4CA1A

Crystal structure of siah1 at 1.58 a resolution.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
192
structure length
189
Chain Sequence
b'ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE SIAH1
publication title Two High-Resolution Structures of the Human E3 Ubiquitin Ligase Siah1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 42
structure length 189
sequence length 192
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 4ca1A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ca1A01
1DVPA 2QICA 4YABA 1HYIA 4R2YA 5TRBA 3ZVZB 1RMDA 3SOUA 5AITA 2E6RA 3N9MA 2Y43A 4JJQA 2MA6A 3N9QA 1D00A 2F1WA 4XI1A 3N9PA 2LQ6A 4O1VA 5TBNA 3N9NA 5H1VA 4MVTA 3MHHA 2Y1MA 1WIMA 4FK5A 3M62A 2FUIA 2D8SA 1D01A 2JMDA 1CA9A 2FSAA 3ZYQA 4V3LC 2BAYA 5C11A 1XWHA 4Z8MA 2F6NA 4M4EA 2F1ZA 4ZQLA 4GJHA 4A4CA 3MQRA 2KFTA 5B75A 4CCGX 3U5OA 2M1RA 4LKAA 4N3WA 2YU4A 4A4BA 2ECTA 3LRQA 4QF3A 1WFKA 4N4FA 2LDRA 2YURA 3L11A 5G04B 2L80A 2C2VS 3EB5A 1LDJB 5H1UA 1CA4A 4YBTA 5DKAA 4YSIA 4GHUA 2MA5A 4ZUXU 2CSYA 3SHBA 3ZTGA 2F42A 2DX8A 3M99A 1RF3A 2VPDA 3VK6A 2L5UA 3MHSA 5TABA 4V3KC 1K2FA 3KV5A 4AYCA 2RI7A 4YATA 1F62A 1JOCA 2VJFA 2KGGA 1JM7A 3O7AA 1X4IA 4WZ2A 1FLKA 3DQVR 2ECIA 4F52B 2QIZA 1FBVA 3ASLA 1L0AA 2XEUA 3SOXA 3L1ZB 3HQIA 3U5NA 4C9ZA 3FL2A 5KH3A 2NAAA 4LADB 4GNDA 4LK9A 3O33A 5J3XA 5D1LB 4AVXA 4NN2A 4B86C 4AUQB 2OXQC 4I7CA 5EYAF 2MNZA 1U6GB 1E4UA 1WEWA 1WGMA 2KWNA 5FERA 3M63A 3GV4A 2YT5A 2CR2A 4B7YC 2XB1A 2ECWA 2JMIA 2YYRA 2MD7B 3L1XA 5D1KB 1VFYA 5H9MA 4GNEA 3PUQA 1LB4A 3EB6A 3NG2A 2ECNA 1Z60A 4YADA 2KIZA 1WEMA 2KWJA 2E6SA 2F6JA 2L75A 5I3LA 4FIPA 5G05B 2L43A 3N9LA 5C13A 2G43A 1ZBDB 2K17A 4PTBA 2UZGA 4YC9A 2K1JA 1WE9A 5LKZA 1WENA 2YW8A 2Y1NA 3O34A 5KH9A 4L58A 2F1YA 4P5OB 2MT5A 4A0CD 2LXPC 2H0DB 4L7XA 3ZJBA 5TDRA 2A25A 2FOPA 2KR4A 2ZETC 2MNYA 1CZZA 3HCUA 1QSCA 3LQHA 2KREA 2EGPA 4PPEA 3ZNIA 4S3OB 5FEYA 2RSDA 2CKLB 3MQSC 5DINA 2XXNA 2VPEA 4FO9A 1FP0A 1WEPA 5LKTA 2F1XA 3DPLR 5B8DA 2JRJA 2LGVA 1VYXA 5D1MB 2KWOA 2VP7A 1F3VB 4I7BA 2I50A 2KWKA 2VPGA 2VJEB 2LGLA 1X4JA 4KG9A 1MM3A 1V87A 3KQIA 1FLLA 3PURA 5JG6A 5AIUA 2K16A 2LXHC 4YBSA 3HCSA 2YSMA 3KV6A 2EODA 4O64A 4S3OC 2AN6A 4WZ0A 4LJNA 3T7LA 2HYED 1Z6UA 3V43A 2L0BA 3C5KA 1X4UA 3HCTA 3N9OA 5E1TA 1CZYA 3KNVA 5B77A 3QZVA 1VD4A 4R7EA 2M6MA 3ZPV1 2LV9A 3IHPA 2C2LA 2LN0A 4ZDTA 4YBMA 4QF2A 1IYMA 4GWNA 2M3HA 4BHWA 3HSVA 3O36A 2IDAA 5FB0A 3RTRB 1N87A 2MIQA 2KGIA 4MSXA 3ZPVE 5H1TA 1HYJA 5LKUA 1WEOA 5TDWA 4GB0A 3RPGB 5B78A 4GWMA 1WILA 3O35A 2YHOA 5KH7A 2CSZA 1D0AA 3HTKC 3U5PA 4W4UA 2GKWA 4BBQA 3LQJA 2FOOA 2CT2A 1G25A 2QJ0A 2VNFA 4YAXA 5B79A 2YQMA 2VPBA 3O37A 3HQMA 3HU6A 2YREA 5LKXA 4K8UA 4UP0A 4IC3A 2H0DA 2YQLA 3O70A 2PUYA 3IVVA 3T6RA 1YY6A 3IVBA 1WESA 2ECJA 4CA1A 3RPGC 3SOWA 2K4DA 4IC2A 1LDKC 2LRIC 4A49A 4AP4A 2KE1A 1D0JA 3HQLA 3ZVYA 1WEQA 2PNXA 2YUCA 3IVQA 2YSJA 2CKLA 2LGKA 2LGGA 2KU3A 3GL6A 3I2DA 4R8PK 2M85A 1YZEA 4AYCB 5FB1A 3HQHA 2VJFB 1JM7B 3C6WA 2KYUA 5B76A 1LB5A 4GNFA 4X3GA 2VJEA 4UP5A 1T1HA 4LLBA 2YHNA 3U5MA 2G6QA 2HDPA 5G0FA 1CHCA 2EA6A 4WZ3B 4Q6FA 2MD8C 1WEVA 1MM2A 2ECGA 1Z2QA 1LB6A 1WEEA 1KZZA 4UI9B 2FUUA 3LQIA 2G45A 2MUMA 4WA6A 1WEUA 2FOJA 4FJCA 2JMJA 2ECVA 1ZMSA 4I7DA 1BORA 5LCWB 4GNGA 3PHDA 4TKPB
chains in the Genus database with same CATH superfamily
1DVPA 2QICA 3Q1DA 4YABA 1HYIA 4R2YA 5TRBA 3DDTA 3T9KA 2CONA 3ZVZB 1RMDA 2XOYA 3SOUA 5AITA 3M7KA 2E6RA 3N9MA 3DWDA 2Y43A 4JJQA 2MA6A 3N9QA 1D00A 2FD4A 2F1WA 4XI1A 3N9PA 2LQ6A 4O1VA 5TBNA 3LDYA 3N9NA 5H1VA 4MVTA 3MHHA 2Y1MA 1WIMA 4FK5A 3M62A 2FUIA 2D8SA 1D01A 2JMDA 1CA9A 2FSAA 3ZYQA 4V3LC 2BAYA 5C11A 1XWHA 3LJUX 4OGCA 3FEHA 4Z8MA 2F6NA 4M4EA 2F1ZA 4ZQLA 4GJHA 4A4CA 3MQRA 2KFTA 5B75A 4CCGX 3U5OA 2M1RA 4LKAA 2CRWA 4N3WA 2YU4A 2E61A 4A4BA 2ECTA 3LRQA 4QF3A 1WFKA 4N4FA 2LDRA 2YURA 3L11A 3FAOA 5G04B 2L80A 2C2VS 3EB5A 4O62A 1LDJB 5H1UA 2CSVA 1CA4A 4YBTA 2RR4A 5DKAA 4YSIA 4GHUA 2MA5A 4ZUXU 2CSYA 3SHBA 3ZTGA 2F42A 2DX8A 3M99A 3FANA 1RF3A 2VPDA 3VK6A 2L5UA 3MHSA 5TABA 4V3KC 1K2FA 3KV5A 4AYCA 2RI7A 4YATA 1F62A 1JOCA 5SVIB 2VJFA 2KGGA 1JM7A 3O7AA 1X4IA 4Z0OA 4WZ2A 2YVRA 1FLKA 3DQVR 2ECIA 4F52B 2QIZA 1FBVA 3ASLA 1L0AA 2XEUA 3SOXA 3L1ZB 2D8UA 3HQIA 3U5NA 4C9ZA 2P57A 3FL2A 5KH3A 2NAAA 4LADB 4GNDA 3PLWA 4LK9A 3O33A 5J3XA 5D1LB 4AVXA 4H9DA 4NN2A 4B86C 4OGEA 4AUQB 2OXQC 4I7CA 5EYAF 2M13A 2XOCA 2MNZA 1U6GB 1E4UA 1WEWA 1WGMA 2KWNA 5FERA 3M63A 3GV4A 2YT5A 2CR2A 2DJAA 2LAUA 4B7YC 2XB1A 2ECWA 2JMIA 2YYRA 2MD7B 3L1XA 5D1KB 1VFYA 5H9MA 4GNEA 3PUQA 1LB4A 3EB6A 3NG2A 2ECNA 1Z60A 4YADA 5K3QA 2KIZA 1WEMA 2KWJA 2E6SA 2F6JA 2L75A 2XP0A 5I3LA 4FIPA 5G05B 2L43A 3N9LA 5C13A 2G43A 2MKEA 1ZBDB 2K17A 4PTBA 2UZGA 4YC9A 2DSMA 2K1JA 1WE9A 3FJUB 3FM8C 5LKZA 1WENA 5SVXA 2YW8A 2Y1NA 3O34A 5KH9A 4L58A 2F1YA 2IQJA 2L7PA 2XOZA 4P5OB 2MT5A 4A0CD 2LXPC 2H0DB 4L7XA 3ZJBA 5TDRA 2A25A 2FOPA 2KR4A 2OWAA 2ZETC 2MNYA 1CZZA 3HCUA 1QSCA 3LQHA 5SVYA 2KREA 2EGPA 4PPEA 3ZNIA 5SVIA 4S3OB 5FEYA 2RSDA 2CKLB 3MQSC 5DINA 3KDEC 2XXNA 2VPEA 4FO9A 1FP0A 1WEPA 5LKTA 2F1XA 3DPLR 5B8DA 2EGMA 2JRJA 2LGVA 1VYXA 5D1MB 2KWOA 2VP7A 1F3VB 4I7BA 2I50A 2KWKA 2VPGA 2VJEB 2LGLA 1X4JA 4KG9A 1MM3A 1V87A 3SUBA 3KQIA 1FLLA 3PURA 5JG6A 5AIUA 2K16A 2LXHC 4YBSA 3HCSA 2YSMA 3KV6A 2EODA 4O64A 4S3OC 1MBMA 2AN6A 3H7HA 2KKYA 4WZ0A 4LJNA 3T7LA 2HYED 1Z6UA 3V43A 2L0BA 3C5KA 1X4UA 3HCTA 3N9OA 5E1TA 1CZYA 3KNVA 5B77A 3QZVA 1VD4A 4R7EA 2M6MA 3ZPV1 2LV9A 3IHPA 2C2LA 3LVQE 2LN0A 4ZDTA 4YBMA 4QF2A 1IYMA 4GWNA 2M3HA 2CRRA 4BHWA 3HSVA 3O36A 2IDAA 2KKXA 3LVRE 5FB0A 3RTRB 1N87A 2MIQA 2KGIA 4MSXA 3ZPVE 5H1TA 1HYJA 5LKUA 1WEOA 5TDWA 4F1PA 3E2DA 4GB0A 1DCQA 3RPGB 5B78A 4GWMA 1WILA 3O35A 2YHOA 5KH7A 4QQ4A 2CSZA 1D0AA 3HTKC 3U5PA 4W4UA 2GKWA 4BBQA 3LQJA 2FOOA 2CT2A 1G25A 2JUNA 2QJ0A 2VNFA 4YAXA 5B79A 2YQMA 2VPBA 3O37A 3HQMA 3HU6A 2YREA 5LKXA 4K8UA 4UP0A 4IC3A 2H0DA 2YQLA 3O70A 2PUYA 3IVVA 3T6RA 1YY6A 3IVBA 1WESA 2ECJA 4CA1A 3RPGC 3SOWA 2K4DA 4IC2A 1LDKC 2LRIC 4A49A 4AP4A 2KE1A 1D0JA 3HQLA 3ZVYA 1WEQA 2PNXA 2YUCA 3IVQA 2YSJA 2CKLA 2LGKA 2LGGA 2KU3A 3GL6A 3I2DA 4R8PK 2M85A 1YZEA 4AYCB 5FB1A 2EXUA 3HQHA 2VJFB 1JM7B 3C6WA 2KYUA 5B76A 1LB5A 4GNFA 4X3GA 2JM3A 2VJEA 4UP5A 1T1HA 4LLBA 2YHNA 3O47A 3U5MA 4Z0RA 2G6QA 2HDPA 5G0FA 1CHCA 2EA6A 3MDBC 4Q6FA 4WZ3B 2FFWA 2MD8C 1WEVA 1MM2A 2ECGA 1Z2QA 3JUEA 1LB6A 1WEEA 1KZZA 4UI9B 2FUUA 3LQIA 2G45A 2MUMA 4WA6A 1WEUA 2FOJA 4FJCA 2B0OE 2JMJA 2ECVA 1ZMSA 4I7DA 1BORA 5LCWB 4GNGA 3PHDA 4TKPB
chains in the Genus database with same CATH topology
1DVPA 2QICA 4YABA 1HYIA 4R2YA 5TRBA 3ZVZB 1RMDA 3SOUA 5AITA 2E6RA 3N9MA 2Y43A 4JJQA 2MA6A 3N9QA 1D00A 2F1WA 4XI1A 3N9PA 2LQ6A 4O1VA 5TBNA 3N9NA 5H1VA 4MVTA 3MHHA 2Y1MA 1WIMA 4FK5A 3M62A 2FUIA 2D8SA 1D01A 2JMDA 1CA9A 2FSAA 3ZYQA 4V3LC 2BAYA 5C11A 1XWHA 4Z8MA 2F6NA 4M4EA 2F1ZA 4ZQLA 4GJHA 4A4CA 3MQRA 2KFTA 5B75A 4CCGX 3U5OA 2M1RA 4LKAA 4N3WA 2YU4A 4A4BA 2ECTA 3LRQA 4QF3A 1WFKA 4N4FA 2LDRA 2YURA 3L11A 5G04B 2L80A 2C2VS 3EB5A 1LDJB 5H1UA 1CA4A 4YBTA 5DKAA 4YSIA 4GHUA 2MA5A 4ZUXU 2CSYA 3SHBA 3ZTGA 2F42A 2DX8A 3M99A 1RF3A 2VPDA 3VK6A 2L5UA 3MHSA 5TABA 4V3KC 1K2FA 3KV5A 4AYCA 2RI7A 4YATA 1F62A 1JOCA 2VJFA 2KGGA 1JM7A 3O7AA 1X4IA 4WZ2A 1FLKA 3DQVR 2ECIA 4F52B 2QIZA 1FBVA 3ASLA 1L0AA 2XEUA 3SOXA 3L1ZB 3HQIA 3U5NA 4C9ZA 3FL2A 5KH3A 2NAAA 4LADB 4GNDA 4LK9A 3O33A 5J3XA 5D1LB 4AVXA 4NN2A 4B86C 4AUQB 2OXQC 4I7CA 5EYAF 2MNZA 1U6GB 1E4UA 1WEWA 1WGMA 2KWNA 5FERA 3M63A 3GV4A 2YT5A 2CR2A 4B7YC 2XB1A 2ECWA 2JMIA 2YYRA 2MD7B 3L1XA 5D1KB 1VFYA 5H9MA 4GNEA 3PUQA 1LB4A 3EB6A 3NG2A 2ECNA 1Z60A 4YADA 2KIZA 1WEMA 2KWJA 2E6SA 2F6JA 2L75A 5I3LA 4FIPA 5G05B 2L43A 3N9LA 5C13A 2G43A 1ZBDB 2K17A 4PTBA 2UZGA 4YC9A 2K1JA 1WE9A 5LKZA 1WENA 2YW8A 2Y1NA 3O34A 5KH9A 4L58A 2F1YA 4P5OB 2MT5A 4A0CD 2LXPC 2H0DB 4L7XA 3ZJBA 5TDRA 2A25A 2FOPA 2KR4A 2ZETC 2MNYA 1CZZA 3HCUA 1QSCA 3LQHA 2KREA 2EGPA 4PPEA 3ZNIA 4S3OB 5FEYA 2RSDA 2CKLB 3MQSC 5DINA 2XXNA 2VPEA 4FO9A 1FP0A 1WEPA 5LKTA 2F1XA 3DPLR 5B8DA 2JRJA 2LGVA 1VYXA 5D1MB 2KWOA 2VP7A 1F3VB 4I7BA 2I50A 2KWKA 2VPGA 2VJEB 2LGLA 1X4JA 4KG9A 1MM3A 1V87A 3KQIA 1FLLA 3PURA 5JG6A 5AIUA 2K16A 2LXHC 4YBSA 3HCSA 2YSMA 3KV6A 2EODA 4O64A 4S3OC 2AN6A 4WZ0A 4LJNA 3T7LA 2HYED 1Z6UA 3V43A 2L0BA 3C5KA 1X4UA 3HCTA 3N9OA 5E1TA 1CZYA 3KNVA 5B77A 3QZVA 1VD4A 4R7EA 2M6MA 3ZPV1 2LV9A 3IHPA 2C2LA 2LN0A 4ZDTA 4YBMA 4QF2A 1IYMA 4GWNA 2M3HA 4BHWA 3HSVA 3O36A 2IDAA 5FB0A 3RTRB 1N87A 2MIQA 2KGIA 4MSXA 3ZPVE 5H1TA 1HYJA 5LKUA 1WEOA 5TDWA 4GB0A 3RPGB 5B78A 4GWMA 1WILA 3O35A 2YHOA 5KH7A 2CSZA 1D0AA 3HTKC 3U5PA 4W4UA 2GKWA 4BBQA 3LQJA 2FOOA 2CT2A 1G25A 2QJ0A 2VNFA 4YAXA 5B79A 2YQMA 2VPBA 3O37A 3HQMA 3HU6A 2YREA 5LKXA 4K8UA 4UP0A 4IC3A 2H0DA 2YQLA 3O70A 2PUYA 3IVVA 3T6RA 1YY6A 3IVBA 1WESA 2ECJA 4CA1A 3RPGC 3SOWA 2K4DA 4IC2A 1LDKC 2LRIC 4A49A 4AP4A 2KE1A 1D0JA 3HQLA 3ZVYA 1WEQA 2PNXA 2YUCA 3IVQA 2YSJA 2CKLA 2LGKA 2LGGA 2KU3A 3GL6A 3I2DA 4R8PK 2M85A 1YZEA 4AYCB 5FB1A 3HQHA 2VJFB 1JM7B 3C6WA 2KYUA 5B76A 1LB5A 4GNFA 4X3GA 2VJEA 4UP5A 1T1HA 4LLBA 2YHNA 3U5MA 2G6QA 2HDPA 5G0FA 1CHCA 2EA6A 4WZ3B 4Q6FA 2MD8C 1WEVA 1MM2A 2ECGA 1Z2QA 1LB6A 1WEEA 1KZZA 4UI9B 2FUUA 3LQIA 2G45A 2MUMA 4WA6A 1WEUA 2FOJA 4FJCA 2JMJA 2ECVA 1ZMSA 4I7DA 1BORA 5LCWB 4GNGA 3PHDA 4TKPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVP A;  2QIC A;  4YAB A;  1HYI A;  4R2Y A;  5TRB A;  3ZVZ B;  1RMD A;  3SOU A;  5AIT A;  2E6R A;  3N9M A;  2Y43 A;  4JJQ A;  2MA6 A;  3N9Q A;  1D00 A;  2F1W A;  4XI1 A;  3N9P A;  2LQ6 A;  4O1V A;  5TBN A;  3N9N A;  5H1V A;  4MVT A;  3MHH A;  2Y1M A;  1WIM A;  4FK5 A;  3M62 A;  2FUI A;  2D8S A;  1D01 A;  2JMD A;  1CA9 A;  2FSA A;  3ZYQ A;  4V3L C;  2BAY A;  5C11 A;  1XWH A;  4Z8M A;  2F6N A;  4M4E A;  2F1Z A;  4ZQL A;  4GJH A;  4A4C A;  3MQR A;  2KFT A;  5B75 A;  4CCG X;  3U5O A;  2M1R A;  4LKA A;  4N3W A;  2YU4 A;  4A4B A;  2ECT A;  3LRQ A;  4QF3 A;  1WFK A;  4N4F A;  2LDR A;  2YUR A;  3L11 A;  5G04 B;  2L80 A;  2C2V S;  3EB5 A;  1LDJ B;  5H1U A;  1CA4 A;  4YBT A;  5DKA A;  4YSI A;  4GHU A;  2MA5 A;  4ZUX U;  2CSY A;  3SHB A;  3ZTG A;  2F42 A;  2DX8 A;  3M99 A;  1RF3 A;  2VPD A;  3VK6 A;  2L5U A;  3MHS A;  5TAB A;  4V3K C;  1K2F A;  3KV5 A;  4AYC A;  2RI7 A;  4YAT A;  1F62 A;  1JOC A;  2VJF A;  2KGG A;  1JM7 A;  3O7A A;  1X4I A;  4WZ2 A;  1FLK A;  3DQV R;  2ECI A;  4F52 B;  2QIZ A;  1FBV A;  3ASL A;  1L0A A;  2XEU A;  3SOX A;  3L1Z B;  3HQI A;  3U5N A;  4C9Z A;  3FL2 A;  5KH3 A;  2NAA A;  4LAD B;  4GND A;  4LK9 A;  3O33 A;  5J3X A;  5D1L B;  4AVX A;  4NN2 A;  4B86 C;  4AUQ B;  2OXQ C;  4I7C A;  5EYA F;  2MNZ A;  1U6G B;  1E4U A;  1WEW A;  1WGM A;  2KWN A;  5FER A;  3M63 A;  3GV4 A;  2YT5 A;  2CR2 A;  4B7Y C;  2XB1 A;  2ECW A;  2JMI A;  2YYR A;  2MD7 B;  3L1X A;  5D1K B;  1VFY A;  5H9M A;  4GNE A;  3PUQ A;  1LB4 A;  3EB6 A;  3NG2 A;  2ECN A;  1Z60 A;  4YAD A;  2KIZ A;  1WEM A;  2KWJ A;  2E6S A;  2F6J A;  2L75 A;  5I3L A;  4FIP A;  5G05 B;  2L43 A;  3N9L A;  5C13 A;  2G43 A;  1ZBD B;  2K17 A;  4PTB A;  2UZG A;  4YC9 A;  2K1J A;  1WE9 A;  5LKZ A;  1WEN A;  2YW8 A;  2Y1N A;  3O34 A;  5KH9 A;  4L58 A;  2F1Y A;  4P5O B;  2MT5 A;  4A0C D;  2LXP C;  2H0D B;  4L7X A;  3ZJB A;  5TDR A;  2A25 A;  2FOP A;  2KR4 A;  2ZET C;  2MNY A;  1CZZ A;  3HCU A;  1QSC A;  3LQH A;  2KRE A;  2EGP A;  4PPE A;  3ZNI A;  4S3O B;  5FEY A;  2RSD A;  2CKL B;  3MQS C;  5DIN A;  2XXN A;  2VPE A;  4FO9 A;  1FP0 A;  1WEP A;  5LKT A;  2F1X A;  3DPL R;  5B8D A;  2JRJ A;  2LGV A;  1VYX A;  5D1M B;  2KWO A;  2VP7 A;  1F3V B;  4I7B A;  2I50 A;  2KWK A;  2VPG A;  2VJE B;  2LGL A;  1X4J A;  4KG9 A;  1MM3 A;  1V87 A;  3KQI A;  1FLL A;  3PUR A;  5JG6 A;  5AIU A;  2K16 A;  2LXH C;  4YBS A;  3HCS A;  2YSM A;  3KV6 A;  2EOD A;  4O64 A;  4S3O C;  2AN6 A;  4WZ0 A;  4LJN A;  3T7L A;  2HYE D;  1Z6U A;  3V43 A;  2L0B A;  3C5K A;  1X4U A;  3HCT A;  3N9O A;  5E1T A;  1CZY A;  3KNV A;  5B77 A;  3QZV A;  1VD4 A;  4R7E A;  2M6M A;  3ZPV 1;  2LV9 A;  3IHP A;  2C2L A;  2LN0 A;  4ZDT A;  4YBM A;  4QF2 A;  1IYM A;  4GWN A;  2M3H A;  4BHW A;  3HSV A;  3O36 A;  2IDA A;  5FB0 A;  3RTR B;  1N87 A;  2MIQ A;  2KGI A;  4MSX A;  3ZPV E;  5H1T A;  1HYJ A;  5LKU A;  1WEO A;  5TDW A;  4GB0 A;  3RPG B;  5B78 A;  4GWM A;  1WIL A;  3O35 A;  2YHO A;  5KH7 A;  2CSZ A;  1D0A A;  3HTK C;  3U5P A;  4W4U A;  2GKW A;  4BBQ A;  3LQJ A;  2FOO A;  2CT2 A;  1G25 A;  2QJ0 A;  2VNF A;  4YAX A;  5B79 A;  2YQM A;  2VPB A;  3O37 A;  3HQM A;  3HU6 A;  2YRE A;  5LKX A;  4K8U A;  4UP0 A;  4IC3 A;  2H0D A;  2YQL A;  3O70 A;  2PUY A;  3IVV A;  3T6R A;  1YY6 A;  3IVB A;  1WES A;  2ECJ A;  4CA1 A;  3RPG C;  3SOW A;  2K4D A;  4IC2 A;  1LDK C;  2LRI C;  4A49 A;  4AP4 A;  2KE1 A;  1D0J A;  3HQL A;  3ZVY A;  1WEQ A;  2PNX A;  2YUC A;  3IVQ A;  2YSJ A;  2CKL A;  2LGK A;  2LGG A;  2KU3 A;  3GL6 A;  3I2D A;  4R8P K;  2M85 A;  1YZE A;  4AYC B;  5FB1 A;  3HQH A;  2VJF B;  1JM7 B;  3C6W A;  2KYU A;  5B76 A;  1LB5 A;  4GNF A;  4X3G A;  2VJE A;  4UP5 A;  1T1H A;  4LLB A;  2YHN A;  3U5M A;  2G6Q A;  2HDP A;  5G0F A;  1CHC A;  2EA6 A;  4WZ3 B;  4Q6F A;  2MD8 C;  1WEV A;  1MM2 A;  2ECG A;  1Z2Q A;  1LB6 A;  1WEE A;  1KZZ A;  4UI9 B;  2FUU A;  3LQI A;  2G45 A;  2MUM A;  4WA6 A;  1WEU A;  2FOJ A;  4FJC A;  2JMJ A;  2ECV A;  1ZMS A;  4I7D A;  1BOR A;  5LCW B;  4GNG A;  3PHD A;  4TKP B; 
#chains in the Genus database with same CATH topology
 1DVP A;  2QIC A;  3Q1D A;  4YAB A;  1HYI A;  4R2Y A;  5TRB A;  3DDT A;  3T9K A;  2CON A;  3ZVZ B;  1RMD A;  2XOY A;  3SOU A;  5AIT A;  3M7K A;  2E6R A;  3N9M A;  3DWD A;  2Y43 A;  4JJQ A;  2MA6 A;  3N9Q A;  1D00 A;  2FD4 A;  2F1W A;  4XI1 A;  3N9P A;  2LQ6 A;  4O1V A;  5TBN A;  3LDY A;  3N9N A;  5H1V A;  4MVT A;  3MHH A;  2Y1M A;  1WIM A;  4FK5 A;  3M62 A;  2FUI A;  2D8S A;  1D01 A;  2JMD A;  1CA9 A;  2FSA A;  3ZYQ A;  4V3L C;  2BAY A;  5C11 A;  1XWH A;  3LJU X;  4OGC A;  3FEH A;  4Z8M A;  2F6N A;  4M4E A;  2F1Z A;  4ZQL A;  4GJH A;  4A4C A;  3MQR A;  2KFT A;  5B75 A;  4CCG X;  3U5O A;  2M1R A;  4LKA A;  2CRW A;  4N3W A;  2YU4 A;  2E61 A;  4A4B A;  2ECT A;  3LRQ A;  4QF3 A;  1WFK A;  4N4F A;  2LDR A;  2YUR A;  3L11 A;  3FAO A;  5G04 B;  2L80 A;  2C2V S;  3EB5 A;  4O62 A;  1LDJ B;  5H1U A;  2CSV A;  1CA4 A;  4YBT A;  2RR4 A;  5DKA A;  4YSI A;  4GHU A;  2MA5 A;  4ZUX U;  2CSY A;  3SHB A;  3ZTG A;  2F42 A;  2DX8 A;  3M99 A;  3FAN A;  1RF3 A;  2VPD A;  3VK6 A;  2L5U A;  3MHS A;  5TAB A;  4V3K C;  1K2F A;  3KV5 A;  4AYC A;  2RI7 A;  4YAT A;  1F62 A;  1JOC A;  5SVI B;  2VJF A;  2KGG A;  1JM7 A;  3O7A A;  1X4I A;  4Z0O A;  4WZ2 A;  2YVR A;  1FLK A;  3DQV R;  2ECI A;  4F52 B;  2QIZ A;  1FBV A;  3ASL A;  1L0A A;  2XEU A;  3SOX A;  3L1Z B;  2D8U A;  3HQI A;  3U5N A;  4C9Z A;  2P57 A;  3FL2 A;  5KH3 A;  2NAA A;  4LAD B;  4GND A;  3PLW A;  4LK9 A;  3O33 A;  5J3X A;  5D1L B;  4AVX A;  4H9D A;  4NN2 A;  4B86 C;  4OGE A;  4AUQ B;  2OXQ C;  4I7C A;  5EYA F;  2M13 A;  2XOC A;  2MNZ A;  1U6G B;  1E4U A;  1WEW A;  1WGM A;  2KWN A;  5FER A;  3M63 A;  3GV4 A;  2YT5 A;  2CR2 A;  2DJA A;  2LAU A;  4B7Y C;  2XB1 A;  2ECW A;  2JMI A;  2YYR A;  2MD7 B;  3L1X A;  5D1K B;  1VFY A;  5H9M A;  4GNE A;  3PUQ A;  1LB4 A;  3EB6 A;  3NG2 A;  2ECN A;  1Z60 A;  4YAD A;  5K3Q A;  2KIZ A;  1WEM A;  2KWJ A;  2E6S A;  2F6J A;  2L75 A;  2XP0 A;  5I3L A;  4FIP A;  5G05 B;  2L43 A;  3N9L A;  5C13 A;  2G43 A;  2MKE A;  1ZBD B;  2K17 A;  4PTB A;  2UZG A;  4YC9 A;  2DSM A;  2K1J A;  1WE9 A;  3FJU B;  3FM8 C;  5LKZ A;  1WEN A;  5SVX A;  2YW8 A;  2Y1N A;  3O34 A;  5KH9 A;  4L58 A;  2F1Y A;  2IQJ A;  2L7P A;  2XOZ A;  4P5O B;  2MT5 A;  4A0C D;  2LXP C;  2H0D B;  4L7X A;  3ZJB A;  5TDR A;  2A25 A;  2FOP A;  2KR4 A;  2OWA A;  2ZET C;  2MNY A;  1CZZ A;  3HCU A;  1QSC A;  3LQH A;  5SVY A;  2KRE A;  2EGP A;  4PPE A;  3ZNI A;  5SVI A;  4S3O B;  5FEY A;  2RSD A;  2CKL B;  3MQS C;  5DIN A;  3KDE C;  2XXN A;  2VPE A;  4FO9 A;  1FP0 A;  1WEP A;  5LKT A;  2F1X A;  3DPL R;  5B8D A;  2EGM A;  2JRJ A;  2LGV A;  1VYX A;  5D1M B;  2KWO A;  2VP7 A;  1F3V B;  4I7B A;  2I50 A;  2KWK A;  2VPG A;  2VJE B;  2LGL A;  1X4J A;  4KG9 A;  1MM3 A;  1V87 A;  3SUB A;  3KQI A;  1FLL A;  3PUR A;  5JG6 A;  5AIU A;  2K16 A;  2LXH C;  4YBS A;  3HCS A;  2YSM A;  3KV6 A;  2EOD A;  4O64 A;  4S3O C;  1MBM A;  2AN6 A;  3H7H A;  2KKY A;  4WZ0 A;  4LJN A;  3T7L A;  2HYE D;  1Z6U A;  3V43 A;  2L0B A;  3C5K A;  1X4U A;  3HCT A;  3N9O A;  5E1T A;  1CZY A;  3KNV A;  5B77 A;  3QZV A;  1VD4 A;  4R7E A;  2M6M A;  3ZPV 1;  2LV9 A;  3IHP A;  2C2L A;  3LVQ E;  2LN0 A;  4ZDT A;  4YBM A;  4QF2 A;  1IYM A;  4GWN A;  2M3H A;  2CRR A;  4BHW A;  3HSV A;  3O36 A;  2IDA A;  2KKX A;  3LVR E;  5FB0 A;  3RTR B;  1N87 A;  2MIQ A;  2KGI A;  4MSX A;  3ZPV E;  5H1T A;  1HYJ A;  5LKU A;  1WEO A;  5TDW A;  4F1P A;  3E2D A;  4GB0 A;  1DCQ A;  3RPG B;  5B78 A;  4GWM A;  1WIL A;  3O35 A;  2YHO A;  5KH7 A;  4QQ4 A;  2CSZ A;  1D0A A;  3HTK C;  3U5P A;  4W4U A;  2GKW A;  4BBQ A;  3LQJ A;  2FOO A;  2CT2 A;  1G25 A;  2JUN A;  2QJ0 A;  2VNF A;  4YAX A;  5B79 A;  2YQM A;  2VPB A;  3O37 A;  3HQM A;  3HU6 A;  2YRE A;  5LKX A;  4K8U A;  4UP0 A;  4IC3 A;  2H0D A;  2YQL A;  3O70 A;  2PUY A;  3IVV A;  3T6R A;  1YY6 A;  3IVB A;  1WES A;  2ECJ A;  4CA1 A;  3RPG C;  3SOW A;  2K4D A;  4IC2 A;  1LDK C;  2LRI C;  4A49 A;  4AP4 A;  2KE1 A;  1D0J A;  3HQL A;  3ZVY A;  1WEQ A;  2PNX A;  2YUC A;  3IVQ A;  2YSJ A;  2CKL A;  2LGK A;  2LGG A;  2KU3 A;  3GL6 A;  3I2D A;  4R8P K;  2M85 A;  1YZE A;  4AYC B;  5FB1 A;  2EXU A;  3HQH A;  2VJF B;  1JM7 B;  3C6W A;  2KYU A;  5B76 A;  1LB5 A;  4GNF A;  4X3G A;  2JM3 A;  2VJE A;  4UP5 A;  1T1H A;  4LLB A;  2YHN A;  3O47 A;  3U5M A;  4Z0R A;  2G6Q A;  2HDP A;  5G0F A;  1CHC A;  2EA6 A;  3MDB C;  4Q6F A;  4WZ3 B;  2FFW A;  2MD8 C;  1WEV A;  1MM2 A;  2ECG A;  1Z2Q A;  3JUE A;  1LB6 A;  1WEE A;  1KZZ A;  4UI9 B;  2FUU A;  3LQI A;  2G45 A;  2MUM A;  4WA6 A;  1WEU A;  2FOJ A;  4FJC A;  2B0O E;  2JMJ A;  2ECV A;  1ZMS A;  4I7D A;  1BOR A;  5LCW B;  4GNG A;  3PHD A;  4TKP B; 
#chains in the Genus database with same CATH homology
 1DVP A;  2QIC A;  4YAB A;  1HYI A;  4R2Y A;  5TRB A;  3ZVZ B;  1RMD A;  3SOU A;  5AIT A;  2E6R A;  3N9M A;  2Y43 A;  4JJQ A;  2MA6 A;  3N9Q A;  1D00 A;  2F1W A;  4XI1 A;  3N9P A;  2LQ6 A;  4O1V A;  5TBN A;  3N9N A;  5H1V A;  4MVT A;  3MHH A;  2Y1M A;  1WIM A;  4FK5 A;  3M62 A;  2FUI A;  2D8S A;  1D01 A;  2JMD A;  1CA9 A;  2FSA A;  3ZYQ A;  4V3L C;  2BAY A;  5C11 A;  1XWH A;  4Z8M A;  2F6N A;  4M4E A;  2F1Z A;  4ZQL A;  4GJH A;  4A4C A;  3MQR A;  2KFT A;  5B75 A;  4CCG X;  3U5O A;  2M1R A;  4LKA A;  4N3W A;  2YU4 A;  4A4B A;  2ECT A;  3LRQ A;  4QF3 A;  1WFK A;  4N4F A;  2LDR A;  2YUR A;  3L11 A;  5G04 B;  2L80 A;  2C2V S;  3EB5 A;  1LDJ B;  5H1U A;  1CA4 A;  4YBT A;  5DKA A;  4YSI A;  4GHU A;  2MA5 A;  4ZUX U;  2CSY A;  3SHB A;  3ZTG A;  2F42 A;  2DX8 A;  3M99 A;  1RF3 A;  2VPD A;  3VK6 A;  2L5U A;  3MHS A;  5TAB A;  4V3K C;  1K2F A;  3KV5 A;  4AYC A;  2RI7 A;  4YAT A;  1F62 A;  1JOC A;  2VJF A;  2KGG A;  1JM7 A;  3O7A A;  1X4I A;  4WZ2 A;  1FLK A;  3DQV R;  2ECI A;  4F52 B;  2QIZ A;  1FBV A;  3ASL A;  1L0A A;  2XEU A;  3SOX A;  3L1Z B;  3HQI A;  3U5N A;  4C9Z A;  3FL2 A;  5KH3 A;  2NAA A;  4LAD B;  4GND A;  4LK9 A;  3O33 A;  5J3X A;  5D1L B;  4AVX A;  4NN2 A;  4B86 C;  4AUQ B;  2OXQ C;  4I7C A;  5EYA F;  2MNZ A;  1U6G B;  1E4U A;  1WEW A;  1WGM A;  2KWN A;  5FER A;  3M63 A;  3GV4 A;  2YT5 A;  2CR2 A;  4B7Y C;  2XB1 A;  2ECW A;  2JMI A;  2YYR A;  2MD7 B;  3L1X A;  5D1K B;  1VFY A;  5H9M A;  4GNE A;  3PUQ A;  1LB4 A;  3EB6 A;  3NG2 A;  2ECN A;  1Z60 A;  4YAD A;  2KIZ A;  1WEM A;  2KWJ A;  2E6S A;  2F6J A;  2L75 A;  5I3L A;  4FIP A;  5G05 B;  2L43 A;  3N9L A;  5C13 A;  2G43 A;  1ZBD B;  2K17 A;  4PTB A;  2UZG A;  4YC9 A;  2K1J A;  1WE9 A;  5LKZ A;  1WEN A;  2YW8 A;  2Y1N A;  3O34 A;  5KH9 A;  4L58 A;  2F1Y A;  4P5O B;  2MT5 A;  4A0C D;  2LXP C;  2H0D B;  4L7X A;  3ZJB A;  5TDR A;  2A25 A;  2FOP A;  2KR4 A;  2ZET C;  2MNY A;  1CZZ A;  3HCU A;  1QSC A;  3LQH A;  2KRE A;  2EGP A;  4PPE A;  3ZNI A;  4S3O B;  5FEY A;  2RSD A;  2CKL B;  3MQS C;  5DIN A;  2XXN A;  2VPE A;  4FO9 A;  1FP0 A;  1WEP A;  5LKT A;  2F1X A;  3DPL R;  5B8D A;  2JRJ A;  2LGV A;  1VYX A;  5D1M B;  2KWO A;  2VP7 A;  1F3V B;  4I7B A;  2I50 A;  2KWK A;  2VPG A;  2VJE B;  2LGL A;  1X4J A;  4KG9 A;  1MM3 A;  1V87 A;  3KQI A;  1FLL A;  3PUR A;  5JG6 A;  5AIU A;  2K16 A;  2LXH C;  4YBS A;  3HCS A;  2YSM A;  3KV6 A;  2EOD A;  4O64 A;  4S3O C;  2AN6 A;  4WZ0 A;  4LJN A;  3T7L A;  2HYE D;  1Z6U A;  3V43 A;  2L0B A;  3C5K A;  1X4U A;  3HCT A;  3N9O A;  5E1T A;  1CZY A;  3KNV A;  5B77 A;  3QZV A;  1VD4 A;  4R7E A;  2M6M A;  3ZPV 1;  2LV9 A;  3IHP A;  2C2L A;  2LN0 A;  4ZDT A;  4YBM A;  4QF2 A;  1IYM A;  4GWN A;  2M3H A;  4BHW A;  3HSV A;  3O36 A;  2IDA A;  5FB0 A;  3RTR B;  1N87 A;  2MIQ A;  2KGI A;  4MSX A;  3ZPV E;  5H1T A;  1HYJ A;  5LKU A;  1WEO A;  5TDW A;  4GB0 A;  3RPG B;  5B78 A;  4GWM A;  1WIL A;  3O35 A;  2YHO A;  5KH7 A;  2CSZ A;  1D0A A;  3HTK C;  3U5P A;  4W4U A;  2GKW A;  4BBQ A;  3LQJ A;  2FOO A;  2CT2 A;  1G25 A;  2QJ0 A;  2VNF A;  4YAX A;  5B79 A;  2YQM A;  2VPB A;  3O37 A;  3HQM A;  3HU6 A;  2YRE A;  5LKX A;  4K8U A;  4UP0 A;  4IC3 A;  2H0D A;  2YQL A;  3O70 A;  2PUY A;  3IVV A;  3T6R A;  1YY6 A;  3IVB A;  1WES A;  2ECJ A;  4CA1 A;  3RPG C;  3SOW A;  2K4D A;  4IC2 A;  1LDK C;  2LRI C;  4A49 A;  4AP4 A;  2KE1 A;  1D0J A;  3HQL A;  3ZVY A;  1WEQ A;  2PNX A;  2YUC A;  3IVQ A;  2YSJ A;  2CKL A;  2LGK A;  2LGG A;  2KU3 A;  3GL6 A;  3I2D A;  4R8P K;  2M85 A;  1YZE A;  4AYC B;  5FB1 A;  3HQH A;  2VJF B;  1JM7 B;  3C6W A;  2KYU A;  5B76 A;  1LB5 A;  4GNF A;  4X3G A;  2VJE A;  4UP5 A;  1T1H A;  4LLB A;  2YHN A;  3U5M A;  2G6Q A;  2HDP A;  5G0F A;  1CHC A;  2EA6 A;  4WZ3 B;  4Q6F A;  2MD8 C;  1WEV A;  1MM2 A;  2ECG A;  1Z2Q A;  1LB6 A;  1WEE A;  1KZZ A;  4UI9 B;  2FUU A;  3LQI A;  2G45 A;  2MUM A;  4WA6 A;  1WEU A;  2FOJ A;  4FJC A;  2JMJ A;  2ECV A;  1ZMS A;  4I7D A;  1BOR A;  5LCW B;  4GNG A;  3PHD A;  4TKP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...