 Ligase Multiprotein Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 33
structure length 146
sequence length 158
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2a25A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2a25A01
2EOOA 1F3VB 2YRKA 1FLLA 2XXNA 2EN7A 1TF3A 2EMKA 2YTGA 4R2EA 4M9VC 2R1FA 2J7JA 2EP3A 2YRHA 2F1YA 2EMAA 2EOSA 3IVBA 4R2RA 1P47A 1YZEA 1WJPA 2EOZA 2EPAA 4R2DA 1ZAAC 2ENAA 1D01A 1A1KA 2FOOA 3HQIA 2CT1A 2EPPA 2YTOA 1A1IA 4C9ZA 2YTJA 3MHSC 2F1ZA 3EPHA 2RSIA 2VRDA 3UK3C 2GKWA 1CA9A 3HQMA 1X6EA 4GJHA 2EORA 2MKDA 1A1JA 2EL5A 1KJKA 1RF3A 2EM8A 1YY6A 2M9AA 4R2SA 2EOMA 2CSHA 4R2QA 2YTFA 3HQHA 2EOHA 1LB6A 2F1XA 2LCEA 1A1HA 4CA1A 2EOYA 4K8UA 2LO3A 5KL7A 2LT7A 2CTDA 1L0AA 4YSIA 4R2CA 3VHTB 1YSAC 4X9JA 2EMYA 2EN4A 5KL4A 1FLKA 1UBDC 4FK5C 2LV2A 2EM9A 2AN6A 2FOJA 2CR2A 5E1TA 5KL6A 1AAYA 2FOPA 1YUJA 1D0AA 4Z8MA 2YU5A 3HQLA 2EM3A 2EMHA 4WSGA 2EPXA 2EQ3A 2YTIA 3IVQA 2EPCA 2EE8A 5KL3A 1A1LA 4F6MA 2EQ0A 2ENCA 2EM7A 4GHUA 4I7BA 4X3GA 2EMIA 2EN1A 1X6HA 2EOQA 2MDGA 4F2JC 2A25A 3IVVA 2RPCA 1D0JA 2YSPA 1NCSA 2EQ1A 2WBSA 1A1FA 1X5WA 1G2FC 2DGCA 4I7CA 2EM6A 2ADRA 4JJQA 3M99B 2EMLA 2DMIA 1K2FA 4GWNA 2EN8A 2DRPA 3HU6A 1ZU1A 4I7DA 4GWMA 2YSOA 1D00A 2ENHA 2YTDA 2EMWA 3MHHC 2BB8A 2YRMA 5H9MA 2EOJA 3EPKA 2EPRA 2HGHA 2EPZA 3EPLA 1BBOA 2EM4A 4O1VA 2EJ4A 2D9HA 4M4EA 2EL6A 1JK1A 2EMZA 2DLKA 2EPUA 2EOEA 1RMDA 2JP9A 1JK2A 3MQSC 2EOIA 2MKNA 1CA4A 2EMCA 4KG9A 1LB4A 2YTQA 1X6FA 2E72A 3EPJA 2ELYA 2NABA 4F6NA 1QSCA 2I13A 1MEYC 2GHFA 3HSVA 4IS1C 4R2AA 1A1GA 1ZR9A 4IJDA 1G2DC 1YUIA 2GLIA 2DLQA 1CZYA 2PRTA 2JPAA 2EM2A 4R2PA 5KL2A 1TN9A 2WCC3 2LVHA 4GZNC 2YU8A 1LB5A 2EMGA 5KL5A 1LLMC 1DGCA 2EMFA 2EN6A 3MQRA 1KZZA 3ZJBA 1TF6A 1X3CA 1BB8A 2EM5A 2ELZA 2EM0A 2EN2A 2EMXA 1B69A 2YTEA 1CZZA 2EOXA 1Z1BA 1F2IG 2EN3A 2EMBA 2EOFA 2F1WA 2YTNA 1ZMSA 2WBUA 1UN6B 2WBTA 2YTPA 2EL4A
chains in the Genus database with same CATH superfamily
1EH6A 2EPMX 1PKPA 2YTGA 4DR3E 2EP3A 2EOSA 5A2QC 1HR0E 1YZEA 2YZTA 2EOZA 4WXDA 4LF4E 2EPAA 1XNRE 2ENAA 2YTOA 2M4IA 4DV1E 1N3GA 4B3SE 2JR1A 3HQMA 2MKDA 2K7IA 2UUCE 2L2NA 1YY6A 2LRSA 2CSHA 4B3ME 2V8QB 1J26A 4DR7E 1IMUA 3HQHA 1A1HA 3K6QA 1FJGE 2EOYA 5KL7A 3VHTB 2DB2A 5KL4A 3KZYA 4BMJA 2LV2A 5FLXC 4P78A 2CR2A 5E1TA 2B7VA 2EM3A 4WSGA 2V85A 2EPXA 4M0VA 3JU0A 1A1LA 4LU9A 2EQ0A 1DGCA 4I7BA 1GZ6A 1QU6A 1X6HA 1IBKE 1X49A 4NZVA 4R03A 2N3GA 1X5WA 3JTZA 4WFTA 5AC5A 3THNA 2EM6A 4HEIA 4J8ZA 3QG5C 1ZBTA 4DV2E 2EPLX 2ZM6E 3HQ1A 4TUIA 1XNQE 4DV5E 4O43A 2EPKX 2MC6A 3LLHA 1X47A 2BB8A 1IBME 4NXME 2EPRA 3EPLA 2F4VE 4ZYHA 1BBOA 2EZ6A 2D9HA 2EMZA 5A6KA 2HHHE 2JP9A 2EMCA 2NUGA 4F6NA 2L2KB 1MEYC 2GHFA 4BCAA 4R2AA 1YUIA 4GKKE 4ZYEA 3FIGA 1HNZE 4R2PA 1TN9A 2JPAA 5A6JA 2ODRD 2LVHA 4MLQA 2WCC3 2LTRA 4WYQB 5KL5A 5IT9C 3J81C 2EMFA 2B7TA 2EN6A 4JI4E 4F9BB 1T38A 5IXMB 1KYQA 4DV6E 3L00A 4LF9E 2EN2A 4KHPE 2EM0A 4GKJE 1B69A 1Z1BA 4DR5E 1AH5A 1UN6B 2MC5A 4L8NA 2YTPA 1YFHA 4X64E 5LL6R 2RQLA 2HJJA 3AUZA 1FLLA 4WSPA 4WXCA 1TF3A 2EMKA 2J7JA 2YRHA 2EMAA 3ZOQB 1P47A 4M30A 4BBYA 5CFFE 1N34E 4WPYA 3HXLA 3HQIA 2YTJA 3MHSC 3KZZA 2F1ZA 2JOBA 3EPHA 1IQOA 2RSIA 1KJKA 2LE2A 2EL5A 1RF3A 5AE1A 1XMQE 2V83A 4JI0E 4LFCE 2B3TB 4JI7E 5A6BA 1PJTA 5AASA 2I9IA 4OX9E 2YTFA 5IWAE 4KZSA 1IBLE 2IHR1 3H09A 4CA1A 4DUYE 2DSYA 2V87A 4K8UA 2RSMA 1XMOE 1YPNA 4LTYA 5AC4A 4X9JA 4X8WA 4X65E 2FOJA 4ZYGA 5IV8B 1AAYA 4LF8E 2FOPA 4DUZE 4O24A 2YTIA 3BIDA 2EPCA 4F6MA 4DR2E 2EOQA 4GHUA 2MDRA 2EMIA 4F9CB 3IVVA 1NCSA 2EQ1A 3F6GA 2WBSA 2ADRA 1HNWE 3M99B 2VF1A 3IWDA 3ECRA 1GQEA 2EN8A 4RHBB 2DRPA 4LF5E 2YRMA 3ADJA 5H9MA 3EPKA 2HGHA 3C4BA 2EPZA 4LF7E 3VYXA 2EM4A 5LLQA 4WX9A 4TUGA 3T1HE 2EPUA 2EOEA 2JXPA 1JK2A 2EOIA 2DMYA 2Q8UA 1LB4A 1X6FA 2NABA 2I13A 4IS1C 1WRJA 1ZR9A 2GLIA 1G2DC 4OOGC 1CZYA 2PRTA 5KL2A 2VQFE 2KONA 4GZNC 2YU8A 4DKKA 1RC7A 3ZJBA 2YWQA 2FTXB 4O5GA 2EM5A 1GTKA 2ELZA 2E5LE 2EMXA 3F6HA 4BC9A 1T4OA 2EOXA 2YTNA 1L4SA 2WBTA 4BHBA 2G7HA 1BBGA 2JY9A 2R1FA 4AQYE 1F3VB 2XXNA 1T4LB 5F3WA 1YYKA 3C4TA 5A6BD 1WJPA 1PJQA 4F9AB 4R2DA 2L3CA 4DV3E 1ZAAC 3DF6A 1FKAE 2FOOA 4HTGA 1PJSA 1A1IA 4C9ZA 5AE3A 2VRDA 3UK3C 1N36E 1A1JA 5AE2A 2EM8A 1EH8A 2M9AA 5LMUE 3ADLA 2EOMA 3ADGA 2LJHA 4X62E 1X48A 2LMZA 2EPNA 3BGHA 1YYWA 2EOHA 2F1XA 2LCEA 3C6MA 4YY3E 5ADZA 2V86A 2R76A 2NA2A 1HNXE 2CTDA 1N33E 1L0AA 4YSIA 2E1MA 1YSAC 2KHXA 2EMYA 2FGGA 2EM9A 2AN6A 2M1SA 5KL6A 4YHHE 2V89A 1YUJA 1D0AA 2EMHA 2UXBE 3MSWA 3IVQA 3T1YE 1EKZA 5A6AA 5TSEA 2ENCA 2EM7A 4X3GA 2EN1A 4X66E 2NUFA 2A25A 2RPCA 4F54A 1D0JA 5BR8E 2YSPA 3OMLA 4I7CA 4JJQA 2DMIA 2N8XA 4M2ZA 2M7QA 4GWNA 1ZU1A 2NUEA 2YSOA 4KWYA 5A69A 2EPOA 2YPNA 2L6MA 2VQEE 2EOJA 1NEIA 2HC5A 2RS7A 2L92A 2JVAA 2EJ4A 3EQ1A 2WZOA 2EL6A 1JK1A 4JI1E 4R8OA 2LBSB 4K0KE 2DLKA 3ADIA 3MQSC 2MKNA 3BF2A 4KG9A 2YTQA 3J80C 1IQSA 2E72A 1WHNA 3EPJA 2B9DA 2VE7C 4JI2E 3THOB 1QSCA 4O4KA 3HSVA 4IJDA 2DLQA 2LTSA 2UUAE 4BS9A 1I94E 2EMGA 1RQ0A 1LLMC 2UU9E 2JOXA 4DMIA 3MQRA 4B3RE 4MLVA 2H36X 4L5NC 1BB8A 1DI2A 4DR6E 2YTEA 3HPSA 1F2IG 1WHQA 2F1WA 2WBUA 2YT4A 2KOUA 2EOOA 2YRKA 2EN7A 4R2EA 4LFAE 4M9VC 3OTOE 2F1YA 1YZ9A 3IVBA 4R2RA 4JI6E 4GEQB 4BC7A 1ZBQA 2F8BA 1D01A 3C6KA 3RMPA 1A1KA 2CT1A 2EPPA 2JWOA 2RS6A 3P1XA 2L33A 2N3HA 2GKWA 1CA9A 1X6EA 2EORA 4GJHA 2FV4B 4NHRA 4DV7E 1T4NA 3HPZA 1O0WA 2LJUA 4R2SA 3LMLA 4DR1E 1PDAA 2L2MA 2BBGA 4R2QA 1LB6A 4NXNE 1MGTA 2LO3A 2LT7A 4R2CA 4DV0E 2EN4A 1FLKA 1UBDC 3HTXA 4FK5C 2UXDE 2JYAA 3VK6A 4Z8MA 2K4VA 2YU5A 3HQLA 2DIXA 4ZYDA 2EQ3A 4DR4E 2EE8A 1UILA 4Q28A 5KL3A 2MDGA 4F2JC 1DQ3A 4JI8E 4JI5E 3KWRA 2EWLA 5LMNE 1WXRA 2UUBE 1A1FA 1G2FC 2DGCA 4P7DA 1T39A 2EMLA 4JI3E 1K2FA 2RTXA 1YYOA 3HU6A 4I7DA 4GWMA 1SFEA 1SR9A 1QNTA 3AV0A 1D00A 2ENHA 2YTDA 5T6JA 2EMWA 3MHHC 3IWBA 4JYAE 1STUA 4O1VA 4M4EA 3J7AG 3DJWA 4JV5E 1RMDA 4RH8A 2GPIA 3BBGA 1CA4A 2L3JA 2LUPB 2L8TA 4BHCA 2ELYA 1EH7A 5DNYA 1A1GA 2UXCE 4Q35B 2EM2A 2V88A 1UHZA 3VYYA 1LB5A 1J5EE 2CPNA 4LF6E 1KZZA 2LUQA 1TF6A 3TQMA 1X3CA 2ODRC 4LFBE 1CZZA 3J7Yp 2EN3A 2EMBA 2EOFA 4B3TE 4N4RB 1ZMSA 3IWCA 4DV4E 1N32E 3JAMC 2EL4A 4I8OA
chains in the Genus database with same CATH topology
2EOOA 1F3VB 2YRKA 1FLLA 2XXNA 2EN7A 1TF3A 2EMKA 2YTGA 4R2EA 4M9VC 2R1FA 2J7JA 2EP3A 2YRHA 2F1YA 2EMAA 2EOSA 3IVBA 4R2RA 1P47A 1YZEA 1WJPA 2EOZA 2EPAA 4R2DA 1ZAAC 2ENAA 1D01A 1A1KA 2FOOA 3HQIA 2CT1A 2EPPA 2YTOA 1A1IA 4C9ZA 2YTJA 3MHSC 2F1ZA 3EPHA 2RSIA 2VRDA 3UK3C 2GKWA 1CA9A 3HQMA 1X6EA 4GJHA 2EORA 2MKDA 1A1JA 2EL5A 1KJKA 1RF3A 2EM8A 1YY6A 2M9AA 4R2SA 2EOMA 2CSHA 4R2QA 2YTFA 3HQHA 2EOHA 1LB6A 2F1XA 2LCEA 1A1HA 4CA1A 2EOYA 4K8UA 2LO3A 5KL7A 2LT7A 2CTDA 1L0AA 4YSIA 4R2CA 3VHTB 1YSAC 4X9JA 2EMYA 2EN4A 5KL4A 1FLKA 1UBDC 4FK5C 2LV2A 2EM9A 2AN6A 2FOJA 2CR2A 5E1TA 5KL6A 1AAYA 2FOPA 1YUJA 1D0AA 4Z8MA 2YU5A 3HQLA 2EM3A 2EMHA 4WSGA 2EPXA 2EQ3A 2YTIA 3IVQA 2EPCA 2EE8A 5KL3A 1A1LA 4F6MA 2EQ0A 2ENCA 2EM7A 4GHUA 4I7BA 4X3GA 2EMIA 2EN1A 1X6HA 2EOQA 2MDGA 4F2JC 2A25A 3IVVA 2RPCA 1D0JA 2YSPA 1NCSA 2EQ1A 2WBSA 1A1FA 1X5WA 1G2FC 2DGCA 4I7CA 2EM6A 2ADRA 4JJQA 3M99B 2EMLA 2DMIA 1K2FA 4GWNA 2EN8A 2DRPA 3HU6A 1ZU1A 4I7DA 4GWMA 2YSOA 1D00A 2ENHA 2YTDA 2EMWA 3MHHC 2BB8A 2YRMA 5H9MA 2EOJA 3EPKA 2EPRA 2HGHA 2EPZA 3EPLA 1BBOA 2EM4A 4O1VA 2EJ4A 2D9HA 4M4EA 2EL6A 1JK1A 2EMZA 2DLKA 2EPUA 2EOEA 1RMDA 2JP9A 1JK2A 3MQSC 2EOIA 2MKNA 1CA4A 2EMCA 4KG9A 1LB4A 2YTQA 1X6FA 2E72A 3EPJA 2ELYA 2NABA 4F6NA 1QSCA 2I13A 1MEYC 2GHFA 3HSVA 4IS1C 4R2AA 1A1GA 1ZR9A 4IJDA 1G2DC 1YUIA 2GLIA 2DLQA 1CZYA 2PRTA 2JPAA 2EM2A 4R2PA 5KL2A 1TN9A 2WCC3 2LVHA 4GZNC 2YU8A 1LB5A 2EMGA 5KL5A 1LLMC 1DGCA 2EMFA 2EN6A 3MQRA 1KZZA 3ZJBA 1TF6A 1X3CA 1BB8A 2EM5A 2ELZA 2EM0A 2EN2A 2EMXA 1B69A 2YTEA 1CZZA 2EOXA 1Z1BA 1F2IG 2EN3A 2EMBA 2EOFA 2F1WA 2YTNA 1ZMSA 2WBUA 1UN6B 2WBTA 2YTPA 2EL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  1F3V B;  2YRK A;  1FLL A;  2XXN A;  2EN7 A;  1TF3 A;  2EMK A;  2YTG A;  4R2E A;  4M9V C;  2R1F A;  2J7J A;  2EP3 A;  2YRH A;  2F1Y A;  2EMA A;  2EOS A;  3IVB A;  4R2R A;  1P47 A;  1YZE A;  1WJP A;  2EOZ A;  2EPA A;  4R2D A;  1ZAA C;  2ENA A;  1D01 A;  1A1K A;  2FOO A;  3HQI A;  2CT1 A;  2EPP A;  2YTO A;  1A1I A;  4C9Z A;  2YTJ A;  3MHS C;  2F1Z A;  3EPH A;  2RSI A;  2VRD A;  3UK3 C;  2GKW A;  1CA9 A;  3HQM A;  1X6E A;  4GJH A;  2EOR A;  2MKD A;  1A1J A;  2EL5 A;  1KJK A;  1RF3 A;  2EM8 A;  1YY6 A;  2M9A A;  4R2S A;  2EOM A;  2CSH A;  4R2Q A;  2YTF A;  3HQH A;  2EOH A;  1LB6 A;  2F1X A;  2LCE A;  1A1H A;  4CA1 A;  2EOY A;  4K8U A;  2LO3 A;  5KL7 A;  2LT7 A;  2CTD A;  1L0A A;  4YSI A;  4R2C A;  3VHT B;  1YSA C;  4X9J A;  2EMY A;  2EN4 A;  5KL4 A;  1FLK A;  1UBD C;  4FK5 C;  2LV2 A;  2EM9 A;  2AN6 A;  2FOJ A;  2CR2 A;  5E1T A;  5KL6 A;  1AAY A;  2FOP A;  1YUJ A;  1D0A A;  4Z8M A;  2YU5 A;  3HQL A;  2EM3 A;  2EMH A;  4WSG A;  2EPX A;  2EQ3 A;  2YTI A;  3IVQ A;  2EPC A;  2EE8 A;  5KL3 A;  1A1L A;  4F6M A;  2EQ0 A;  2ENC A;  2EM7 A;  4GHU A;  4I7B A;  4X3G A;  2EMI A;  2EN1 A;  1X6H A;  2EOQ A;  2MDG A;  4F2J C;  2A25 A;  3IVV A;  2RPC A;  1D0J A;  2YSP A;  1NCS A;  2EQ1 A;  2WBS A;  1A1F A;  1X5W A;  1G2F C;  2DGC A;  4I7C A;  2EM6 A;  2ADR A;  4JJQ A;  3M99 B;  2EML A;  2DMI A;  1K2F A;  4GWN A;  2EN8 A;  2DRP A;  3HU6 A;  1ZU1 A;  4I7D A;  4GWM A;  2YSO A;  1D00 A;  2ENH A;  2YTD A;  2EMW A;  3MHH C;  2BB8 A;  2YRM A;  5H9M A;  2EOJ A;  3EPK A;  2EPR A;  2HGH A;  2EPZ A;  3EPL A;  1BBO A;  2EM4 A;  4O1V A;  2EJ4 A;  2D9H A;  4M4E A;  2EL6 A;  1JK1 A;  2EMZ A;  2DLK A;  2EPU A;  2EOE A;  1RMD A;  2JP9 A;  1JK2 A;  3MQS C;  2EOI A;  2MKN A;  1CA4 A;  2EMC A;  4KG9 A;  1LB4 A;  2YTQ A;  1X6F A;  2E72 A;  3EPJ A;  2ELY A;  2NAB A;  4F6N A;  1QSC A;  2I13 A;  1MEY C;  2GHF A;  3HSV A;  4IS1 C;  4R2A A;  1A1G A;  1ZR9 A;  4IJD A;  1G2D C;  1YUI A;  2GLI A;  2DLQ A;  1CZY A;  2PRT A;  2JPA A;  2EM2 A;  4R2P A;  5KL2 A;  1TN9 A;  2WCC 3;  2LVH A;  4GZN C;  2YU8 A;  1LB5 A;  2EMG A;  5KL5 A;  1LLM C;  1DGC A;  2EMF A;  2EN6 A;  3MQR A;  1KZZ A;  3ZJB A;  1TF6 A;  1X3C A;  1BB8 A;  2EM5 A;  2ELZ A;  2EM0 A;  2EN2 A;  2EMX A;  1B69 A;  2YTE A;  1CZZ A;  2EOX A;  1Z1B A;  1F2I G;  2EN3 A;  2EMB A;  2EOF A;  2F1W A;  2YTN A;  1ZMS A;  2WBU A;  1UN6 B;  2WBT A;  2YTP A;  2EL4 A; 
#chains in the Genus database with same CATH topology
 1EH6 A;  2EPM X;  1PKP A;  2YTG A;  4DR3 E;  2EP3 A;  2EOS A;  5A2Q C;  1HR0 E;  1YZE A;  2YZT A;  2EOZ A;  4WXD A;  4LF4 E;  2EPA A;  1XNR E;  2ENA A;  2YTO A;  2M4I A;  4DV1 E;  1N3G A;  4B3S E;  2JR1 A;  3HQM A;  2MKD A;  2K7I A;  2UUC E;  2L2N A;  1YY6 A;  2LRS A;  2CSH A;  4B3M E;  2V8Q B;  1J26 A;  4DR7 E;  1IMU A;  3HQH A;  1A1H A;  3K6Q A;  1FJG E;  2EOY A;  5KL7 A;  3VHT B;  2DB2 A;  5KL4 A;  3KZY A;  4BMJ A;  2LV2 A;  5FLX C;  4P78 A;  2CR2 A;  5E1T A;  2B7V A;  2EM3 A;  4WSG A;  2V85 A;  2EPX A;  4M0V A;  3JU0 A;  1A1L A;  4LU9 A;  2EQ0 A;  1DGC A;  4I7B A;  1GZ6 A;  1QU6 A;  1X6H A;  1IBK E;  1X49 A;  4NZV A;  4R03 A;  2N3G A;  1X5W A;  3JTZ A;  4WFT A;  5AC5 A;  3THN A;  2EM6 A;  4HEI A;  4J8Z A;  3QG5 C;  1ZBT A;  4DV2 E;  2EPL X;  2ZM6 E;  3HQ1 A;  4TUI A;  1XNQ E;  4DV5 E;  4O43 A;  2EPK X;  2MC6 A;  3LLH A;  1X47 A;  2BB8 A;  1IBM E;  4NXM E;  2EPR A;  3EPL A;  2F4V E;  4ZYH A;  1BBO A;  2EZ6 A;  2D9H A;  2EMZ A;  5A6K A;  2HHH E;  2JP9 A;  2EMC A;  2NUG A;  4F6N A;  2L2K B;  1MEY C;  2GHF A;  4BCA A;  4R2A A;  1YUI A;  4GKK E;  4ZYE A;  3FIG A;  1HNZ E;  4R2P A;  1TN9 A;  2JPA A;  5A6J A;  2ODR D;  2LVH A;  4MLQ A;  2WCC 3;  2LTR A;  4WYQ B;  5KL5 A;  5IT9 C;  3J81 C;  2EMF A;  2B7T A;  2EN6 A;  4JI4 E;  4F9B B;  1T38 A;  5IXM B;  1KYQ A;  4DV6 E;  3L00 A;  4LF9 E;  2EN2 A;  4KHP E;  2EM0 A;  4GKJ E;  1B69 A;  1Z1B A;  4DR5 E;  1AH5 A;  1UN6 B;  2MC5 A;  4L8N A;  2YTP A;  1YFH A;  4X64 E;  5LL6 R;  2RQL A;  2HJJ A;  3AUZ A;  1FLL A;  4WSP A;  4WXC A;  1TF3 A;  2EMK A;  2J7J A;  2YRH A;  2EMA A;  3ZOQ B;  1P47 A;  4M30 A;  4BBY A;  5CFF E;  1N34 E;  4WPY A;  3HXL A;  3HQI A;  2YTJ A;  3MHS C;  3KZZ A;  2F1Z A;  2JOB A;  3EPH A;  1IQO A;  2RSI A;  1KJK A;  2LE2 A;  2EL5 A;  1RF3 A;  5AE1 A;  1XMQ E;  2V83 A;  4JI0 E;  4LFC E;  2B3T B;  4JI7 E;  5A6B A;  1PJT A;  5AAS A;  2I9I A;  4OX9 E;  2YTF A;  5IWA E;  4KZS A;  1IBL E;  2IHR 1;  3H09 A;  4CA1 A;  4DUY E;  2DSY A;  2V87 A;  4K8U A;  2RSM A;  1XMO E;  1YPN A;  4LTY A;  5AC4 A;  4X9J A;  4X8W A;  4X65 E;  2FOJ A;  4ZYG A;  5IV8 B;  1AAY A;  4LF8 E;  2FOP A;  4DUZ E;  4O24 A;  2YTI A;  3BID A;  2EPC A;  4F6M A;  4DR2 E;  2EOQ A;  4GHU A;  2MDR A;  2EMI A;  4F9C B;  3IVV A;  1NCS A;  2EQ1 A;  3F6G A;  2WBS A;  2ADR A;  1HNW E;  3M99 B;  2VF1 A;  3IWD A;  3ECR A;  1GQE A;  2EN8 A;  4RHB B;  2DRP A;  4LF5 E;  2YRM A;  3ADJ A;  5H9M A;  3EPK A;  2HGH A;  3C4B A;  2EPZ A;  4LF7 E;  3VYX A;  2EM4 A;  5LLQ A;  4WX9 A;  4TUG A;  3T1H E;  2EPU A;  2EOE A;  2JXP A;  1JK2 A;  2EOI A;  2DMY A;  2Q8U A;  1LB4 A;  1X6F A;  2NAB A;  2I13 A;  4IS1 C;  1WRJ A;  1ZR9 A;  2GLI A;  1G2D C;  4OOG C;  1CZY A;  2PRT A;  5KL2 A;  2VQF E;  2KON A;  4GZN C;  2YU8 A;  4DKK A;  1RC7 A;  3ZJB A;  2YWQ A;  2FTX B;  4O5G A;  2EM5 A;  1GTK A;  2ELZ A;  2E5L E;  2EMX A;  3F6H A;  4BC9 A;  1T4O A;  2EOX A;  2YTN A;  1L4S A;  2WBT A;  4BHB A;  2G7H A;  1BBG A;  2JY9 A;  2R1F A;  4AQY E;  1F3V B;  2XXN A;  1T4L B;  5F3W A;  1YYK A;  3C4T A;  5A6B D;  1WJP A;  1PJQ A;  4F9A B;  4R2D A;  2L3C A;  4DV3 E;  1ZAA C;  3DF6 A;  1FKA E;  2FOO A;  4HTG A;  1PJS A;  1A1I A;  4C9Z A;  5AE3 A;  2VRD A;  3UK3 C;  1N36 E;  1A1J A;  5AE2 A;  2EM8 A;  1EH8 A;  2M9A A;  5LMU E;  3ADL A;  2EOM A;  3ADG A;  2LJH A;  4X62 E;  1X48 A;  2LMZ A;  2EPN A;  3BGH A;  1YYW A;  2EOH A;  2F1X A;  2LCE A;  3C6M A;  4YY3 E;  5ADZ A;  2V86 A;  2R76 A;  2NA2 A;  1HNX E;  2CTD A;  1N33 E;  1L0A A;  4YSI A;  2E1M A;  1YSA C;  2KHX A;  2EMY A;  2FGG A;  2EM9 A;  2AN6 A;  2M1S A;  5KL6 A;  4YHH E;  2V89 A;  1YUJ A;  1D0A A;  2EMH A;  2UXB E;  3MSW A;  3IVQ A;  3T1Y E;  1EKZ A;  5A6A A;  5TSE A;  2ENC A;  2EM7 A;  4X3G A;  2EN1 A;  4X66 E;  2NUF A;  2A25 A;  2RPC A;  4F54 A;  1D0J A;  5BR8 E;  2YSP A;  3OML A;  4I7C A;  4JJQ A;  2DMI A;  2N8X A;  4M2Z A;  2M7Q A;  4GWN A;  1ZU1 A;  2NUE A;  2YSO A;  4KWY A;  5A69 A;  2EPO A;  2YPN A;  2L6M A;  2VQE E;  2EOJ A;  1NEI A;  2HC5 A;  2RS7 A;  2L92 A;  2JVA A;  2EJ4 A;  3EQ1 A;  2WZO A;  2EL6 A;  1JK1 A;  4JI1 E;  4R8O A;  2LBS B;  4K0K E;  2DLK A;  3ADI A;  3MQS C;  2MKN A;  3BF2 A;  4KG9 A;  2YTQ A;  3J80 C;  1IQS A;  2E72 A;  1WHN A;  3EPJ A;  2B9D A;  2VE7 C;  4JI2 E;  3THO B;  1QSC A;  4O4K A;  3HSV A;  4IJD A;  2DLQ A;  2LTS A;  2UUA E;  4BS9 A;  1I94 E;  2EMG A;  1RQ0 A;  1LLM C;  2UU9 E;  2JOX A;  4DMI A;  3MQR A;  4B3R E;  4MLV A;  2H36 X;  4L5N C;  1BB8 A;  1DI2 A;  4DR6 E;  2YTE A;  3HPS A;  1F2I G;  1WHQ A;  2F1W A;  2WBU A;  2YT4 A;  2KOU A;  2EOO A;  2YRK A;  2EN7 A;  4R2E A;  4LFA E;  4M9V C;  3OTO E;  2F1Y A;  1YZ9 A;  3IVB A;  4R2R A;  4JI6 E;  4GEQ B;  4BC7 A;  1ZBQ A;  2F8B A;  1D01 A;  3C6K A;  3RMP A;  1A1K A;  2CT1 A;  2EPP A;  2JWO A;  2RS6 A;  3P1X A;  2L33 A;  2N3H A;  2GKW A;  1CA9 A;  1X6E A;  2EOR A;  4GJH A;  2FV4 B;  4NHR A;  4DV7 E;  1T4N A;  3HPZ A;  1O0W A;  2LJU A;  4R2S A;  3LML A;  4DR1 E;  1PDA A;  2L2M A;  2BBG A;  4R2Q A;  1LB6 A;  4NXN E;  1MGT A;  2LO3 A;  2LT7 A;  4R2C A;  4DV0 E;  2EN4 A;  1FLK A;  1UBD C;  3HTX A;  4FK5 C;  2UXD E;  2JYA A;  3VK6 A;  4Z8M A;  2K4V A;  2YU5 A;  3HQL A;  2DIX A;  4ZYD A;  2EQ3 A;  4DR4 E;  2EE8 A;  1UIL A;  4Q28 A;  5KL3 A;  2MDG A;  4F2J C;  1DQ3 A;  4JI8 E;  4JI5 E;  3KWR A;  2EWL A;  5LMN E;  1WXR A;  2UUB E;  1A1F A;  1G2F C;  2DGC A;  4P7D A;  1T39 A;  2EML A;  4JI3 E;  1K2F A;  2RTX A;  1YYO A;  3HU6 A;  4I7D A;  4GWM A;  1SFE A;  1SR9 A;  1QNT A;  3AV0 A;  1D00 A;  2ENH A;  2YTD A;  5T6J A;  2EMW A;  3MHH C;  3IWB A;  4JYA E;  1STU A;  4O1V A;  4M4E A;  3J7A G;  3DJW A;  4JV5 E;  1RMD A;  4RH8 A;  2GPI A;  3BBG A;  1CA4 A;  2L3J A;  2LUP B;  2L8T A;  4BHC A;  2ELY A;  1EH7 A;  5DNY A;  1A1G A;  2UXC E;  4Q35 B;  2EM2 A;  2V88 A;  1UHZ A;  3VYY A;  1LB5 A;  1J5E E;  2CPN A;  4LF6 E;  1KZZ A;  2LUQ A;  1TF6 A;  3TQM A;  1X3C A;  2ODR C;  4LFB E;  1CZZ A;  3J7Y p;  2EN3 A;  2EMB A;  2EOF A;  4B3T E;  4N4R B;  1ZMS A;  3IWC A;  4DV4 E;  1N32 E;  3JAM C;  2EL4 A;  4I8O A; 
#chains in the Genus database with same CATH homology
 2EOO A;  1F3V B;  2YRK A;  1FLL A;  2XXN A;  2EN7 A;  1TF3 A;  2EMK A;  2YTG A;  4R2E A;  4M9V C;  2R1F A;  2J7J A;  2EP3 A;  2YRH A;  2F1Y A;  2EMA A;  2EOS A;  3IVB A;  4R2R A;  1P47 A;  1YZE A;  1WJP A;  2EOZ A;  2EPA A;  4R2D A;  1ZAA C;  2ENA A;  1D01 A;  1A1K A;  2FOO A;  3HQI A;  2CT1 A;  2EPP A;  2YTO A;  1A1I A;  4C9Z A;  2YTJ A;  3MHS C;  2F1Z A;  3EPH A;  2RSI A;  2VRD A;  3UK3 C;  2GKW A;  1CA9 A;  3HQM A;  1X6E A;  4GJH A;  2EOR A;  2MKD A;  1A1J A;  2EL5 A;  1KJK A;  1RF3 A;  2EM8 A;  1YY6 A;  2M9A A;  4R2S A;  2EOM A;  2CSH A;  4R2Q A;  2YTF A;  3HQH A;  2EOH A;  1LB6 A;  2F1X A;  2LCE A;  1A1H A;  4CA1 A;  2EOY A;  4K8U A;  2LO3 A;  5KL7 A;  2LT7 A;  2CTD A;  1L0A A;  4YSI A;  4R2C A;  3VHT B;  1YSA C;  4X9J A;  2EMY A;  2EN4 A;  5KL4 A;  1FLK A;  1UBD C;  4FK5 C;  2LV2 A;  2EM9 A;  2AN6 A;  2FOJ A;  2CR2 A;  5E1T A;  5KL6 A;  1AAY A;  2FOP A;  1YUJ A;  1D0A A;  4Z8M A;  2YU5 A;  3HQL A;  2EM3 A;  2EMH A;  4WSG A;  2EPX A;  2EQ3 A;  2YTI A;  3IVQ A;  2EPC A;  2EE8 A;  5KL3 A;  1A1L A;  4F6M A;  2EQ0 A;  2ENC A;  2EM7 A;  4GHU A;  4I7B A;  4X3G A;  2EMI A;  2EN1 A;  1X6H A;  2EOQ A;  2MDG A;  4F2J C;  2A25 A;  3IVV A;  2RPC A;  1D0J A;  2YSP A;  1NCS A;  2EQ1 A;  2WBS A;  1A1F A;  1X5W A;  1G2F C;  2DGC A;  4I7C A;  2EM6 A;  2ADR A;  4JJQ A;  3M99 B;  2EML A;  2DMI A;  1K2F A;  4GWN A;  2EN8 A;  2DRP A;  3HU6 A;  1ZU1 A;  4I7D A;  4GWM A;  2YSO A;  1D00 A;  2ENH A;  2YTD A;  2EMW A;  3MHH C;  2BB8 A;  2YRM A;  5H9M A;  2EOJ A;  3EPK A;  2EPR A;  2HGH A;  2EPZ A;  3EPL A;  1BBO A;  2EM4 A;  4O1V A;  2EJ4 A;  2D9H A;  4M4E A;  2EL6 A;  1JK1 A;  2EMZ A;  2DLK A;  2EPU A;  2EOE A;  1RMD A;  2JP9 A;  1JK2 A;  3MQS C;  2EOI A;  2MKN A;  1CA4 A;  2EMC A;  4KG9 A;  1LB4 A;  2YTQ A;  1X6F A;  2E72 A;  3EPJ A;  2ELY A;  2NAB A;  4F6N A;  1QSC A;  2I13 A;  1MEY C;  2GHF A;  3HSV A;  4IS1 C;  4R2A A;  1A1G A;  1ZR9 A;  4IJD A;  1G2D C;  1YUI A;  2GLI A;  2DLQ A;  1CZY A;  2PRT A;  2JPA A;  2EM2 A;  4R2P A;  5KL2 A;  1TN9 A;  2WCC 3;  2LVH A;  4GZN C;  2YU8 A;  1LB5 A;  2EMG A;  5KL5 A;  1LLM C;  1DGC A;  2EMF A;  2EN6 A;  3MQR A;  1KZZ A;  3ZJB A;  1TF6 A;  1X3C A;  1BB8 A;  2EM5 A;  2ELZ A;  2EM0 A;  2EN2 A;  2EMX A;  1B69 A;  2YTE A;  1CZZ A;  2EOX A;  1Z1B A;  1F2I G;  2EN3 A;  2EMB A;  2EOF A;  2F1W A;  2YTN A;  1ZMS A;  2WBU A;  1UN6 B;  2WBT A;  2YTP A;  2EL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...