5H9MA

Crystal structure of siah2 sbd domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
190
structure length
190
Chain Sequence
SAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTIST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase SIAH2
publication title Crystal structure of siah2 SBD domain
rcsb
source organism Homo sapiens
total genus 45
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 5h9mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h9mA01
3NG2A 1KZZA 2FOJA 2KGIA 3KNVA 3HCSA 3LRQA 4YSIA 1X4UA 3C5KA 2IDAA 5KH9A 1VFYA 3VK6A 1WE9A 2VJEA 2F1YA 5H9MA 2MD7B 4R8PK 4AYCA 3MHSA 2KWJA 2LQ6A 4S3OB 3T6RA 4UP0A 1FLKA 4WZ0A 4PPEA 3V43A 2K17A 2F6JA 2M3HA 2F1WA 4UI9B 1LDJB 5EYAF 3U5PA 2LDRA 3N9QA 5DKAA 5G04B 2LN0A 4GNFA 3IVQA 3HQIA 3PURA 4V3KC 1WGMA 5D1LB 2VP7A 2QJ0A 3MQRA 1CZYA 2E6RA 3DPLR 2K1JA 2YW8A 4LKAA 5DINA 1WIMA 3SOUA 3N9NA 5D1KB 2RSDA 4A49A 1WEVA 2Y1NA 3GL6A 2XB1A 4F52B 2ECNA 1F3VB 3O34A 3MHHA 1HYJA 4GHUA 4NN2A 4AVXA 4AP4A 2VNFA 1WILA 1WENA 4YADA 2F1ZA 1N87A 5B79A 4YBTA 1YZEA 4B86C 2NAAA 3T7LA 2VJFA 2C2VS 2KU3A 3RPGC 2FOOA 2K4DA 1LB5A 3SHBA 3ZPV1 1F62A 4N3WA 2LV9A 2LXHC 3HQLA 5LKUA 3HCTA 2YT5A 1RF3A 1IYMA 4LLBA 5B76A 1ZBDB 1D00A 2YHOA 1Z2QA 4Q6FA 2KWKA 2YREA 2KREA 3O37A 2EGPA 3L1XA 1K2FA 3DQVR 3LQIA 5KH3A 4YABA 3N9MA 1Z60A 4YAXA 1V87A 1JOCA 4YATA 4LADB 2C2LA 2LXPC 5B75A 2CT2A 3PUQA 4O64A 5TABA 2L75A 3ZPVE 1HYIA 2ZETC 3SOXA 4O1VA 1WEMA 1WEEA 1RMDA 4MSXA 3KV6A 1ZMSA 3U5OA 1G25A 1XWHA 4Z8MA 2MIQA 3M62A 2LGVA 1WEPA 4GB0A 2KWNA 2YQMA 2YHNA 3U5NA 5TDRA 1DVPA 4W4UA 4KG9A 1WEOA 2ECJA 5TBNA 4P5OB 5B78A 5KH7A 4FO9A 1D01A 3O70A 2JRJA 2ECWA 2FSAA 4YBSA 2LRIC 1D0AA 2CSYA 2ECGA 2HDPA 4QF2A 5B8DA 2VPBA 5LKZA 2VPGA 4FIPA 4BBQA 5LKXA 3GV4A 2CSZA 5C11A 2LGGA 3ZTGA 1U6GB 4IC3A 3ZYQA 1FBVA 2YSJA 2VJFB 4IC2A 5LCWB 2OXQC 2CKLA 2L0BA 3KV5A 1CA4A 1LB6A 5H1TA 5FB0A 4FK5A 3RPGB 3O33A 4GNEA 3SOWA 2L43A 4LJNA 4K8UA 4MVTA 4GWMA 4WZ2A 3KQIA 4R7EA 3HCUA 4I7DA 4L7XA 2DX8A 5H1UA 2YSMA 3M99A 1YY6A 2ECTA 4FJCA 4XI1A 4X3GA 3HQMA 2MNYA 2ECIA 2KWOA 3N9PA 1T1HA 3I2DA 2XEUA 3EB6A 2H0DB 1LDKC 3LQHA 2D8SA 2LGKA 1VYXA 2YUCA 5B77A 5JG6A 2EA6A 3ZJBA 4CCGX 4B7YC 3HQHA 5G05B 1MM2A 1QSCA 2LGLA 1MM3A 2M1RA 4LK9A 1VD4A 1WEUA 5AITA 4YC9A 2JMIA 2PNXA 3ZVYA 2H0DA 2E6SA 5D1MB 1X4JA 4BHWA 2M85A 4WA6A 2Y43A 2G45A 1L0AA 1WFKA 2F42A 2FOPA 2MA6A 3IVBA 3FL2A 3ZNIA 4AUQB 2G6QA 3O36A 3N9LA 2VPDA 2Y1MA 3EB5A 5TDWA 1D0JA 1LB4A 2YURA 2MT5A 4GJHA 4R2YA 5FEYA 2PUYA 3MQSC 2YU4A 3ZVZB 2EODA 2XXNA 2CKLB 4PTBA 2UZGA 4TKPB 1Z6UA 4A4CA 4ZUXU 4GNDA 5LKTA 4S3OC 3QZVA 2KR4A 2VPEA 3C6WA 1WEQA 2F6NA 2FUIA 3HU6A 2K16A 4C9ZA 3L11A 1WESA 1BORA 1FLLA 1CA9A 4YBMA 1E4UA 2JMJA 2JMDA 2GKWA 2ECVA 2KIZA 3IHPA 4QF3A 4GNGA 2G43A 2KGGA 5G0FA 3LQJA 5TRBA 4M4EA 2M6MA 5H1VA 4A0CD 3L1ZB 2MA5A 4GWNA 3O7AA 3U5MA 5I3LA 4WZ3B 3PHDA 4ZQLA 3HSVA 5AIUA 3IVVA 4I7BA 2QIZA 2HYED 2L5UA 2MNZA 1JM7B 5E1TA 2KE1A 2BAYA 2F1XA 4JJQA 5FERA 2QICA 5J3XA 1X4IA 4N4FA 4A4BA 1WEWA 5FB1A 2YQLA 2MUMA 3ASLA 2YYRA 2KYUA 4I7CA 3O35A 2MD8C 1CHCA 4UP5A 3M63A 2AN6A 2FUUA 2CR2A 1CZZA 2VJEB 2RI7A 3N9OA 1JM7A 4AYCB 5C13A 4CA1A 4L58A 4V3LC 2KFTA 4ZDTA 3HTKC 2A25A 3RTRB 2L80A 2I50A 1FP0A
chains in the Genus database with same CATH superfamily
3NG2A 1KZZA 2FOJA 2KGIA 3KNVA 3HCSA 3LRQA 4YSIA 1X4UA 3C5KA 2IDAA 5KH9A 1VFYA 3VK6A 1WE9A 2VJEA 2F1YA 5H9MA 2MD7B 4R8PK 4AYCA 3MHSA 2KWJA 4O62A 4QQ4A 2LQ6A 4S3OB 3T6RA 4UP0A 1FLKA 4WZ0A 4PPEA 3V43A 2K17A 2F6JA 2M3HA 2F1WA 3E2DA 4UI9B 1LDJB 2CRRA 5EYAF 3U5PA 2LDRA 3N9QA 5DKAA 5G04B 2JUNA 2LN0A 4GNFA 3IVQA 3HQIA 5SVIB 3KDEC 4OGCA 3PURA 4V3KC 1WGMA 5D1LB 4Z0RA 2VP7A 2QJ0A 3H7HA 3MQRA 1CZYA 2E6RA 3DPLR 2K1JA 2YW8A 2L7PA 4LKAA 5DINA 1WIMA 2FFWA 3SOUA 3N9NA 5D1KB 2RSDA 4A49A 1WEVA 2Y1NA 3GL6A 2XB1A 4F52B 2ECNA 5K3QA 1F3VB 3O34A 3MHHA 1HYJA 4GHUA 4NN2A 4AVXA 4AP4A 2VNFA 1WILA 1WENA 4YADA 2F1ZA 1N87A 5B79A 4YBTA 1YZEA 2XOZA 4B86C 2OWAA 2NAAA 3M7KA 3T7LA 2VJFA 2CSVA 2C2VS 2KU3A 3JUEA 3RPGC 2FOOA 2K4DA 2RR4A 1LB5A 3SHBA 3ZPV1 1F62A 4N3WA 2LV9A 2LXHC 3LVRE 3HQLA 2XOYA 5LKUA 3O47A 3HCTA 2YT5A 1RF3A 2EXUA 1IYMA 4LLBA 5B76A 1ZBDB 2JM3A 1D00A 2YHOA 1Z2QA 4Q6FA 5SVXA 3T9KA 2KWKA 2YREA 2KREA 3O37A 2EGPA 4F1PA 2YVRA 3L1XA 1K2FA 3DQVR 3LQIA 5KH3A 4YABA 3N9MA 1Z60A 4YAXA 1V87A 1JOCA 4YATA 3DDTA 4LADB 2C2LA 2LXPC 5B75A 2CT2A 3PUQA 4O64A 5TABA 2L75A 3ZPVE 1HYIA 2ZETC 3SOXA 4O1VA 1WEMA 1WEEA 1RMDA 4MSXA 3PLWA 3KV6A 1ZMSA 3U5OA 1G25A 1XWHA 2FD4A 3DWDA 4Z8MA 2MIQA 3M62A 2LGVA 3LDYA 1WEPA 4GB0A 2KWNA 2YQMA 2YHNA 3U5NA 5TDRA 1DVPA 4W4UA 4KG9A 1WEOA 2ECJA 5TBNA 4P5OB 5B78A 5KH7A 4FO9A 1D01A 2IQJA 3O70A 2JRJA 2ECWA 2FSAA 2CONA 3FM8C 4YBSA 2LRIC 1D0AA 2CSYA 2ECGA 2HDPA 4QF2A 5B8DA 3MDBC 2VPBA 5LKZA 2VPGA 4FIPA 4BBQA 5LKXA 3GV4A 2CSZA 5C11A 2LGGA 3ZTGA 1U6GB 2KKYA 4IC3A 3ZYQA 1FBVA 2YSJA 2VJFB 4IC2A 5LCWB 2OXQC 2CKLA 2L0BA 3KV5A 1CA4A 1LB6A 5H1TA 5FB0A 4FK5A 3RPGB 3O33A 2DJAA 4GNEA 3SOWA 2L43A 4LJNA 2XOCA 4K8UA 4MVTA 4GWMA 4WZ2A 3KQIA 4R7EA 3HCUA 4I7DA 4L7XA 2DX8A 5H1UA 2YSMA 3M99A 1YY6A 2ECTA 4H9DA 4FJCA 4XI1A 4X3GA 3HQMA 2MNYA 2ECIA 2KWOA 3N9PA 1T1HA 3I2DA 2XEUA 3EB6A 2H0DB 2MKEA 1LDKC 3LQHA 2D8SA 2LGKA 1VYXA 2YUCA 5B77A 5JG6A 2EA6A 3ZJBA 4CCGX 4B7YC 3HQHA 5G05B 1MM2A 1QSCA 2LGLA 1MM3A 2M1RA 4LK9A 1VD4A 1WEUA 5AITA 4YC9A 2JMIA 2PNXA 4OGEA 1DCQA 3ZVYA 2H0DA 2E6SA 5D1MB 1X4JA 4BHWA 2M85A 4WA6A 2Y43A 3FANA 2G45A 1L0AA 1WFKA 2B0OE 2F42A 2FOPA 2MA6A 2DSMA 3IVBA 3FL2A 3ZNIA 4AUQB 2G6QA 3O36A 3N9LA 2VPDA 2Y1MA 3EB5A 2LAUA 3FAOA 2XP0A 5TDWA 2CRWA 1D0JA 1LB4A 2YURA 2MT5A 4GJHA 4R2YA 5FEYA 2PUYA 3MQSC 2YU4A 3ZVZB 2EODA 2XXNA 2CKLB 4PTBA 5SVYA 2UZGA 4TKPB 1Z6UA 4A4CA 4ZUXU 4GNDA 5LKTA 4S3OC 3QZVA 2KR4A 2VPEA 3C6WA 3Q1DA 1WEQA 2F6NA 2FUIA 3HU6A 2K16A 4C9ZA 3L11A 1WESA 1BORA 3LVQE 1FLLA 1CA9A 4YBMA 1E4UA 2JMJA 2JMDA 2GKWA 2ECVA 2KIZA 3IHPA 4QF3A 4GNGA 2KKXA 2G43A 3LJUX 2D8UA 5SVIA 2KGGA 5G0FA 3LQJA 5TRBA 4M4EA 2M6MA 5H1VA 4A0CD 3L1ZB 2MA5A 4GWNA 2M13A 3O7AA 3U5MA 5I3LA 4WZ3B 3PHDA 4ZQLA 4Z0OA 3HSVA 5AIUA 3IVVA 3FJUB 4I7BA 2QIZA 2HYED 2L5UA 2MNZA 3SUBA 1JM7B 5E1TA 2KE1A 2BAYA 2F1XA 4JJQA 5FERA 2QICA 5J3XA 1X4IA 2P57A 4N4FA 4A4BA 1WEWA 5FB1A 2YQLA 2MUMA 3ASLA 2YYRA 2KYUA 2EGMA 4I7CA 2E61A 3O35A 1CHCA 2MD8C 4UP5A 3M63A 2AN6A 2FUUA 2CR2A 1CZZA 2VJEB 2RI7A 3N9OA 1JM7A 4AYCB 5C13A 1MBMA 4CA1A 3FEHA 4L58A 4V3LC 2KFTA 4ZDTA 3HTKC 2A25A 3RTRB 2L80A 2I50A 1FP0A
chains in the Genus database with same CATH topology
3NG2A 1KZZA 2FOJA 2KGIA 3KNVA 3HCSA 3LRQA 4YSIA 1X4UA 3C5KA 2IDAA 5KH9A 1VFYA 3VK6A 1WE9A 2VJEA 2F1YA 5H9MA 2MD7B 4R8PK 4AYCA 3MHSA 2KWJA 2LQ6A 4S3OB 3T6RA 4UP0A 1FLKA 4WZ0A 4PPEA 3V43A 2K17A 2F6JA 2M3HA 2F1WA 4UI9B 1LDJB 5EYAF 3U5PA 2LDRA 3N9QA 5DKAA 5G04B 2LN0A 4GNFA 3IVQA 3HQIA 3PURA 4V3KC 1WGMA 5D1LB 2VP7A 2QJ0A 3MQRA 1CZYA 2E6RA 3DPLR 2K1JA 2YW8A 4LKAA 5DINA 1WIMA 3SOUA 3N9NA 5D1KB 2RSDA 4A49A 1WEVA 2Y1NA 3GL6A 2XB1A 4F52B 2ECNA 1F3VB 3O34A 3MHHA 1HYJA 4GHUA 4NN2A 4AVXA 4AP4A 2VNFA 1WILA 1WENA 4YADA 2F1ZA 1N87A 5B79A 4YBTA 1YZEA 4B86C 2NAAA 3T7LA 2VJFA 2C2VS 2KU3A 3RPGC 2FOOA 2K4DA 1LB5A 3SHBA 3ZPV1 1F62A 4N3WA 2LV9A 2LXHC 3HQLA 5LKUA 3HCTA 2YT5A 1RF3A 1IYMA 4LLBA 5B76A 1ZBDB 1D00A 2YHOA 1Z2QA 4Q6FA 2KWKA 2YREA 2KREA 3O37A 2EGPA 3L1XA 1K2FA 3DQVR 3LQIA 5KH3A 4YABA 3N9MA 1Z60A 4YAXA 1V87A 1JOCA 4YATA 4LADB 2C2LA 2LXPC 5B75A 2CT2A 3PUQA 4O64A 5TABA 2L75A 3ZPVE 1HYIA 2ZETC 3SOXA 4O1VA 1WEMA 1WEEA 1RMDA 4MSXA 3KV6A 1ZMSA 3U5OA 1G25A 1XWHA 4Z8MA 2MIQA 3M62A 2LGVA 1WEPA 4GB0A 2KWNA 2YQMA 2YHNA 3U5NA 5TDRA 1DVPA 4W4UA 4KG9A 1WEOA 2ECJA 5TBNA 4P5OB 5B78A 5KH7A 4FO9A 1D01A 3O70A 2JRJA 2ECWA 2FSAA 4YBSA 2LRIC 1D0AA 2CSYA 2ECGA 2HDPA 4QF2A 5B8DA 2VPBA 5LKZA 2VPGA 4FIPA 4BBQA 5LKXA 3GV4A 2CSZA 5C11A 2LGGA 3ZTGA 1U6GB 4IC3A 3ZYQA 1FBVA 2YSJA 2VJFB 4IC2A 5LCWB 2OXQC 2CKLA 2L0BA 3KV5A 1CA4A 1LB6A 5H1TA 5FB0A 4FK5A 3RPGB 3O33A 4GNEA 3SOWA 2L43A 4LJNA 4K8UA 4MVTA 4GWMA 4WZ2A 3KQIA 4R7EA 3HCUA 4I7DA 4L7XA 2DX8A 5H1UA 2YSMA 3M99A 1YY6A 2ECTA 4FJCA 4XI1A 4X3GA 3HQMA 2MNYA 2ECIA 2KWOA 3N9PA 1T1HA 3I2DA 2XEUA 3EB6A 2H0DB 1LDKC 3LQHA 2D8SA 2LGKA 1VYXA 2YUCA 5B77A 5JG6A 2EA6A 3ZJBA 4CCGX 4B7YC 3HQHA 5G05B 1MM2A 1QSCA 2LGLA 1MM3A 2M1RA 4LK9A 1VD4A 1WEUA 5AITA 4YC9A 2JMIA 2PNXA 3ZVYA 2H0DA 2E6SA 5D1MB 1X4JA 4BHWA 2M85A 4WA6A 2Y43A 2G45A 1L0AA 1WFKA 2F42A 2FOPA 2MA6A 3IVBA 3FL2A 3ZNIA 4AUQB 2G6QA 3O36A 3N9LA 2VPDA 2Y1MA 3EB5A 5TDWA 1D0JA 1LB4A 2YURA 2MT5A 4GJHA 4R2YA 5FEYA 2PUYA 3MQSC 2YU4A 3ZVZB 2EODA 2XXNA 2CKLB 4PTBA 2UZGA 4TKPB 1Z6UA 4A4CA 4ZUXU 4GNDA 5LKTA 4S3OC 3QZVA 2KR4A 2VPEA 3C6WA 1WEQA 2F6NA 2FUIA 3HU6A 2K16A 4C9ZA 3L11A 1WESA 1BORA 1FLLA 1CA9A 4YBMA 1E4UA 2JMJA 2JMDA 2GKWA 2ECVA 2KIZA 3IHPA 4QF3A 4GNGA 2G43A 2KGGA 5G0FA 3LQJA 5TRBA 4M4EA 2M6MA 5H1VA 4A0CD 3L1ZB 2MA5A 4GWNA 3O7AA 3U5MA 5I3LA 4WZ3B 3PHDA 4ZQLA 3HSVA 5AIUA 3IVVA 4I7BA 2QIZA 2HYED 2L5UA 2MNZA 1JM7B 5E1TA 2KE1A 2BAYA 2F1XA 4JJQA 5FERA 2QICA 5J3XA 1X4IA 4N4FA 4A4BA 1WEWA 5FB1A 2YQLA 2MUMA 3ASLA 2YYRA 2KYUA 4I7CA 3O35A 2MD8C 1CHCA 4UP5A 3M63A 2AN6A 2FUUA 2CR2A 1CZZA 2VJEB 2RI7A 3N9OA 1JM7A 4AYCB 5C13A 4CA1A 4L58A 4V3LC 2KFTA 4ZDTA 3HTKC 2A25A 3RTRB 2L80A 2I50A 1FP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NG2 A;  1KZZ A;  2FOJ A;  2KGI A;  3KNV A;  3HCS A;  3LRQ A;  4YSI A;  1X4U A;  3C5K A;  2IDA A;  5KH9 A;  1VFY A;  3VK6 A;  1WE9 A;  2VJE A;  2F1Y A;  5H9M A;  2MD7 B;  4R8P K;  4AYC A;  3MHS A;  2KWJ A;  2LQ6 A;  4S3O B;  3T6R A;  4UP0 A;  1FLK A;  4WZ0 A;  4PPE A;  3V43 A;  2K17 A;  2F6J A;  2M3H A;  2F1W A;  4UI9 B;  1LDJ B;  5EYA F;  3U5P A;  2LDR A;  3N9Q A;  5DKA A;  5G04 B;  2LN0 A;  4GNF A;  3IVQ A;  3HQI A;  3PUR A;  4V3K C;  1WGM A;  5D1L B;  2VP7 A;  2QJ0 A;  3MQR A;  1CZY A;  2E6R A;  3DPL R;  2K1J A;  2YW8 A;  4LKA A;  5DIN A;  1WIM A;  3SOU A;  3N9N A;  5D1K B;  2RSD A;  4A49 A;  1WEV A;  2Y1N A;  3GL6 A;  2XB1 A;  4F52 B;  2ECN A;  1F3V B;  3O34 A;  3MHH A;  1HYJ A;  4GHU A;  4NN2 A;  4AVX A;  4AP4 A;  2VNF A;  1WIL A;  1WEN A;  4YAD A;  2F1Z A;  1N87 A;  5B79 A;  4YBT A;  1YZE A;  4B86 C;  2NAA A;  3T7L A;  2VJF A;  2C2V S;  2KU3 A;  3RPG C;  2FOO A;  2K4D A;  1LB5 A;  3SHB A;  3ZPV 1;  1F62 A;  4N3W A;  2LV9 A;  2LXH C;  3HQL A;  5LKU A;  3HCT A;  2YT5 A;  1RF3 A;  1IYM A;  4LLB A;  5B76 A;  1ZBD B;  1D00 A;  2YHO A;  1Z2Q A;  4Q6F A;  2KWK A;  2YRE A;  2KRE A;  3O37 A;  2EGP A;  3L1X A;  1K2F A;  3DQV R;  3LQI A;  5KH3 A;  4YAB A;  3N9M A;  1Z60 A;  4YAX A;  1V87 A;  1JOC A;  4YAT A;  4LAD B;  2C2L A;  2LXP C;  5B75 A;  2CT2 A;  3PUQ A;  4O64 A;  5TAB A;  2L75 A;  3ZPV E;  1HYI A;  2ZET C;  3SOX A;  4O1V A;  1WEM A;  1WEE A;  1RMD A;  4MSX A;  3KV6 A;  1ZMS A;  3U5O A;  1G25 A;  1XWH A;  4Z8M A;  2MIQ A;  3M62 A;  2LGV A;  1WEP A;  4GB0 A;  2KWN A;  2YQM A;  2YHN A;  3U5N A;  5TDR A;  1DVP A;  4W4U A;  4KG9 A;  1WEO A;  2ECJ A;  5TBN A;  4P5O B;  5B78 A;  5KH7 A;  4FO9 A;  1D01 A;  3O70 A;  2JRJ A;  2ECW A;  2FSA A;  4YBS A;  2LRI C;  1D0A A;  2CSY A;  2ECG A;  2HDP A;  4QF2 A;  5B8D A;  2VPB A;  5LKZ A;  2VPG A;  4FIP A;  4BBQ A;  5LKX A;  3GV4 A;  2CSZ A;  5C11 A;  2LGG A;  3ZTG A;  1U6G B;  4IC3 A;  3ZYQ A;  1FBV A;  2YSJ A;  2VJF B;  4IC2 A;  5LCW B;  2OXQ C;  2CKL A;  2L0B A;  3KV5 A;  1CA4 A;  1LB6 A;  5H1T A;  5FB0 A;  4FK5 A;  3RPG B;  3O33 A;  4GNE A;  3SOW A;  2L43 A;  4LJN A;  4K8U A;  4MVT A;  4GWM A;  4WZ2 A;  3KQI A;  4R7E A;  3HCU A;  4I7D A;  4L7X A;  2DX8 A;  5H1U A;  2YSM A;  3M99 A;  1YY6 A;  2ECT A;  4FJC A;  4XI1 A;  4X3G A;  3HQM A;  2MNY A;  2ECI A;  2KWO A;  3N9P A;  1T1H A;  3I2D A;  2XEU A;  3EB6 A;  2H0D B;  1LDK C;  3LQH A;  2D8S A;  2LGK A;  1VYX A;  2YUC A;  5B77 A;  5JG6 A;  2EA6 A;  3ZJB A;  4CCG X;  4B7Y C;  3HQH A;  5G05 B;  1MM2 A;  1QSC A;  2LGL A;  1MM3 A;  2M1R A;  4LK9 A;  1VD4 A;  1WEU A;  5AIT A;  4YC9 A;  2JMI A;  2PNX A;  3ZVY A;  2H0D A;  2E6S A;  5D1M B;  1X4J A;  4BHW A;  2M85 A;  4WA6 A;  2Y43 A;  2G45 A;  1L0A A;  1WFK A;  2F42 A;  2FOP A;  2MA6 A;  3IVB A;  3FL2 A;  3ZNI A;  4AUQ B;  2G6Q A;  3O36 A;  3N9L A;  2VPD A;  2Y1M A;  3EB5 A;  5TDW A;  1D0J A;  1LB4 A;  2YUR A;  2MT5 A;  4GJH A;  4R2Y A;  5FEY A;  2PUY A;  3MQS C;  2YU4 A;  3ZVZ B;  2EOD A;  2XXN A;  2CKL B;  4PTB A;  2UZG A;  4TKP B;  1Z6U A;  4A4C A;  4ZUX U;  4GND A;  5LKT A;  4S3O C;  3QZV A;  2KR4 A;  2VPE A;  3C6W A;  1WEQ A;  2F6N A;  2FUI A;  3HU6 A;  2K16 A;  4C9Z A;  3L11 A;  1WES A;  1BOR A;  1FLL A;  1CA9 A;  4YBM A;  1E4U A;  2JMJ A;  2JMD A;  2GKW A;  2ECV A;  2KIZ A;  3IHP A;  4QF3 A;  4GNG A;  2G43 A;  2KGG A;  5G0F A;  3LQJ A;  5TRB A;  4M4E A;  2M6M A;  5H1V A;  4A0C D;  3L1Z B;  2MA5 A;  4GWN A;  3O7A A;  3U5M A;  5I3L A;  4WZ3 B;  3PHD A;  4ZQL A;  3HSV A;  5AIU A;  3IVV A;  4I7B A;  2QIZ A;  2HYE D;  2L5U A;  2MNZ A;  1JM7 B;  5E1T A;  2KE1 A;  2BAY A;  2F1X A;  4JJQ A;  5FER A;  2QIC A;  5J3X A;  1X4I A;  4N4F A;  4A4B A;  1WEW A;  5FB1 A;  2YQL A;  2MUM A;  3ASL A;  2YYR A;  2KYU A;  4I7C A;  3O35 A;  2MD8 C;  1CHC A;  4UP5 A;  3M63 A;  2AN6 A;  2FUU A;  2CR2 A;  1CZZ A;  2VJE B;  2RI7 A;  3N9O A;  1JM7 A;  4AYC B;  5C13 A;  4CA1 A;  4L58 A;  4V3L C;  2KFT A;  4ZDT A;  3HTK C;  2A25 A;  3RTR B;  2L80 A;  2I50 A;  1FP0 A; 
#chains in the Genus database with same CATH topology
 3NG2 A;  1KZZ A;  2FOJ A;  2KGI A;  3KNV A;  3HCS A;  3LRQ A;  4YSI A;  1X4U A;  3C5K A;  2IDA A;  5KH9 A;  1VFY A;  3VK6 A;  1WE9 A;  2VJE A;  2F1Y A;  5H9M A;  2MD7 B;  4R8P K;  4AYC A;  3MHS A;  2KWJ A;  4O62 A;  4QQ4 A;  2LQ6 A;  4S3O B;  3T6R A;  4UP0 A;  1FLK A;  4WZ0 A;  4PPE A;  3V43 A;  2K17 A;  2F6J A;  2M3H A;  2F1W A;  3E2D A;  4UI9 B;  1LDJ B;  2CRR A;  5EYA F;  3U5P A;  2LDR A;  3N9Q A;  5DKA A;  5G04 B;  2JUN A;  2LN0 A;  4GNF A;  3IVQ A;  3HQI A;  5SVI B;  3KDE C;  4OGC A;  3PUR A;  4V3K C;  1WGM A;  5D1L B;  4Z0R A;  2VP7 A;  2QJ0 A;  3H7H A;  3MQR A;  1CZY A;  2E6R A;  3DPL R;  2K1J A;  2YW8 A;  2L7P A;  4LKA A;  5DIN A;  1WIM A;  2FFW A;  3SOU A;  3N9N A;  5D1K B;  2RSD A;  4A49 A;  1WEV A;  2Y1N A;  3GL6 A;  2XB1 A;  4F52 B;  2ECN A;  5K3Q A;  1F3V B;  3O34 A;  3MHH A;  1HYJ A;  4GHU A;  4NN2 A;  4AVX A;  4AP4 A;  2VNF A;  1WIL A;  1WEN A;  4YAD A;  2F1Z A;  1N87 A;  5B79 A;  4YBT A;  1YZE A;  2XOZ A;  4B86 C;  2OWA A;  2NAA A;  3M7K A;  3T7L A;  2VJF A;  2CSV A;  2C2V S;  2KU3 A;  3JUE A;  3RPG C;  2FOO A;  2K4D A;  2RR4 A;  1LB5 A;  3SHB A;  3ZPV 1;  1F62 A;  4N3W A;  2LV9 A;  2LXH C;  3LVR E;  3HQL A;  2XOY A;  5LKU A;  3O47 A;  3HCT A;  2YT5 A;  1RF3 A;  2EXU A;  1IYM A;  4LLB A;  5B76 A;  1ZBD B;  2JM3 A;  1D00 A;  2YHO A;  1Z2Q A;  4Q6F A;  5SVX A;  3T9K A;  2KWK A;  2YRE A;  2KRE A;  3O37 A;  2EGP A;  4F1P A;  2YVR A;  3L1X A;  1K2F A;  3DQV R;  3LQI A;  5KH3 A;  4YAB A;  3N9M A;  1Z60 A;  4YAX A;  1V87 A;  1JOC A;  4YAT A;  3DDT A;  4LAD B;  2C2L A;  2LXP C;  5B75 A;  2CT2 A;  3PUQ A;  4O64 A;  5TAB A;  2L75 A;  3ZPV E;  1HYI A;  2ZET C;  3SOX A;  4O1V A;  1WEM A;  1WEE A;  1RMD A;  4MSX A;  3PLW A;  3KV6 A;  1ZMS A;  3U5O A;  1G25 A;  1XWH A;  2FD4 A;  3DWD A;  4Z8M A;  2MIQ A;  3M62 A;  2LGV A;  3LDY A;  1WEP A;  4GB0 A;  2KWN A;  2YQM A;  2YHN A;  3U5N A;  5TDR A;  1DVP A;  4W4U A;  4KG9 A;  1WEO A;  2ECJ A;  5TBN A;  4P5O B;  5B78 A;  5KH7 A;  4FO9 A;  1D01 A;  2IQJ A;  3O70 A;  2JRJ A;  2ECW A;  2FSA A;  2CON A;  3FM8 C;  4YBS A;  2LRI C;  1D0A A;  2CSY A;  2ECG A;  2HDP A;  4QF2 A;  5B8D A;  3MDB C;  2VPB A;  5LKZ A;  2VPG A;  4FIP A;  4BBQ A;  5LKX A;  3GV4 A;  2CSZ A;  5C11 A;  2LGG A;  3ZTG A;  1U6G B;  2KKY A;  4IC3 A;  3ZYQ A;  1FBV A;  2YSJ A;  2VJF B;  4IC2 A;  5LCW B;  2OXQ C;  2CKL A;  2L0B A;  3KV5 A;  1CA4 A;  1LB6 A;  5H1T A;  5FB0 A;  4FK5 A;  3RPG B;  3O33 A;  2DJA A;  4GNE A;  3SOW A;  2L43 A;  4LJN A;  2XOC A;  4K8U A;  4MVT A;  4GWM A;  4WZ2 A;  3KQI A;  4R7E A;  3HCU A;  4I7D A;  4L7X A;  2DX8 A;  5H1U A;  2YSM A;  3M99 A;  1YY6 A;  2ECT A;  4H9D A;  4FJC A;  4XI1 A;  4X3G A;  3HQM A;  2MNY A;  2ECI A;  2KWO A;  3N9P A;  1T1H A;  3I2D A;  2XEU A;  3EB6 A;  2H0D B;  2MKE A;  1LDK C;  3LQH A;  2D8S A;  2LGK A;  1VYX A;  2YUC A;  5B77 A;  5JG6 A;  2EA6 A;  3ZJB A;  4CCG X;  4B7Y C;  3HQH A;  5G05 B;  1MM2 A;  1QSC A;  2LGL A;  1MM3 A;  2M1R A;  4LK9 A;  1VD4 A;  1WEU A;  5AIT A;  4YC9 A;  2JMI A;  2PNX A;  4OGE A;  1DCQ A;  3ZVY A;  2H0D A;  2E6S A;  5D1M B;  1X4J A;  4BHW A;  2M85 A;  4WA6 A;  2Y43 A;  3FAN A;  2G45 A;  1L0A A;  1WFK A;  2B0O E;  2F42 A;  2FOP A;  2MA6 A;  2DSM A;  3IVB A;  3FL2 A;  3ZNI A;  4AUQ B;  2G6Q A;  3O36 A;  3N9L A;  2VPD A;  2Y1M A;  3EB5 A;  2LAU A;  3FAO A;  2XP0 A;  5TDW A;  2CRW A;  1D0J A;  1LB4 A;  2YUR A;  2MT5 A;  4GJH A;  4R2Y A;  5FEY A;  2PUY A;  3MQS C;  2YU4 A;  3ZVZ B;  2EOD A;  2XXN A;  2CKL B;  4PTB A;  5SVY A;  2UZG A;  4TKP B;  1Z6U A;  4A4C A;  4ZUX U;  4GND A;  5LKT A;  4S3O C;  3QZV A;  2KR4 A;  2VPE A;  3C6W A;  3Q1D A;  1WEQ A;  2F6N A;  2FUI A;  3HU6 A;  2K16 A;  4C9Z A;  3L11 A;  1WES A;  1BOR A;  3LVQ E;  1FLL A;  1CA9 A;  4YBM A;  1E4U A;  2JMJ A;  2JMD A;  2GKW A;  2ECV A;  2KIZ A;  3IHP A;  4QF3 A;  4GNG A;  2KKX A;  2G43 A;  3LJU X;  2D8U A;  5SVI A;  2KGG A;  5G0F A;  3LQJ A;  5TRB A;  4M4E A;  2M6M A;  5H1V A;  4A0C D;  3L1Z B;  2MA5 A;  4GWN A;  2M13 A;  3O7A A;  3U5M A;  5I3L A;  4WZ3 B;  3PHD A;  4ZQL A;  4Z0O A;  3HSV A;  5AIU A;  3IVV A;  3FJU B;  4I7B A;  2QIZ A;  2HYE D;  2L5U A;  2MNZ A;  3SUB A;  1JM7 B;  5E1T A;  2KE1 A;  2BAY A;  2F1X A;  4JJQ A;  5FER A;  2QIC A;  5J3X A;  1X4I A;  2P57 A;  4N4F A;  4A4B A;  1WEW A;  5FB1 A;  2YQL A;  2MUM A;  3ASL A;  2YYR A;  2KYU A;  2EGM A;  4I7C A;  2E61 A;  3O35 A;  1CHC A;  2MD8 C;  4UP5 A;  3M63 A;  2AN6 A;  2FUU A;  2CR2 A;  1CZZ A;  2VJE B;  2RI7 A;  3N9O A;  1JM7 A;  4AYC B;  5C13 A;  1MBM A;  4CA1 A;  3FEH A;  4L58 A;  4V3L C;  2KFT A;  4ZDT A;  3HTK C;  2A25 A;  3RTR B;  2L80 A;  2I50 A;  1FP0 A; 
#chains in the Genus database with same CATH homology
 3NG2 A;  1KZZ A;  2FOJ A;  2KGI A;  3KNV A;  3HCS A;  3LRQ A;  4YSI A;  1X4U A;  3C5K A;  2IDA A;  5KH9 A;  1VFY A;  3VK6 A;  1WE9 A;  2VJE A;  2F1Y A;  5H9M A;  2MD7 B;  4R8P K;  4AYC A;  3MHS A;  2KWJ A;  2LQ6 A;  4S3O B;  3T6R A;  4UP0 A;  1FLK A;  4WZ0 A;  4PPE A;  3V43 A;  2K17 A;  2F6J A;  2M3H A;  2F1W A;  4UI9 B;  1LDJ B;  5EYA F;  3U5P A;  2LDR A;  3N9Q A;  5DKA A;  5G04 B;  2LN0 A;  4GNF A;  3IVQ A;  3HQI A;  3PUR A;  4V3K C;  1WGM A;  5D1L B;  2VP7 A;  2QJ0 A;  3MQR A;  1CZY A;  2E6R A;  3DPL R;  2K1J A;  2YW8 A;  4LKA A;  5DIN A;  1WIM A;  3SOU A;  3N9N A;  5D1K B;  2RSD A;  4A49 A;  1WEV A;  2Y1N A;  3GL6 A;  2XB1 A;  4F52 B;  2ECN A;  1F3V B;  3O34 A;  3MHH A;  1HYJ A;  4GHU A;  4NN2 A;  4AVX A;  4AP4 A;  2VNF A;  1WIL A;  1WEN A;  4YAD A;  2F1Z A;  1N87 A;  5B79 A;  4YBT A;  1YZE A;  4B86 C;  2NAA A;  3T7L A;  2VJF A;  2C2V S;  2KU3 A;  3RPG C;  2FOO A;  2K4D A;  1LB5 A;  3SHB A;  3ZPV 1;  1F62 A;  4N3W A;  2LV9 A;  2LXH C;  3HQL A;  5LKU A;  3HCT A;  2YT5 A;  1RF3 A;  1IYM A;  4LLB A;  5B76 A;  1ZBD B;  1D00 A;  2YHO A;  1Z2Q A;  4Q6F A;  2KWK A;  2YRE A;  2KRE A;  3O37 A;  2EGP A;  3L1X A;  1K2F A;  3DQV R;  3LQI A;  5KH3 A;  4YAB A;  3N9M A;  1Z60 A;  4YAX A;  1V87 A;  1JOC A;  4YAT A;  4LAD B;  2C2L A;  2LXP C;  5B75 A;  2CT2 A;  3PUQ A;  4O64 A;  5TAB A;  2L75 A;  3ZPV E;  1HYI A;  2ZET C;  3SOX A;  4O1V A;  1WEM A;  1WEE A;  1RMD A;  4MSX A;  3KV6 A;  1ZMS A;  3U5O A;  1G25 A;  1XWH A;  4Z8M A;  2MIQ A;  3M62 A;  2LGV A;  1WEP A;  4GB0 A;  2KWN A;  2YQM A;  2YHN A;  3U5N A;  5TDR A;  1DVP A;  4W4U A;  4KG9 A;  1WEO A;  2ECJ A;  5TBN A;  4P5O B;  5B78 A;  5KH7 A;  4FO9 A;  1D01 A;  3O70 A;  2JRJ A;  2ECW A;  2FSA A;  4YBS A;  2LRI C;  1D0A A;  2CSY A;  2ECG A;  2HDP A;  4QF2 A;  5B8D A;  2VPB A;  5LKZ A;  2VPG A;  4FIP A;  4BBQ A;  5LKX A;  3GV4 A;  2CSZ A;  5C11 A;  2LGG A;  3ZTG A;  1U6G B;  4IC3 A;  3ZYQ A;  1FBV A;  2YSJ A;  2VJF B;  4IC2 A;  5LCW B;  2OXQ C;  2CKL A;  2L0B A;  3KV5 A;  1CA4 A;  1LB6 A;  5H1T A;  5FB0 A;  4FK5 A;  3RPG B;  3O33 A;  4GNE A;  3SOW A;  2L43 A;  4LJN A;  4K8U A;  4MVT A;  4GWM A;  4WZ2 A;  3KQI A;  4R7E A;  3HCU A;  4I7D A;  4L7X A;  2DX8 A;  5H1U A;  2YSM A;  3M99 A;  1YY6 A;  2ECT A;  4FJC A;  4XI1 A;  4X3G A;  3HQM A;  2MNY A;  2ECI A;  2KWO A;  3N9P A;  1T1H A;  3I2D A;  2XEU A;  3EB6 A;  2H0D B;  1LDK C;  3LQH A;  2D8S A;  2LGK A;  1VYX A;  2YUC A;  5B77 A;  5JG6 A;  2EA6 A;  3ZJB A;  4CCG X;  4B7Y C;  3HQH A;  5G05 B;  1MM2 A;  1QSC A;  2LGL A;  1MM3 A;  2M1R A;  4LK9 A;  1VD4 A;  1WEU A;  5AIT A;  4YC9 A;  2JMI A;  2PNX A;  3ZVY A;  2H0D A;  2E6S A;  5D1M B;  1X4J A;  4BHW A;  2M85 A;  4WA6 A;  2Y43 A;  2G45 A;  1L0A A;  1WFK A;  2F42 A;  2FOP A;  2MA6 A;  3IVB A;  3FL2 A;  3ZNI A;  4AUQ B;  2G6Q A;  3O36 A;  3N9L A;  2VPD A;  2Y1M A;  3EB5 A;  5TDW A;  1D0J A;  1LB4 A;  2YUR A;  2MT5 A;  4GJH A;  4R2Y A;  5FEY A;  2PUY A;  3MQS C;  2YU4 A;  3ZVZ B;  2EOD A;  2XXN A;  2CKL B;  4PTB A;  2UZG A;  4TKP B;  1Z6U A;  4A4C A;  4ZUX U;  4GND A;  5LKT A;  4S3O C;  3QZV A;  2KR4 A;  2VPE A;  3C6W A;  1WEQ A;  2F6N A;  2FUI A;  3HU6 A;  2K16 A;  4C9Z A;  3L11 A;  1WES A;  1BOR A;  1FLL A;  1CA9 A;  4YBM A;  1E4U A;  2JMJ A;  2JMD A;  2GKW A;  2ECV A;  2KIZ A;  3IHP A;  4QF3 A;  4GNG A;  2G43 A;  2KGG A;  5G0F A;  3LQJ A;  5TRB A;  4M4E A;  2M6M A;  5H1V A;  4A0C D;  3L1Z B;  2MA5 A;  4GWN A;  3O7A A;  3U5M A;  5I3L A;  4WZ3 B;  3PHD A;  4ZQL A;  3HSV A;  5AIU A;  3IVV A;  4I7B A;  2QIZ A;  2HYE D;  2L5U A;  2MNZ A;  1JM7 B;  5E1T A;  2KE1 A;  2BAY A;  2F1X A;  4JJQ A;  5FER A;  2QIC A;  5J3X A;  1X4I A;  4N4F A;  4A4B A;  1WEW A;  5FB1 A;  2YQL A;  2MUM A;  3ASL A;  2YYR A;  2KYU A;  4I7C A;  3O35 A;  2MD8 C;  1CHC A;  4UP5 A;  3M63 A;  2AN6 A;  2FUU A;  2CR2 A;  1CZZ A;  2VJE B;  2RI7 A;  3N9O A;  1JM7 A;  4AYC B;  5C13 A;  4CA1 A;  4L58 A;  4V3L C;  2KFT A;  4ZDT A;  3HTK C;  2A25 A;  3RTR B;  2L80 A;  2I50 A;  1FP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...