4CA1A

Crystal structure of siah1 at 1.58 a resolution.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
192
structure length
189
Chain Sequence
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two High-Resolution Structures of the Human E3 Ubiquitin Ligase Siah1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE SIAH1
total genus 42
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4ca1A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ca1A01
3C5KA 4V3LC 3T6RA 2L75A 5FB0A 3MQRA 3ZPVE 4CA1A 5LKUA 1CZYA 1VYXA 1X4JA 3N9NA 4WZ0A 1T1HA 2EGPA 4F52B 2Y43A 5FEYA 1WGMA 5FB1A 2H0DA 2QICA 1LDJB 4A4CA 4GJHA 2MD8C 4KG9A 1ZBDB 3U5MA 2VPGA 1LB5A 4O64A 1XWHA 5H9MA 2LXPC 2F1WA 5JG6A 2CT2A 1K2FA 4LJNA 3HSVA 1X4UA 4Z8MA 3PUQA 2FOJA 1WE9A 2L5UA 3N9QA 2K1JA 3O34A 1D01A 2LRIC 2HYED 4GNEA 3GV4A 4BBQA 5B77A 2KR4A 5LKZA 2RSDA 3ZNIA 2YURA 4K8UA 5G0FA 1WENA 2YW8A 5DINA 3O35A 4YABA 1DVPA 1HYIA 3O70A 4L58A 2FSAA 3VK6A 2IDAA 2XEUA 2JMJA 2YT5A 2K17A 1YZEA 4WZ2A 1RMDA 4PTBA 5H1UA 5G04B 3KV5A 3N9MA 2ECIA 4B86C 3N9PA 2RI7A 2YHOA 3QZVA 1WFKA 4ZUXU 1WEOA 4IC2A 1LB4A 4N4FA 3GL6A 2L0BA 4LADB 2F42A 2KU3A 3HCUA 2KGGA 2M6MA 5D1LB 3IVVA 3N9LA 1Z2QA 2MNYA 2VPBA 2EODA 4NN2A 2KYUA 2AN6A 3L11A 4GNGA 2VPEA 2D8SA 2E6SA 1WEMA 2C2VS 4YADA 5J3XA 2CKLA 4XI1A 2H0DB 2KREA 3L1ZB 2LGVA 2KGIA 4QF3A 1IYMA 2LGGA 3V43A 1WEVA 3HQMA 2ECNA 1MM2A 4FK5A 2LV9A 2JMDA 2ECVA 3KQIA 1D00A 3MHHA 1F3VB 2L80A 2VNFA 4YATA 2L43A 2PNXA 2KWJA 3KNVA 2KIZA 1WIMA 2UZGA 3RPGC 1N87A 3HCTA 4GHUA 5B79A 1F62A 2LGKA 1FLLA 2ECJA 2F1XA 4S3OC 4WA6A 4LK9A 3U5OA 3SHBA 1WEWA 4MSXA 4MVTA 4AVXA 2BAYA 1WEQA 1Z6UA 2XXNA 3MQSC 5DKAA 1CHCA 2QJ0A 2VJEA 1CZZA 5C13A 4UI9B 4YAXA 5EYAF 1WEUA 5TBNA 3O33A 4R7EA 1BORA 4FO9A 2CR2A 3PHDA 4R2YA 2FOPA 4LKAA 2DX8A 4AP4A 3IVQA 2KWOA 4AYCA 3M99A 4V3KC 3MHSA 3N9OA 2FUIA 2FOOA 2KWKA 2K4DA 2E6RA 4S3OB 2EA6A 2YHNA 3O36A 3M62A 3HU6A 4GWNA 2ECWA 1JM7A 3ZYQA 1D0JA 3I2DA 3ZTGA 3ZJBA 3DQVR 2MUMA 4BHWA 1FP0A 5TABA 2VJFB 2JRJA 4FJCA 2MD7B 2FUUA 4UP5A 4YBMA 3HCSA 5KH9A 5TDWA 1G25A 3O37A 4JJQA 5G05B 2CSZA 1V87A 3HQHA 2M1RA 2Y1NA 2YSJA 4GNFA 4AUQB 4QF2A 1HYJA 2CSYA 3L1XA 1QSCA 1RF3A 5KH7A 4TKPB 2ECTA 1VFYA 3NG2A 4L7XA 1JOCA 3M63A 4O1VA 4X3GA 4A4BA 2VPDA 3SOWA 4LLBA 4I7DA 1CA9A 3EB6A 1LB6A 1VD4A 1CA4A 4PPEA 2CKLB 4M4EA 4A0CD 3EB5A 3ZVYA 4P5OB 4R8PK 2JMIA 3RTRB 2F6JA 5AIUA 2YSMA 2KFTA 2YQLA 5H1VA 2XB1A 3LQHA 2LGLA 1KZZA 2PUYA 3ZVZB 3SOXA 3KV6A 2ZETC 4YC9A 2ECGA 2K16A 1YY6A 4B7YC 2LXHC 2YYRA 2A25A 2KWNA 4ZQLA 1JM7B 5E1TA 2NAAA 3C6WA 2YREA 4GWMA 4FIPA 4Q6FA 5KH3A 2LQ6A 3LRQA 3T7LA 3SOUA 2VJFA 5B75A 5LKTA 4AYCB 4C9ZA 2M85A 4YSIA 3DPLR 5AITA 3O7AA 1D0AA 4A49A 3IVBA 2G6QA 2M3HA 1WILA 2LN0A 2F1YA 3PURA 3HQIA 4ZDTA 4IC3A 3IHPA 1ZMSA 2VJEB 3LQJA 3FL2A 3U5PA 1X4IA 2MA5A 2G45A 5C11A 2LDRA 5I3LA 4GB0A 4GNDA 2G43A 1MM3A 2MA6A 1U6GB 2KE1A 4N3WA 4WZ3B 3RPGB 4I7CA 4CCGX 2QIZA 2HDPA 5LCWB 3U5NA 5B76A 2I50A 2VP7A 4UP0A 2MIQA 4YBTA 2F6NA 1Z60A 2F1ZA 5D1MB 5TDRA 3HQLA 5D1KB 4YBSA 1WESA 1LDKC 1WEPA 5LKXA 2MT5A 2Y1MA 5B78A 4W4UA 5B8DA 2GKWA 2MNZA 2OXQC 1FLKA 2YU4A 5H1TA 3ZPV1 2C2LA 1E4UA 3HTKC 5TRBA 3LQIA 2YUCA 3ASLA 4I7BA 1L0AA 1FBVA 5FERA 1WEEA 2YQMA
chains in the Genus database with same CATH superfamily
3C5KA 4V3LC 3T6RA 2JUNA 2L75A 5FB0A 3MQRA 5SVYA 3ZPVE 4CA1A 5LKUA 1CZYA 1VYXA 5K3QA 1X4JA 3N9NA 4WZ0A 1T1HA 2EGPA 4H9DA 4F52B 2Y43A 3FEHA 5FEYA 2M13A 1WGMA 5FB1A 2H0DA 2QICA 1LDJB 4A4CA 4GJHA 2MD8C 4KG9A 1ZBDB 3U5MA 2VPGA 1LB5A 4O64A 1XWHA 5H9MA 2LXPC 2F1WA 5JG6A 3T9KA 2CT2A 1K2FA 4LJNA 5SVIA 3HSVA 1X4UA 4Z8MA 2KKYA 3LVRE 5SVXA 3PUQA 2FOJA 1WE9A 2L5UA 3N9QA 2K1JA 3O34A 1D01A 2LRIC 2HYED 4GNEA 3GV4A 4BBQA 5B77A 3FANA 2KR4A 5LKZA 2RSDA 2CONA 3ZNIA 3FM8C 2YURA 4K8UA 5G0FA 1WENA 2YW8A 3FJUB 5DINA 2MKEA 3O35A 4YABA 1DVPA 1HYIA 3O70A 4L58A 2FSAA 3VK6A 2IDAA 2XEUA 2CSVA 2JM3A 2JMJA 2YT5A 2K17A 1YZEA 4WZ2A 2KKXA 3O47A 1RMDA 2CRRA 4PTBA 5H1UA 5G04B 3KV5A 3N9MA 2ECIA 4B86C 3N9PA 1MBMA 2RI7A 3KDEC 2YHOA 2XOZA 3QZVA 1WFKA 4ZUXU 1WEOA 3LVQE 4IC2A 1LB4A 4N4FA 3GL6A 2L0BA 4LADB 2F42A 2KU3A 3HCUA 2KGGA 2M6MA 5D1LB 3IVVA 3N9LA 1Z2QA 2MNYA 2VPBA 2EODA 4NN2A 2KYUA 2AN6A 3L11A 4GNGA 2VPEA 2D8SA 2E6SA 1WEMA 2C2VS 4YADA 5J3XA 2CKLA 4XI1A 2H0DB 2KREA 3L1ZB 2LGVA 2KGIA 4QF3A 1IYMA 2LGGA 3V43A 1WEVA 3HQMA 2ECNA 3Q1DA 1MM2A 4FK5A 2LV9A 2JMDA 2ECVA 3KQIA 1D00A 3MHHA 1F3VB 2L80A 2VNFA 4YATA 2L43A 2PNXA 2KWJA 3KNVA 2KIZA 1WIMA 2UZGA 3RPGC 1N87A 3HCTA 4GHUA 5B79A 1F62A 2LGKA 1FLLA 2ECJA 2F1XA 4S3OC 4WA6A 4LK9A 3U5OA 3SHBA 1WEWA 4MSXA 4MVTA 4AVXA 2BAYA 1WEQA 1Z6UA 3DDTA 2XXNA 3MQSC 5SVIB 5DKAA 1CHCA 2QJ0A 2VJEA 1CZZA 5C13A 3LDYA 4UI9B 4YAXA 5EYAF 1WEUA 5TBNA 2FD4A 3O33A 4Z0OA 4R7EA 1BORA 4FO9A 2CR2A 3PHDA 4R2YA 2FOPA 4LKAA 4F1PA 2DX8A 4AP4A 3IVQA 2KWOA 4AYCA 3M99A 4V3KC 3MHSA 2L7PA 3N9OA 2LAUA 2FUIA 2FOOA 2KWKA 2K4DA 2E6RA 4S3OB 3DWDA 2EA6A 2YHNA 2EXUA 3O36A 3M62A 3HU6A 4GWNA 2ECWA 1JM7A 3ZYQA 1D0JA 3I2DA 3ZTGA 3ZJBA 3DQVR 2MUMA 4BHWA 1FP0A 5TABA 2VJFB 2JRJA 2DSMA 4FJCA 2MD7B 2FUUA 4UP5A 4YBMA 3HCSA 5KH9A 5TDWA 1G25A 3O37A 4JJQA 2CRWA 5G05B 2CSZA 1V87A 3HQHA 2D8UA 2M1RA 2Y1NA 2YSJA 4GNFA 4AUQB 4QF2A 1HYJA 2CSYA 3L1XA 1QSCA 1RF3A 4OGCA 5KH7A 4TKPB 4OGEA 2ECTA 1VFYA 3NG2A 4L7XA 2OWAA 1JOCA 2XOCA 3M63A 4O1VA 4X3GA 4A4BA 2VPDA 2E61A 3JUEA 4LLBA 4I7DA 1CA9A 3EB6A 3SOWA 1LB6A 1VD4A 1CA4A 4PPEA 2CKLB 4M4EA 4A0CD 3EB5A 3ZVYA 4P5OB 4R8PK 2JMIA 3RTRB 2F6JA 5AIUA 2YSMA 2KFTA 2YQLA 5H1VA 2XB1A 2EGMA 3LQHA 3MDBC 2LGLA 1KZZA 2PUYA 3ZVZB 3SOXA 4O62A 3KV6A 2ZETC 4YC9A 2XOYA 2ECGA 2K16A 1YY6A 3PLWA 4B7YC 2LXHC 2YYRA 4QQ4A 2A25A 2KWNA 4ZQLA 1JM7B 5E1TA 2NAAA 3E2DA 3FAOA 3C6WA 2YREA 3LJUX 4GWMA 4FIPA 4Q6FA 5KH3A 2P57A 2LQ6A 3LRQA 3T7LA 3SOUA 2VJFA 5B75A 5LKTA 4AYCB 4C9ZA 2M85A 4YSIA 3DPLR 5AITA 3O7AA 1D0AA 4A49A 3SUBA 3IVBA 2G6QA 2M3HA 1WILA 2LN0A 2F1YA 3PURA 3HQIA 4Z0RA 3M7KA 4ZDTA 3H7HA 4IC3A 3IHPA 1ZMSA 2VJEB 3LQJA 3FL2A 3U5PA 1X4IA 2MA5A 1DCQA 2G45A 5C11A 2LDRA 5I3LA 4GB0A 4GNDA 2G43A 1MM3A 2MA6A 1U6GB 2KE1A 4N3WA 4WZ3B 3RPGB 2YVRA 4I7CA 4CCGX 2QIZA 2HDPA 5LCWB 2IQJA 3U5NA 5B76A 2I50A 2VP7A 4UP0A 2MIQA 4YBTA 2F6NA 1Z60A 2F1ZA 5D1MB 5TDRA 3HQLA 5D1KB 2RR4A 4YBSA 2B0OE 1WESA 1LDKC 1WEPA 5LKXA 2MT5A 2Y1MA 5B78A 4W4UA 2XP0A 5B8DA 2FFWA 2GKWA 2MNZA 2OXQC 1FLKA 2YU4A 5H1TA 3ZPV1 2C2LA 1E4UA 3HTKC 5TRBA 2DJAA 3LQIA 2YUCA 3ASLA 4I7BA 1L0AA 1FBVA 5FERA 1WEEA 2YQMA
chains in the Genus database with same CATH topology
3C5KA 4V3LC 3T6RA 2L75A 5FB0A 3MQRA 3ZPVE 4CA1A 5LKUA 1CZYA 1VYXA 1X4JA 3N9NA 4WZ0A 1T1HA 2EGPA 4F52B 2Y43A 5FEYA 1WGMA 5FB1A 2H0DA 2QICA 1LDJB 4A4CA 4GJHA 2MD8C 4KG9A 1ZBDB 3U5MA 2VPGA 1LB5A 4O64A 1XWHA 5H9MA 2LXPC 2F1WA 5JG6A 2CT2A 1K2FA 4LJNA 3HSVA 1X4UA 4Z8MA 3PUQA 2FOJA 1WE9A 2L5UA 3N9QA 2K1JA 3O34A 1D01A 2LRIC 2HYED 4GNEA 3GV4A 4BBQA 5B77A 2KR4A 5LKZA 2RSDA 3ZNIA 2YURA 4K8UA 5G0FA 1WENA 2YW8A 5DINA 3O35A 4YABA 1DVPA 1HYIA 3O70A 4L58A 2FSAA 3VK6A 2IDAA 2XEUA 2JMJA 2YT5A 2K17A 1YZEA 4WZ2A 1RMDA 4PTBA 5H1UA 5G04B 3KV5A 3N9MA 2ECIA 4B86C 3N9PA 2RI7A 2YHOA 3QZVA 1WFKA 4ZUXU 1WEOA 4IC2A 1LB4A 4N4FA 3GL6A 2L0BA 4LADB 2F42A 2KU3A 3HCUA 2KGGA 2M6MA 5D1LB 3IVVA 3N9LA 1Z2QA 2MNYA 2VPBA 2EODA 4NN2A 2KYUA 2AN6A 3L11A 4GNGA 2VPEA 2D8SA 2E6SA 1WEMA 2C2VS 4YADA 5J3XA 2CKLA 4XI1A 2H0DB 2KREA 3L1ZB 2LGVA 2KGIA 4QF3A 1IYMA 2LGGA 3V43A 1WEVA 3HQMA 2ECNA 1MM2A 4FK5A 2LV9A 2JMDA 2ECVA 3KQIA 1D00A 3MHHA 1F3VB 2L80A 2VNFA 4YATA 2L43A 2PNXA 2KWJA 3KNVA 2KIZA 1WIMA 2UZGA 3RPGC 1N87A 3HCTA 4GHUA 5B79A 1F62A 2LGKA 1FLLA 2ECJA 2F1XA 4S3OC 4WA6A 4LK9A 3U5OA 3SHBA 1WEWA 4MSXA 4MVTA 4AVXA 2BAYA 1WEQA 1Z6UA 2XXNA 3MQSC 5DKAA 1CHCA 2QJ0A 2VJEA 1CZZA 5C13A 4UI9B 4YAXA 5EYAF 1WEUA 5TBNA 3O33A 4R7EA 1BORA 4FO9A 2CR2A 3PHDA 4R2YA 2FOPA 4LKAA 2DX8A 4AP4A 3IVQA 2KWOA 4AYCA 3M99A 4V3KC 3MHSA 3N9OA 2FUIA 2FOOA 2KWKA 2K4DA 2E6RA 4S3OB 2EA6A 2YHNA 3O36A 3M62A 3HU6A 4GWNA 2ECWA 1JM7A 3ZYQA 1D0JA 3I2DA 3ZTGA 3ZJBA 3DQVR 2MUMA 4BHWA 1FP0A 5TABA 2VJFB 2JRJA 4FJCA 2MD7B 2FUUA 4UP5A 4YBMA 3HCSA 5KH9A 5TDWA 1G25A 3O37A 4JJQA 5G05B 2CSZA 1V87A 3HQHA 2M1RA 2Y1NA 2YSJA 4GNFA 4AUQB 4QF2A 1HYJA 2CSYA 3L1XA 1QSCA 1RF3A 5KH7A 4TKPB 2ECTA 1VFYA 3NG2A 4L7XA 1JOCA 3M63A 4O1VA 4X3GA 4A4BA 2VPDA 3SOWA 4LLBA 4I7DA 1CA9A 3EB6A 1LB6A 1VD4A 1CA4A 4PPEA 2CKLB 4M4EA 4A0CD 3EB5A 3ZVYA 4P5OB 4R8PK 2JMIA 3RTRB 2F6JA 5AIUA 2YSMA 2KFTA 2YQLA 5H1VA 2XB1A 3LQHA 2LGLA 1KZZA 2PUYA 3ZVZB 3SOXA 3KV6A 2ZETC 4YC9A 2ECGA 2K16A 1YY6A 4B7YC 2LXHC 2YYRA 2A25A 2KWNA 4ZQLA 1JM7B 5E1TA 2NAAA 3C6WA 2YREA 4GWMA 4FIPA 4Q6FA 5KH3A 2LQ6A 3LRQA 3T7LA 3SOUA 2VJFA 5B75A 5LKTA 4AYCB 4C9ZA 2M85A 4YSIA 3DPLR 5AITA 3O7AA 1D0AA 4A49A 3IVBA 2G6QA 2M3HA 1WILA 2LN0A 2F1YA 3PURA 3HQIA 4ZDTA 4IC3A 3IHPA 1ZMSA 2VJEB 3LQJA 3FL2A 3U5PA 1X4IA 2MA5A 2G45A 5C11A 2LDRA 5I3LA 4GB0A 4GNDA 2G43A 1MM3A 2MA6A 1U6GB 2KE1A 4N3WA 4WZ3B 3RPGB 4I7CA 4CCGX 2QIZA 2HDPA 5LCWB 3U5NA 5B76A 2I50A 2VP7A 4UP0A 2MIQA 4YBTA 2F6NA 1Z60A 2F1ZA 5D1MB 5TDRA 3HQLA 5D1KB 4YBSA 1WESA 1LDKC 1WEPA 5LKXA 2MT5A 2Y1MA 5B78A 4W4UA 5B8DA 2GKWA 2MNZA 2OXQC 1FLKA 2YU4A 5H1TA 3ZPV1 2C2LA 1E4UA 3HTKC 5TRBA 3LQIA 2YUCA 3ASLA 4I7BA 1L0AA 1FBVA 5FERA 1WEEA 2YQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5K A;  4V3L C;  3T6R A;  2L75 A;  5FB0 A;  3MQR A;  3ZPV E;  4CA1 A;  5LKU A;  1CZY A;  1VYX A;  1X4J A;  3N9N A;  4WZ0 A;  1T1H A;  2EGP A;  4F52 B;  2Y43 A;  5FEY A;  1WGM A;  5FB1 A;  2H0D A;  2QIC A;  1LDJ B;  4A4C A;  4GJH A;  2MD8 C;  4KG9 A;  1ZBD B;  3U5M A;  2VPG A;  1LB5 A;  4O64 A;  1XWH A;  5H9M A;  2LXP C;  2F1W A;  5JG6 A;  2CT2 A;  1K2F A;  4LJN A;  3HSV A;  1X4U A;  4Z8M A;  3PUQ A;  2FOJ A;  1WE9 A;  2L5U A;  3N9Q A;  2K1J A;  3O34 A;  1D01 A;  2LRI C;  2HYE D;  4GNE A;  3GV4 A;  4BBQ A;  5B77 A;  2KR4 A;  5LKZ A;  2RSD A;  3ZNI A;  2YUR A;  4K8U A;  5G0F A;  1WEN A;  2YW8 A;  5DIN A;  3O35 A;  4YAB A;  1DVP A;  1HYI A;  3O70 A;  4L58 A;  2FSA A;  3VK6 A;  2IDA A;  2XEU A;  2JMJ A;  2YT5 A;  2K17 A;  1YZE A;  4WZ2 A;  1RMD A;  4PTB A;  5H1U A;  5G04 B;  3KV5 A;  3N9M A;  2ECI A;  4B86 C;  3N9P A;  2RI7 A;  2YHO A;  3QZV A;  1WFK A;  4ZUX U;  1WEO A;  4IC2 A;  1LB4 A;  4N4F A;  3GL6 A;  2L0B A;  4LAD B;  2F42 A;  2KU3 A;  3HCU A;  2KGG A;  2M6M A;  5D1L B;  3IVV A;  3N9L A;  1Z2Q A;  2MNY A;  2VPB A;  2EOD A;  4NN2 A;  2KYU A;  2AN6 A;  3L11 A;  4GNG A;  2VPE A;  2D8S A;  2E6S A;  1WEM A;  2C2V S;  4YAD A;  5J3X A;  2CKL A;  4XI1 A;  2H0D B;  2KRE A;  3L1Z B;  2LGV A;  2KGI A;  4QF3 A;  1IYM A;  2LGG A;  3V43 A;  1WEV A;  3HQM A;  2ECN A;  1MM2 A;  4FK5 A;  2LV9 A;  2JMD A;  2ECV A;  3KQI A;  1D00 A;  3MHH A;  1F3V B;  2L80 A;  2VNF A;  4YAT A;  2L43 A;  2PNX A;  2KWJ A;  3KNV A;  2KIZ A;  1WIM A;  2UZG A;  3RPG C;  1N87 A;  3HCT A;  4GHU A;  5B79 A;  1F62 A;  2LGK A;  1FLL A;  2ECJ A;  2F1X A;  4S3O C;  4WA6 A;  4LK9 A;  3U5O A;  3SHB A;  1WEW A;  4MSX A;  4MVT A;  4AVX A;  2BAY A;  1WEQ A;  1Z6U A;  2XXN A;  3MQS C;  5DKA A;  1CHC A;  2QJ0 A;  2VJE A;  1CZZ A;  5C13 A;  4UI9 B;  4YAX A;  5EYA F;  1WEU A;  5TBN A;  3O33 A;  4R7E A;  1BOR A;  4FO9 A;  2CR2 A;  3PHD A;  4R2Y A;  2FOP A;  4LKA A;  2DX8 A;  4AP4 A;  3IVQ A;  2KWO A;  4AYC A;  3M99 A;  4V3K C;  3MHS A;  3N9O A;  2FUI A;  2FOO A;  2KWK A;  2K4D A;  2E6R A;  4S3O B;  2EA6 A;  2YHN A;  3O36 A;  3M62 A;  3HU6 A;  4GWN A;  2ECW A;  1JM7 A;  3ZYQ A;  1D0J A;  3I2D A;  3ZTG A;  3ZJB A;  3DQV R;  2MUM A;  4BHW A;  1FP0 A;  5TAB A;  2VJF B;  2JRJ A;  4FJC A;  2MD7 B;  2FUU A;  4UP5 A;  4YBM A;  3HCS A;  5KH9 A;  5TDW A;  1G25 A;  3O37 A;  4JJQ A;  5G05 B;  2CSZ A;  1V87 A;  3HQH A;  2M1R A;  2Y1N A;  2YSJ A;  4GNF A;  4AUQ B;  4QF2 A;  1HYJ A;  2CSY A;  3L1X A;  1QSC A;  1RF3 A;  5KH7 A;  4TKP B;  2ECT A;  1VFY A;  3NG2 A;  4L7X A;  1JOC A;  3M63 A;  4O1V A;  4X3G A;  4A4B A;  2VPD A;  3SOW A;  4LLB A;  4I7D A;  1CA9 A;  3EB6 A;  1LB6 A;  1VD4 A;  1CA4 A;  4PPE A;  2CKL B;  4M4E A;  4A0C D;  3EB5 A;  3ZVY A;  4P5O B;  4R8P K;  2JMI A;  3RTR B;  2F6J A;  5AIU A;  2YSM A;  2KFT A;  2YQL A;  5H1V A;  2XB1 A;  3LQH A;  2LGL A;  1KZZ A;  2PUY A;  3ZVZ B;  3SOX A;  3KV6 A;  2ZET C;  4YC9 A;  2ECG A;  2K16 A;  1YY6 A;  4B7Y C;  2LXH C;  2YYR A;  2A25 A;  2KWN A;  4ZQL A;  1JM7 B;  5E1T A;  2NAA A;  3C6W A;  2YRE A;  4GWM A;  4FIP A;  4Q6F A;  5KH3 A;  2LQ6 A;  3LRQ A;  3T7L A;  3SOU A;  2VJF A;  5B75 A;  5LKT A;  4AYC B;  4C9Z A;  2M85 A;  4YSI A;  3DPL R;  5AIT A;  3O7A A;  1D0A A;  4A49 A;  3IVB A;  2G6Q A;  2M3H A;  1WIL A;  2LN0 A;  2F1Y A;  3PUR A;  3HQI A;  4ZDT A;  4IC3 A;  3IHP A;  1ZMS A;  2VJE B;  3LQJ A;  3FL2 A;  3U5P A;  1X4I A;  2MA5 A;  2G45 A;  5C11 A;  2LDR A;  5I3L A;  4GB0 A;  4GND A;  2G43 A;  1MM3 A;  2MA6 A;  1U6G B;  2KE1 A;  4N3W A;  4WZ3 B;  3RPG B;  4I7C A;  4CCG X;  2QIZ A;  2HDP A;  5LCW B;  3U5N A;  5B76 A;  2I50 A;  2VP7 A;  4UP0 A;  2MIQ A;  4YBT A;  2F6N A;  1Z60 A;  2F1Z A;  5D1M B;  5TDR A;  3HQL A;  5D1K B;  4YBS A;  1WES A;  1LDK C;  1WEP A;  5LKX A;  2MT5 A;  2Y1M A;  5B78 A;  4W4U A;  5B8D A;  2GKW A;  2MNZ A;  2OXQ C;  1FLK A;  2YU4 A;  5H1T A;  3ZPV 1;  2C2L A;  1E4U A;  3HTK C;  5TRB A;  3LQI A;  2YUC A;  3ASL A;  4I7B A;  1L0A A;  1FBV A;  5FER A;  1WEE A;  2YQM A; 
#chains in the Genus database with same CATH topology
 3C5K A;  4V3L C;  3T6R A;  2JUN A;  2L75 A;  5FB0 A;  3MQR A;  5SVY A;  3ZPV E;  4CA1 A;  5LKU A;  1CZY A;  1VYX A;  5K3Q A;  1X4J A;  3N9N A;  4WZ0 A;  1T1H A;  2EGP A;  4H9D A;  4F52 B;  2Y43 A;  3FEH A;  5FEY A;  2M13 A;  1WGM A;  5FB1 A;  2H0D A;  2QIC A;  1LDJ B;  4A4C A;  4GJH A;  2MD8 C;  4KG9 A;  1ZBD B;  3U5M A;  2VPG A;  1LB5 A;  4O64 A;  1XWH A;  5H9M A;  2LXP C;  2F1W A;  5JG6 A;  3T9K A;  2CT2 A;  1K2F A;  4LJN A;  5SVI A;  3HSV A;  1X4U A;  4Z8M A;  2KKY A;  3LVR E;  5SVX A;  3PUQ A;  2FOJ A;  1WE9 A;  2L5U A;  3N9Q A;  2K1J A;  3O34 A;  1D01 A;  2LRI C;  2HYE D;  4GNE A;  3GV4 A;  4BBQ A;  5B77 A;  3FAN A;  2KR4 A;  5LKZ A;  2RSD A;  2CON A;  3ZNI A;  3FM8 C;  2YUR A;  4K8U A;  5G0F A;  1WEN A;  2YW8 A;  3FJU B;  5DIN A;  2MKE A;  3O35 A;  4YAB A;  1DVP A;  1HYI A;  3O70 A;  4L58 A;  2FSA A;  3VK6 A;  2IDA A;  2XEU A;  2CSV A;  2JM3 A;  2JMJ A;  2YT5 A;  2K17 A;  1YZE A;  4WZ2 A;  2KKX A;  3O47 A;  1RMD A;  2CRR A;  4PTB A;  5H1U A;  5G04 B;  3KV5 A;  3N9M A;  2ECI A;  4B86 C;  3N9P A;  1MBM A;  2RI7 A;  3KDE C;  2YHO A;  2XOZ A;  3QZV A;  1WFK A;  4ZUX U;  1WEO A;  3LVQ E;  4IC2 A;  1LB4 A;  4N4F A;  3GL6 A;  2L0B A;  4LAD B;  2F42 A;  2KU3 A;  3HCU A;  2KGG A;  2M6M A;  5D1L B;  3IVV A;  3N9L A;  1Z2Q A;  2MNY A;  2VPB A;  2EOD A;  4NN2 A;  2KYU A;  2AN6 A;  3L11 A;  4GNG A;  2VPE A;  2D8S A;  2E6S A;  1WEM A;  2C2V S;  4YAD A;  5J3X A;  2CKL A;  4XI1 A;  2H0D B;  2KRE A;  3L1Z B;  2LGV A;  2KGI A;  4QF3 A;  1IYM A;  2LGG A;  3V43 A;  1WEV A;  3HQM A;  2ECN A;  3Q1D A;  1MM2 A;  4FK5 A;  2LV9 A;  2JMD A;  2ECV A;  3KQI A;  1D00 A;  3MHH A;  1F3V B;  2L80 A;  2VNF A;  4YAT A;  2L43 A;  2PNX A;  2KWJ A;  3KNV A;  2KIZ A;  1WIM A;  2UZG A;  3RPG C;  1N87 A;  3HCT A;  4GHU A;  5B79 A;  1F62 A;  2LGK A;  1FLL A;  2ECJ A;  2F1X A;  4S3O C;  4WA6 A;  4LK9 A;  3U5O A;  3SHB A;  1WEW A;  4MSX A;  4MVT A;  4AVX A;  2BAY A;  1WEQ A;  1Z6U A;  3DDT A;  2XXN A;  3MQS C;  5SVI B;  5DKA A;  1CHC A;  2QJ0 A;  2VJE A;  1CZZ A;  5C13 A;  3LDY A;  4UI9 B;  4YAX A;  5EYA F;  1WEU A;  5TBN A;  2FD4 A;  3O33 A;  4Z0O A;  4R7E A;  1BOR A;  4FO9 A;  2CR2 A;  3PHD A;  4R2Y A;  2FOP A;  4LKA A;  4F1P A;  2DX8 A;  4AP4 A;  3IVQ A;  2KWO A;  4AYC A;  3M99 A;  4V3K C;  3MHS A;  2L7P A;  3N9O A;  2LAU A;  2FUI A;  2FOO A;  2KWK A;  2K4D A;  2E6R A;  4S3O B;  3DWD A;  2EA6 A;  2YHN A;  2EXU A;  3O36 A;  3M62 A;  3HU6 A;  4GWN A;  2ECW A;  1JM7 A;  3ZYQ A;  1D0J A;  3I2D A;  3ZTG A;  3ZJB A;  3DQV R;  2MUM A;  4BHW A;  1FP0 A;  5TAB A;  2VJF B;  2JRJ A;  2DSM A;  4FJC A;  2MD7 B;  2FUU A;  4UP5 A;  4YBM A;  3HCS A;  5KH9 A;  5TDW A;  1G25 A;  3O37 A;  4JJQ A;  2CRW A;  5G05 B;  2CSZ A;  1V87 A;  3HQH A;  2D8U A;  2M1R A;  2Y1N A;  2YSJ A;  4GNF A;  4AUQ B;  4QF2 A;  1HYJ A;  2CSY A;  3L1X A;  1QSC A;  1RF3 A;  4OGC A;  5KH7 A;  4TKP B;  4OGE A;  2ECT A;  1VFY A;  3NG2 A;  4L7X A;  2OWA A;  1JOC A;  2XOC A;  3M63 A;  4O1V A;  4X3G A;  4A4B A;  2VPD A;  2E61 A;  3JUE A;  4LLB A;  4I7D A;  1CA9 A;  3EB6 A;  3SOW A;  1LB6 A;  1VD4 A;  1CA4 A;  4PPE A;  2CKL B;  4M4E A;  4A0C D;  3EB5 A;  3ZVY A;  4P5O B;  4R8P K;  2JMI A;  3RTR B;  2F6J A;  5AIU A;  2YSM A;  2KFT A;  2YQL A;  5H1V A;  2XB1 A;  2EGM A;  3LQH A;  3MDB C;  2LGL A;  1KZZ A;  2PUY A;  3ZVZ B;  3SOX A;  4O62 A;  3KV6 A;  2ZET C;  4YC9 A;  2XOY A;  2ECG A;  2K16 A;  1YY6 A;  3PLW A;  4B7Y C;  2LXH C;  2YYR A;  4QQ4 A;  2A25 A;  2KWN A;  4ZQL A;  1JM7 B;  5E1T A;  2NAA A;  3E2D A;  3FAO A;  3C6W A;  2YRE A;  3LJU X;  4GWM A;  4FIP A;  4Q6F A;  5KH3 A;  2P57 A;  2LQ6 A;  3LRQ A;  3T7L A;  3SOU A;  2VJF A;  5B75 A;  5LKT A;  4AYC B;  4C9Z A;  2M85 A;  4YSI A;  3DPL R;  5AIT A;  3O7A A;  1D0A A;  4A49 A;  3SUB A;  3IVB A;  2G6Q A;  2M3H A;  1WIL A;  2LN0 A;  2F1Y A;  3PUR A;  3HQI A;  4Z0R A;  3M7K A;  4ZDT A;  3H7H A;  4IC3 A;  3IHP A;  1ZMS A;  2VJE B;  3LQJ A;  3FL2 A;  3U5P A;  1X4I A;  2MA5 A;  1DCQ A;  2G45 A;  5C11 A;  2LDR A;  5I3L A;  4GB0 A;  4GND A;  2G43 A;  1MM3 A;  2MA6 A;  1U6G B;  2KE1 A;  4N3W A;  4WZ3 B;  3RPG B;  2YVR A;  4I7C A;  4CCG X;  2QIZ A;  2HDP A;  5LCW B;  2IQJ A;  3U5N A;  5B76 A;  2I50 A;  2VP7 A;  4UP0 A;  2MIQ A;  4YBT A;  2F6N A;  1Z60 A;  2F1Z A;  5D1M B;  5TDR A;  3HQL A;  5D1K B;  2RR4 A;  4YBS A;  2B0O E;  1WES A;  1LDK C;  1WEP A;  5LKX A;  2MT5 A;  2Y1M A;  5B78 A;  4W4U A;  2XP0 A;  5B8D A;  2FFW A;  2GKW A;  2MNZ A;  2OXQ C;  1FLK A;  2YU4 A;  5H1T A;  3ZPV 1;  2C2L A;  1E4U A;  3HTK C;  5TRB A;  2DJA A;  3LQI A;  2YUC A;  3ASL A;  4I7B A;  1L0A A;  1FBV A;  5FER A;  1WEE A;  2YQM A; 
#chains in the Genus database with same CATH homology
 3C5K A;  4V3L C;  3T6R A;  2L75 A;  5FB0 A;  3MQR A;  3ZPV E;  4CA1 A;  5LKU A;  1CZY A;  1VYX A;  1X4J A;  3N9N A;  4WZ0 A;  1T1H A;  2EGP A;  4F52 B;  2Y43 A;  5FEY A;  1WGM A;  5FB1 A;  2H0D A;  2QIC A;  1LDJ B;  4A4C A;  4GJH A;  2MD8 C;  4KG9 A;  1ZBD B;  3U5M A;  2VPG A;  1LB5 A;  4O64 A;  1XWH A;  5H9M A;  2LXP C;  2F1W A;  5JG6 A;  2CT2 A;  1K2F A;  4LJN A;  3HSV A;  1X4U A;  4Z8M A;  3PUQ A;  2FOJ A;  1WE9 A;  2L5U A;  3N9Q A;  2K1J A;  3O34 A;  1D01 A;  2LRI C;  2HYE D;  4GNE A;  3GV4 A;  4BBQ A;  5B77 A;  2KR4 A;  5LKZ A;  2RSD A;  3ZNI A;  2YUR A;  4K8U A;  5G0F A;  1WEN A;  2YW8 A;  5DIN A;  3O35 A;  4YAB A;  1DVP A;  1HYI A;  3O70 A;  4L58 A;  2FSA A;  3VK6 A;  2IDA A;  2XEU A;  2JMJ A;  2YT5 A;  2K17 A;  1YZE A;  4WZ2 A;  1RMD A;  4PTB A;  5H1U A;  5G04 B;  3KV5 A;  3N9M A;  2ECI A;  4B86 C;  3N9P A;  2RI7 A;  2YHO A;  3QZV A;  1WFK A;  4ZUX U;  1WEO A;  4IC2 A;  1LB4 A;  4N4F A;  3GL6 A;  2L0B A;  4LAD B;  2F42 A;  2KU3 A;  3HCU A;  2KGG A;  2M6M A;  5D1L B;  3IVV A;  3N9L A;  1Z2Q A;  2MNY A;  2VPB A;  2EOD A;  4NN2 A;  2KYU A;  2AN6 A;  3L11 A;  4GNG A;  2VPE A;  2D8S A;  2E6S A;  1WEM A;  2C2V S;  4YAD A;  5J3X A;  2CKL A;  4XI1 A;  2H0D B;  2KRE A;  3L1Z B;  2LGV A;  2KGI A;  4QF3 A;  1IYM A;  2LGG A;  3V43 A;  1WEV A;  3HQM A;  2ECN A;  1MM2 A;  4FK5 A;  2LV9 A;  2JMD A;  2ECV A;  3KQI A;  1D00 A;  3MHH A;  1F3V B;  2L80 A;  2VNF A;  4YAT A;  2L43 A;  2PNX A;  2KWJ A;  3KNV A;  2KIZ A;  1WIM A;  2UZG A;  3RPG C;  1N87 A;  3HCT A;  4GHU A;  5B79 A;  1F62 A;  2LGK A;  1FLL A;  2ECJ A;  2F1X A;  4S3O C;  4WA6 A;  4LK9 A;  3U5O A;  3SHB A;  1WEW A;  4MSX A;  4MVT A;  4AVX A;  2BAY A;  1WEQ A;  1Z6U A;  2XXN A;  3MQS C;  5DKA A;  1CHC A;  2QJ0 A;  2VJE A;  1CZZ A;  5C13 A;  4UI9 B;  4YAX A;  5EYA F;  1WEU A;  5TBN A;  3O33 A;  4R7E A;  1BOR A;  4FO9 A;  2CR2 A;  3PHD A;  4R2Y A;  2FOP A;  4LKA A;  2DX8 A;  4AP4 A;  3IVQ A;  2KWO A;  4AYC A;  3M99 A;  4V3K C;  3MHS A;  3N9O A;  2FUI A;  2FOO A;  2KWK A;  2K4D A;  2E6R A;  4S3O B;  2EA6 A;  2YHN A;  3O36 A;  3M62 A;  3HU6 A;  4GWN A;  2ECW A;  1JM7 A;  3ZYQ A;  1D0J A;  3I2D A;  3ZTG A;  3ZJB A;  3DQV R;  2MUM A;  4BHW A;  1FP0 A;  5TAB A;  2VJF B;  2JRJ A;  4FJC A;  2MD7 B;  2FUU A;  4UP5 A;  4YBM A;  3HCS A;  5KH9 A;  5TDW A;  1G25 A;  3O37 A;  4JJQ A;  5G05 B;  2CSZ A;  1V87 A;  3HQH A;  2M1R A;  2Y1N A;  2YSJ A;  4GNF A;  4AUQ B;  4QF2 A;  1HYJ A;  2CSY A;  3L1X A;  1QSC A;  1RF3 A;  5KH7 A;  4TKP B;  2ECT A;  1VFY A;  3NG2 A;  4L7X A;  1JOC A;  3M63 A;  4O1V A;  4X3G A;  4A4B A;  2VPD A;  3SOW A;  4LLB A;  4I7D A;  1CA9 A;  3EB6 A;  1LB6 A;  1VD4 A;  1CA4 A;  4PPE A;  2CKL B;  4M4E A;  4A0C D;  3EB5 A;  3ZVY A;  4P5O B;  4R8P K;  2JMI A;  3RTR B;  2F6J A;  5AIU A;  2YSM A;  2KFT A;  2YQL A;  5H1V A;  2XB1 A;  3LQH A;  2LGL A;  1KZZ A;  2PUY A;  3ZVZ B;  3SOX A;  3KV6 A;  2ZET C;  4YC9 A;  2ECG A;  2K16 A;  1YY6 A;  4B7Y C;  2LXH C;  2YYR A;  2A25 A;  2KWN A;  4ZQL A;  1JM7 B;  5E1T A;  2NAA A;  3C6W A;  2YRE A;  4GWM A;  4FIP A;  4Q6F A;  5KH3 A;  2LQ6 A;  3LRQ A;  3T7L A;  3SOU A;  2VJF A;  5B75 A;  5LKT A;  4AYC B;  4C9Z A;  2M85 A;  4YSI A;  3DPL R;  5AIT A;  3O7A A;  1D0A A;  4A49 A;  3IVB A;  2G6Q A;  2M3H A;  1WIL A;  2LN0 A;  2F1Y A;  3PUR A;  3HQI A;  4ZDT A;  4IC3 A;  3IHP A;  1ZMS A;  2VJE B;  3LQJ A;  3FL2 A;  3U5P A;  1X4I A;  2MA5 A;  2G45 A;  5C11 A;  2LDR A;  5I3L A;  4GB0 A;  4GND A;  2G43 A;  1MM3 A;  2MA6 A;  1U6G B;  2KE1 A;  4N3W A;  4WZ3 B;  3RPG B;  4I7C A;  4CCG X;  2QIZ A;  2HDP A;  5LCW B;  3U5N A;  5B76 A;  2I50 A;  2VP7 A;  4UP0 A;  2MIQ A;  4YBT A;  2F6N A;  1Z60 A;  2F1Z A;  5D1M B;  5TDR A;  3HQL A;  5D1K B;  4YBS A;  1WES A;  1LDK C;  1WEP A;  5LKX A;  2MT5 A;  2Y1M A;  5B78 A;  4W4U A;  5B8D A;  2GKW A;  2MNZ A;  2OXQ C;  1FLK A;  2YU4 A;  5H1T A;  3ZPV 1;  2C2L A;  1E4U A;  3HTK C;  5TRB A;  3LQI A;  2YUC A;  3ASL A;  4I7B A;  1L0A A;  1FBV A;  5FER A;  1WEE A;  2YQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...