1FLLA

Molecular basis for cd40 signaling mediated by traf3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
205
structure length
205
Chain Sequence
LESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords TNF RECEPTOR ASSOCIATED FACTOR 3
publication title Molecular basis for CD40 signaling mediated by TRAF3.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 1fllA00
4JJQA 1LB4A 3MQRA 1YY6A 4GWMA 3HQMA 2AN6A 4M4EA 2XXNA 1CA4A 1QSCA 4GJHA 1LB5A 4X3GA 3IVQA 1K2FA 3ZJBA 1ZMSA 2CR2A 3MQSC 4C9ZA 4O1VA 1LB6A 1RF3A 2FOJA 4K8UA 4CA1A 3HQLA 2FOOA 1D0AA 2F1ZA 4Z8MA 1D0JA 2F1YA 5H9MA 5E1TA 3HSVA 4I7BA 1CA9A 1F3VB 3HQHA 4I7DA 4I7CA 4YSIA 2FOPA 1FLKA 1KZZA 2GKWA 3HQIA 4GHUA 4GWNA 1L0AA 1FLLA 3IVBA 3IVVA 3HU6A 2F1XA 1D01A 1YZEA 2F1WA 4KG9A 1D00A 1CZYA 2A25A 1CZZA
chains in the Genus database with same CATH superfamily
4JJQA 1LB4A 3MQRA 1YY6A 4GWMA 3HQMA 2AN6A 4M4EA 2XXNA 1CA4A 1QSCA 4GJHA 1LB5A 4X3GA 3IVQA 1K2FA 3ZJBA 1ZMSA 2CR2A 3MQSC 4C9ZA 4O1VA 1LB6A 1RF3A 2FOJA 4K8UA 4CA1A 3HQLA 2FOOA 1D0AA 2F1ZA 4Z8MA 1D0JA 2F1YA 5H9MA 5E1TA 3HSVA 4I7BA 1CA9A 1F3VB 3HQHA 4I7DA 4I7CA 4YSIA 2FOPA 1FLKA 1KZZA 2GKWA 3HQIA 4GHUA 4GWNA 1L0AA 1FLLA 3IVBA 3IVVA 3HU6A 2F1XA 1D01A 1YZEA 2F1WA 4KG9A 1D00A 1CZYA 2A25A 1CZZA
chains in the Genus database with same CATH topology
4JJQA 1LB4A 3MQRA 1YY6A 4GWMA 3HQMA 2AN6A 4M4EA 2XXNA 1CA4A 1QSCA 4GJHA 1LB5A 4X3GA 3IVQA 1K2FA 3ZJBA 1ZMSA 2CR2A 3MQSC 4C9ZA 4O1VA 1LB6A 1RF3A 2FOJA 4K8UA 4CA1A 3HQLA 2FOOA 1D0AA 2F1ZA 4Z8MA 1D0JA 2F1YA 5H9MA 5E1TA 3HSVA 4I7BA 1CA9A 1F3VB 3HQHA 4I7DA 4I7CA 4YSIA 2FOPA 1FLKA 1KZZA 2GKWA 3HQIA 4GHUA 4GWNA 1L0AA 1FLLA 3IVBA 3IVVA 3HU6A 2F1XA 1D01A 1YZEA 2F1WA 4KG9A 1D00A 1CZYA 2A25A 1CZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJQ A;  1LB4 A;  3MQR A;  1YY6 A;  4GWM A;  3HQM A;  2AN6 A;  4M4E A;  2XXN A;  1CA4 A;  1QSC A;  4GJH A;  1LB5 A;  4X3G A;  3IVQ A;  1K2F A;  3ZJB A;  1ZMS A;  2CR2 A;  3MQS C;  4C9Z A;  4O1V A;  1LB6 A;  1RF3 A;  2FOJ A;  4K8U A;  4CA1 A;  3HQL A;  2FOO A;  1D0A A;  2F1Z A;  4Z8M A;  1D0J A;  2F1Y A;  5H9M A;  5E1T A;  3HSV A;  4I7B A;  1CA9 A;  1F3V B;  3HQH A;  4I7D A;  4I7C A;  4YSI A;  2FOP A;  1FLK A;  1KZZ A;  2GKW A;  3HQI A;  4GHU A;  4GWN A;  1L0A A;  1FLL A;  3IVB A;  3IVV A;  3HU6 A;  2F1X A;  1D01 A;  1YZE A;  2F1W A;  4KG9 A;  1D00 A;  1CZY A;  2A25 A;  1CZZ A; 
#chains in the Genus database with same CATH topology
 4JJQ A;  1LB4 A;  3MQR A;  1YY6 A;  4GWM A;  3HQM A;  2AN6 A;  4M4E A;  2XXN A;  1CA4 A;  1QSC A;  4GJH A;  1LB5 A;  4X3G A;  3IVQ A;  1K2F A;  3ZJB A;  1ZMS A;  2CR2 A;  3MQS C;  4C9Z A;  4O1V A;  1LB6 A;  1RF3 A;  2FOJ A;  4K8U A;  4CA1 A;  3HQL A;  2FOO A;  1D0A A;  2F1Z A;  4Z8M A;  1D0J A;  2F1Y A;  5H9M A;  5E1T A;  3HSV A;  4I7B A;  1CA9 A;  1F3V B;  3HQH A;  4I7D A;  4I7C A;  4YSI A;  2FOP A;  1FLK A;  1KZZ A;  2GKW A;  3HQI A;  4GHU A;  4GWN A;  1L0A A;  1FLL A;  3IVB A;  3IVV A;  3HU6 A;  2F1X A;  1D01 A;  1YZE A;  2F1W A;  4KG9 A;  1D00 A;  1CZY A;  2A25 A;  1CZZ A; 
#chains in the Genus database with same CATH homology
 4JJQ A;  1LB4 A;  3MQR A;  1YY6 A;  4GWM A;  3HQM A;  2AN6 A;  4M4E A;  2XXN A;  1CA4 A;  1QSC A;  4GJH A;  1LB5 A;  4X3G A;  3IVQ A;  1K2F A;  3ZJB A;  1ZMS A;  2CR2 A;  3MQS C;  4C9Z A;  4O1V A;  1LB6 A;  1RF3 A;  2FOJ A;  4K8U A;  4CA1 A;  3HQL A;  2FOO A;  1D0A A;  2F1Z A;  4Z8M A;  1D0J A;  2F1Y A;  5H9M A;  5E1T A;  3HSV A;  4I7B A;  1CA9 A;  1F3V B;  3HQH A;  4I7D A;  4I7C A;  4YSI A;  2FOP A;  1FLK A;  1KZZ A;  2GKW A;  3HQI A;  4GHU A;  4GWN A;  1L0A A;  1FLL A;  3IVB A;  3IVV A;  3HU6 A;  2F1X A;  1D01 A;  1YZE A;  2F1W A;  4KG9 A;  1D00 A;  1CZY A;  2A25 A;  1CZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...