1LB5A

Traf6-rank complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
155
Chain Sequence
QQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords TNF receptor-associated factor 6
publication title Distinct molecular mechanism for initiating TRAF6 signalling.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 155
sequence length 155
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 1lb5A00
1YY6A 1LB6A 1D0JA 4GJHA 1CA9A 2F1YA 2FOJA 1D00A 1K2FA 2F1WA 4M4EA 2GKWA 3ZJBA 3HQIA 3IVQA 4I7BA 3HSVA 1FLLA 1RF3A 1YZEA 3HQLA 3MQSC 4O1VA 4YSIA 5H9MA 4I7CA 1L0AA 3MQRA 4GWNA 1LB4A 2A25A 4C9ZA 1CZYA 2XXNA 1D0AA 3HQHA 1ZMSA 4GHUA 2FOPA 1CA4A 1D01A 1KZZA 1QSCA 2F1XA 3IVBA 1LB5A 3HQMA 1F3VB 4JJQA 4CA1A 2AN6A 1FLKA 4Z8MA 5E1TA 2CR2A 4I7DA 4X3GA 4K8UA 3IVVA 2F1ZA 4KG9A 1CZZA 3HU6A 2FOOA 4GWMA
chains in the Genus database with same CATH superfamily
1YY6A 1LB6A 1D0JA 4GJHA 1CA9A 2F1YA 2FOJA 1D00A 1K2FA 2F1WA 4M4EA 2GKWA 3ZJBA 3HQIA 3IVQA 4I7BA 3HSVA 1FLLA 1RF3A 1YZEA 3HQLA 3MQSC 4O1VA 4YSIA 5H9MA 4I7CA 1L0AA 3MQRA 4GWNA 1LB4A 2A25A 4C9ZA 1CZYA 2XXNA 1D0AA 3HQHA 1ZMSA 4GHUA 2FOPA 1CA4A 1D01A 1KZZA 1QSCA 2F1XA 3IVBA 1LB5A 3HQMA 1F3VB 4JJQA 4CA1A 2AN6A 1FLKA 4Z8MA 5E1TA 2CR2A 4I7DA 4X3GA 4K8UA 3IVVA 2F1ZA 4KG9A 1CZZA 3HU6A 2FOOA 4GWMA
chains in the Genus database with same CATH topology
1YY6A 1LB6A 1D0JA 4GJHA 1CA9A 2F1YA 2FOJA 1D00A 1K2FA 2F1WA 4M4EA 2GKWA 3ZJBA 3HQIA 3IVQA 4I7BA 3HSVA 1FLLA 1RF3A 1YZEA 3HQLA 3MQSC 4O1VA 4YSIA 5H9MA 4I7CA 1L0AA 3MQRA 4GWNA 1LB4A 2A25A 4C9ZA 1CZYA 2XXNA 1D0AA 3HQHA 1ZMSA 4GHUA 2FOPA 1CA4A 1D01A 1KZZA 1QSCA 2F1XA 3IVBA 1LB5A 3HQMA 1F3VB 4JJQA 4CA1A 2AN6A 1FLKA 4Z8MA 5E1TA 2CR2A 4I7DA 4X3GA 4K8UA 3IVVA 2F1ZA 4KG9A 1CZZA 3HU6A 2FOOA 4GWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YY6 A;  1LB6 A;  1D0J A;  4GJH A;  1CA9 A;  2F1Y A;  2FOJ A;  1D00 A;  1K2F A;  2F1W A;  4M4E A;  2GKW A;  3ZJB A;  3HQI A;  3IVQ A;  4I7B A;  3HSV A;  1FLL A;  1RF3 A;  1YZE A;  3HQL A;  3MQS C;  4O1V A;  4YSI A;  5H9M A;  4I7C A;  1L0A A;  3MQR A;  4GWN A;  1LB4 A;  2A25 A;  4C9Z A;  1CZY A;  2XXN A;  1D0A A;  3HQH A;  1ZMS A;  4GHU A;  2FOP A;  1CA4 A;  1D01 A;  1KZZ A;  1QSC A;  2F1X A;  3IVB A;  1LB5 A;  3HQM A;  1F3V B;  4JJQ A;  4CA1 A;  2AN6 A;  1FLK A;  4Z8M A;  5E1T A;  2CR2 A;  4I7D A;  4X3G A;  4K8U A;  3IVV A;  2F1Z A;  4KG9 A;  1CZZ A;  3HU6 A;  2FOO A;  4GWM A; 
#chains in the Genus database with same CATH topology
 1YY6 A;  1LB6 A;  1D0J A;  4GJH A;  1CA9 A;  2F1Y A;  2FOJ A;  1D00 A;  1K2F A;  2F1W A;  4M4E A;  2GKW A;  3ZJB A;  3HQI A;  3IVQ A;  4I7B A;  3HSV A;  1FLL A;  1RF3 A;  1YZE A;  3HQL A;  3MQS C;  4O1V A;  4YSI A;  5H9M A;  4I7C A;  1L0A A;  3MQR A;  4GWN A;  1LB4 A;  2A25 A;  4C9Z A;  1CZY A;  2XXN A;  1D0A A;  3HQH A;  1ZMS A;  4GHU A;  2FOP A;  1CA4 A;  1D01 A;  1KZZ A;  1QSC A;  2F1X A;  3IVB A;  1LB5 A;  3HQM A;  1F3V B;  4JJQ A;  4CA1 A;  2AN6 A;  1FLK A;  4Z8M A;  5E1T A;  2CR2 A;  4I7D A;  4X3G A;  4K8U A;  3IVV A;  2F1Z A;  4KG9 A;  1CZZ A;  3HU6 A;  2FOO A;  4GWM A; 
#chains in the Genus database with same CATH homology
 1YY6 A;  1LB6 A;  1D0J A;  4GJH A;  1CA9 A;  2F1Y A;  2FOJ A;  1D00 A;  1K2F A;  2F1W A;  4M4E A;  2GKW A;  3ZJB A;  3HQI A;  3IVQ A;  4I7B A;  3HSV A;  1FLL A;  1RF3 A;  1YZE A;  3HQL A;  3MQS C;  4O1V A;  4YSI A;  5H9M A;  4I7C A;  1L0A A;  3MQR A;  4GWN A;  1LB4 A;  2A25 A;  4C9Z A;  1CZY A;  2XXN A;  1D0A A;  3HQH A;  1ZMS A;  4GHU A;  2FOP A;  1CA4 A;  1D01 A;  1KZZ A;  1QSC A;  2F1X A;  3IVB A;  1LB5 A;  3HQM A;  1F3V B;  4JJQ A;  4CA1 A;  2AN6 A;  1FLK A;  4Z8M A;  5E1T A;  2CR2 A;  4I7D A;  4X3G A;  4K8U A;  3IVV A;  2F1Z A;  4KG9 A;  1CZZ A;  3HU6 A;  2FOO A;  4GWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...