3HSVA

Structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: spopmathx-macroh2asbcpep2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
138
structure length
133
Chain Sequence
KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, ligase
molecule keywords Speckle-type POZ protein
publication title Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
pubmed doi rcsb
source organism Pongo abelii
total genus 27
structure length 133
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00917 MATH MATH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 3hsvA01
2F1WA 2F1ZA 2FOPA 4GHUA 2AN6A 4GWNA 1D00A 5H9MA 2A25A 2F1YA 3HU6A 2FOOA 1CA9A 1CA4A 1CZZA 3MQRA 4I7DA 1QSCA 4M4EA 4GJHA 5E1TA 4I7CA 1K2FA 1ZMSA 4JJQA 1LB5A 2XXNA 3IVVA 4GWMA 4C9ZA 4K8UA 3IVBA 1D01A 3HQMA 1RF3A 3HQHA 3HSVA 3MQSC 4O1VA 1L0AA 1YZEA 1FLKA 1LB4A 1YY6A 2CR2A 3HQLA 2GKWA 3ZJBA 1F3VB 1D0JA 4I7BA 3HQIA 2FOJA 1FLLA 3IVQA 1LB6A 4YSIA 1D0AA 2F1XA 4CA1A 1CZYA 4KG9A 1KZZA 4X3GA 4Z8MA
chains in the Genus database with same CATH superfamily
2F1WA 2F1ZA 2FOPA 4GHUA 2AN6A 4GWNA 1D00A 5H9MA 2A25A 2F1YA 3HU6A 2FOOA 1CA9A 1CA4A 1CZZA 3MQRA 4I7DA 1QSCA 4M4EA 4GJHA 5E1TA 4I7CA 1K2FA 1ZMSA 4JJQA 1LB5A 2XXNA 3IVVA 4GWMA 4C9ZA 4K8UA 3IVBA 1D01A 3HQMA 1RF3A 3HQHA 3HSVA 3MQSC 4O1VA 1L0AA 1YZEA 1FLKA 1LB4A 1YY6A 2CR2A 3HQLA 2GKWA 3ZJBA 1F3VB 1D0JA 4I7BA 3HQIA 2FOJA 1FLLA 3IVQA 1LB6A 4YSIA 1D0AA 2F1XA 4CA1A 1CZYA 4KG9A 1KZZA 4X3GA 4Z8MA
chains in the Genus database with same CATH topology
2F1WA 2F1ZA 2FOPA 4GHUA 2AN6A 4GWNA 1D00A 5H9MA 2A25A 2F1YA 3HU6A 2FOOA 1CA9A 1CA4A 1CZZA 3MQRA 4I7DA 1QSCA 4M4EA 4GJHA 5E1TA 4I7CA 1K2FA 1ZMSA 4JJQA 1LB5A 2XXNA 3IVVA 4GWMA 4C9ZA 4K8UA 3IVBA 1D01A 3HQMA 1RF3A 3HQHA 3HSVA 3MQSC 4O1VA 1L0AA 1YZEA 1FLKA 1LB4A 1YY6A 2CR2A 3HQLA 2GKWA 3ZJBA 1F3VB 1D0JA 4I7BA 3HQIA 2FOJA 1FLLA 3IVQA 1LB6A 4YSIA 1D0AA 2F1XA 4CA1A 1CZYA 4KG9A 1KZZA 4X3GA 4Z8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1W A;  2F1Z A;  2FOP A;  4GHU A;  2AN6 A;  4GWN A;  1D00 A;  5H9M A;  2A25 A;  2F1Y A;  3HU6 A;  2FOO A;  1CA9 A;  1CA4 A;  1CZZ A;  3MQR A;  4I7D A;  1QSC A;  4M4E A;  4GJH A;  5E1T A;  4I7C A;  1K2F A;  1ZMS A;  4JJQ A;  1LB5 A;  2XXN A;  3IVV A;  4GWM A;  4C9Z A;  4K8U A;  3IVB A;  1D01 A;  3HQM A;  1RF3 A;  3HQH A;  3HSV A;  3MQS C;  4O1V A;  1L0A A;  1YZE A;  1FLK A;  1LB4 A;  1YY6 A;  2CR2 A;  3HQL A;  2GKW A;  3ZJB A;  1F3V B;  1D0J A;  4I7B A;  3HQI A;  2FOJ A;  1FLL A;  3IVQ A;  1LB6 A;  4YSI A;  1D0A A;  2F1X A;  4CA1 A;  1CZY A;  4KG9 A;  1KZZ A;  4X3G A;  4Z8M A; 
#chains in the Genus database with same CATH topology
 2F1W A;  2F1Z A;  2FOP A;  4GHU A;  2AN6 A;  4GWN A;  1D00 A;  5H9M A;  2A25 A;  2F1Y A;  3HU6 A;  2FOO A;  1CA9 A;  1CA4 A;  1CZZ A;  3MQR A;  4I7D A;  1QSC A;  4M4E A;  4GJH A;  5E1T A;  4I7C A;  1K2F A;  1ZMS A;  4JJQ A;  1LB5 A;  2XXN A;  3IVV A;  4GWM A;  4C9Z A;  4K8U A;  3IVB A;  1D01 A;  3HQM A;  1RF3 A;  3HQH A;  3HSV A;  3MQS C;  4O1V A;  1L0A A;  1YZE A;  1FLK A;  1LB4 A;  1YY6 A;  2CR2 A;  3HQL A;  2GKW A;  3ZJB A;  1F3V B;  1D0J A;  4I7B A;  3HQI A;  2FOJ A;  1FLL A;  3IVQ A;  1LB6 A;  4YSI A;  1D0A A;  2F1X A;  4CA1 A;  1CZY A;  4KG9 A;  1KZZ A;  4X3G A;  4Z8M A; 
#chains in the Genus database with same CATH homology
 2F1W A;  2F1Z A;  2FOP A;  4GHU A;  2AN6 A;  4GWN A;  1D00 A;  5H9M A;  2A25 A;  2F1Y A;  3HU6 A;  2FOO A;  1CA9 A;  1CA4 A;  1CZZ A;  3MQR A;  4I7D A;  1QSC A;  4M4E A;  4GJH A;  5E1T A;  4I7C A;  1K2F A;  1ZMS A;  4JJQ A;  1LB5 A;  2XXN A;  3IVV A;  4GWM A;  4C9Z A;  4K8U A;  3IVB A;  1D01 A;  3HQM A;  1RF3 A;  3HQH A;  3HSV A;  3MQS C;  4O1V A;  1L0A A;  1YZE A;  1FLK A;  1LB4 A;  1YY6 A;  2CR2 A;  3HQL A;  2GKW A;  3ZJB A;  1F3V B;  1D0J A;  4I7B A;  3HQI A;  2FOJ A;  1FLL A;  3IVQ A;  1LB6 A;  4YSI A;  1D0A A;  2F1X A;  4CA1 A;  1CZY A;  4KG9 A;  1KZZ A;  4X3G A;  4Z8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...