5H9MA

Crystal structure of siah2 sbd domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
190
structure length
190
Chain Sequence
SAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTIST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SIAH2
publication title Crystal structure of siah2 SBD domain
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 45
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 5h9mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h9mA01
2FOOA 1ZBDB 2MT5A 2ECVA 2JMDA 2VNFA 3LQJA 5LKZA 2QJ0A 5B78A 1U6GB 5TDRA 3HQIA 2L5UA 2KGGA 2ZETC 2A25A 2EODA 1X4IA 2ECWA 3M99A 2L80A 2F1XA 3PUQA 2FUIA 2YQLA 4R8PK 3O34A 3MQRA 4AP4A 3KQIA 3NG2A 3GV4A 3IVQA 2KFTA 4YABA 4MVTA 3O33A 2ECTA 3ZNIA 1FLLA 2VJEB 2VPBA 3U5PA 2BAYA 3V43A 4R7EA 3IHPA 2I50A 5D1KB 5G04B 2KYUA 4YADA 5TDWA 4AYCA 3M62A 2GKWA 4GWNA 1QSCA 3U5NA 1ZMSA 4BHWA 2KR4A 2F6JA 2KWOA 3HCSA 3ZTGA 1WFKA 4PPEA 2C2VS 2YSMA 1YZEA 2KWJA 1X4UA 4WZ3B 1CA4A 1WGMA 1WEMA 2E6SA 2KWKA 3DPLR 2RI7A 2JMJA 4YBTA 2LGKA 2Y43A 3I2DA 1Z2QA 2LGLA 2LV9A 2K1JA 5TABA 2YHOA 2MD8C 2YUCA 1WILA 2YU4A 3L1ZB 2M6MA 5G0FA 2G45A 3U5OA 2MA6A 5LKXA 1IYMA 3ZPVE 5FERA 4F52B 5B75A 4YAXA 2ECNA 1WE9A 2CT2A 1WEQA 4ZDTA 3N9LA 2FUUA 4FK5A 2RSDA 2K17A 3KNVA 4LK9A 4BBQA 2MUMA 1FLKA 3O37A 4L7XA 5B79A 4MSXA 3SOWA 4N3WA 4V3LC 1WEOA 1CHCA 4NN2A 4QF2A 1BORA 4GNEA 2LN0A 4K8UA 5H9MA 4YSIA 2YW8A 3QZVA 5G05B 4UI9B 3HSVA 4KG9A 1F62A 3KV5A 3SOXA 3T7LA 2M3HA 3SHBA 1JM7A 2YYRA 4YC9A 2L0BA 5D1LB 1MM2A 3L11A 5H1VA 1X4JA 5J3XA 5B76A 5DINA 2ECGA 2PNXA 1MM3A 2CKLA 2LRIC 3O7AA 2VJFA 4V3KC 1WEVA 2KREA 3HQLA 4O64A 2H0DB 4AVXA 5B77A 2VPEA 4LJNA 4A4CA 5AITA 2YURA 2QIZA 4LADB 2KIZA 2IDAA 3LQIA 3T6RA 5TBNA 5H1TA 2MNYA 5I3LA 5KH3A 3FL2A 2FSAA 2M85A 2JRJA 3ZVZB 4PTBA 2E6RA 2LGGA 2KU3A 4LKAA 1CZZA 4A0CD 1KZZA 1D01A 2CSYA 3MHHA 1D0JA 2FOJA 5H1UA 1F3VB 5LKUA 1LB5A 1WENA 2CR2A 2F1YA 4WZ2A 4UP0A 3HU6A 3O70A 4WZ0A 2HYED 2Y1NA 5DKAA 2XEUA 2MIQA 2D8SA 4S3OC 2F6NA 4GJHA 4S3OB 5EYAF 4GNDA 2QICA 3N9NA 3SOUA 4I7DA 4GHUA 4QF3A 1E4UA 2YREA 4FO9A 1VD4A 3N9PA 3HTKC 1Z60A 4X3GA 2YQMA 1LB4A 3ZYQA 2MNZA 3IVVA 1DVPA 5KH9A 2L43A 4AYCB 2CSZA 4FJCA 4O1VA 1L0AA 3MQSC 4C9ZA 1WESA 4CCGX 1RF3A 2LGVA 2K4DA 2OXQC 2VPGA 4YBMA 1XWHA 4YBSA 1WIMA 4W4UA 2ECIA 2DX8A 2AN6A 3KV6A 5FB0A 5AIUA 1D0AA 3RPGC 2NAAA 2FOPA 2Y1MA 1VFYA 3C6WA 3RPGB 2VJEA 4CA1A 4A4BA 5C13A 2LDRA 4I7CA 2VP7A 2LXHC 5D1MB 5LKTA 4LLBA 3VK6A 4GWMA 4FIPA 2EA6A 1HYIA 1K2FA 2YHNA 4IC3A 3IVBA 1LDJB 2G6QA 4B86C 2VPDA 1V87A 2XXNA 2EGPA 2K16A 4GB0A 4N4FA 1RMDA 2G43A 4P5OB 3U5MA 3EB6A 1FP0A 5TRBA 3LQHA 4WA6A 1Z6UA 4A49A 5JG6A 1JM7B 3N9MA 2LXPC 3O35A 5C11A 2L75A 2JMIA 1CA9A 2M1RA 3EB5A 4YATA 2CKLB 3DQVR 2VJFB 3N9OA 4B7YC 2PUYA 3M63A 1LB6A 3GL6A 4M4EA 2YSJA 3MHSA 4JJQA 1D00A 1YY6A 3HCUA 2YT5A 1WEEA 5FB1A 5KH7A 1FBVA 5FEYA 2HDPA 2UZGA 3HQMA 4L58A 4Q6FA 2LQ6A 3PHDA 4GNFA 3HCTA 4TKPB 3ZPV1 2XB1A 1WEUA 3ZVYA 2C2LA 1CZYA 2KWNA 3L1XA 3N9QA 4ZQLA 3RTRB 3ASLA 4R2YA 2F1ZA 2KE1A 2MD7B 3PURA 2H0DA 1G25A 3C5KA 5B8DA 3ZJBA 3HQHA 1JOCA 3O36A 1N87A 3LRQA 4GNGA 5LCWB 4UP5A 1WEWA 4XI1A 2MA5A 4ZUXU 4Z8MA 1WEPA 1HYJA 4I7BA 2F42A 1VYXA 2F1WA 1LDKC 1T1HA 4IC2A 5E1TA 2KGIA 4AUQB 2ECJA
chains in the Genus database with same CATH superfamily
2FOOA 1ZBDB 2MT5A 2ECVA 2JMDA 2VNFA 3LQJA 5LKZA 2QJ0A 5B78A 1U6GB 5TDRA 3HQIA 2L5UA 2KGGA 2ZETC 2DSMA 2A25A 2EODA 1X4IA 2CRWA 2ECWA 3M99A 2L80A 4Z0RA 2F1XA 3PUQA 4F1PA 2FUIA 2YQLA 4R8PK 3O34A 3MQRA 4AP4A 3KQIA 3NG2A 3GV4A 3FEHA 3IVQA 2KFTA 4YABA 4MVTA 3O33A 2ECTA 3FJUB 1FLLA 3ZNIA 2VJEB 5SVXA 2VPBA 3U5PA 2BAYA 2CONA 4R7EA 3V43A 3IHPA 2I50A 5D1KB 5G04B 2KYUA 2M13A 3DDTA 4YADA 5TDWA 4AYCA 3M62A 2GKWA 4GWNA 3PLWA 1QSCA 3U5NA 1ZMSA 4BHWA 2KR4A 2F6JA 2KWOA 3HCSA 3ZTGA 1WFKA 4PPEA 2C2VS 2YSMA 1YZEA 2KWJA 1X4UA 4WZ3B 1CA4A 3DWDA 1WGMA 1WEMA 2E6SA 2KWKA 3DPLR 2RI7A 2JMJA 4YBTA 2LGKA 2Y43A 3I2DA 1Z2QA 2LGLA 2LV9A 2K1JA 5TABA 2YHOA 4QQ4A 2MD8C 2YUCA 3LDYA 1WILA 2YU4A 3L1ZB 2M6MA 5G0FA 2G45A 3U5OA 2MA6A 5LKXA 1IYMA 3ZPVE 5FERA 4F52B 5B75A 4YAXA 3T9KA 2ECNA 1WE9A 2CT2A 1WEQA 4ZDTA 3N9LA 4OGEA 2FUUA 4FK5A 2RSDA 2K17A 2JUNA 3KNVA 1MBMA 4LK9A 4BBQA 3H7HA 2KKYA 2KKXA 2MUMA 2P57A 5K3QA 1FLKA 3O37A 4L7XA 5B79A 4MSXA 3SOWA 3FAOA 4N3WA 4V3LC 1WEOA 1CHCA 4NN2A 4QF2A 1BORA 4GNEA 2LN0A 4K8UA 5H9MA 4YSIA 2YW8A 3QZVA 5G05B 4UI9B 3HSVA 4KG9A 1F62A 3KV5A 3SOXA 3T7LA 2M3HA 3SHBA 1JM7A 2YYRA 4YC9A 2L0BA 5D1LB 1MM2A 3L11A 5H1VA 1X4JA 5J3XA 5B76A 2OWAA 5DINA 2ECGA 2PNXA 1MM3A 2CKLA 2LRIC 3O7AA 2VJFA 4V3KC 5SVIB 1WEVA 2KREA 3HQLA 4O64A 2H0DB 4AVXA 5B77A 2VPEA 4LJNA 4A4CA 2RR4A 5AITA 2YURA 2QIZA 4H9DA 3LQIA 2KIZA 2IDAA 3FM8C 4LADB 3T6RA 5TBNA 5H1TA 2MNYA 5I3LA 5KH3A 2FD4A 3FL2A 2E61A 2FSAA 2M85A 2JRJA 3ZVZB 4PTBA 2E6RA 2LGGA 2XOYA 2KU3A 2JM3A 4LKAA 1CZZA 4A0CD 1KZZA 1D01A 3KDEC 2CSYA 3MHHA 1D0JA 2FOJA 5H1UA 1F3VB 5LKUA 1LB5A 1WENA 2CR2A 2XOCA 2CSVA 2F1YA 4WZ2A 4O62A 3HU6A 4UP0A 3O70A 4WZ0A 2HYED 2Y1NA 5DKAA 2XEUA 2MIQA 2D8SA 4S3OC 2F6NA 4GJHA 4S3OB 2CRRA 5EYAF 4GNDA 2QICA 3N9NA 2DJAA 2L7PA 3Q1DA 3SOUA 4I7DA 4GHUA 4QF3A 1E4UA 2B0OE 2YREA 3O47A 4FO9A 1VD4A 3N9PA 3HTKC 1Z60A 4X3GA 2YQMA 1LB4A 3ZYQA 2MNZA 3IVVA 1DVPA 5KH9A 2L43A 4AYCB 2CSZA 1DCQA 4FJCA 4O1VA 1L0AA 3LVRE 3SUBA 3MQSC 4C9ZA 1WESA 4CCGX 1RF3A 2LGVA 2K4DA 2OXQC 2VPGA 4YBMA 1XWHA 4YBSA 1WIMA 4W4UA 2ECIA 2DX8A 2AN6A 3KV6A 5SVYA 5FB0A 5AIUA 1D0AA 3RPGC 2NAAA 2FOPA 2Y1MA 1VFYA 3C6WA 3RPGB 2VJEA 4CA1A 2YVRA 3LJUX 4A4BA 2XP0A 5C13A 4OGCA 2LDRA 4I7CA 2VP7A 3JUEA 2EGMA 2LXHC 5D1MB 5LKTA 4LLBA 3VK6A 4GWMA 4FIPA 2EA6A 3LVQE 1HYIA 1K2FA 2YHNA 4IC3A 3IVBA 1LDJB 2G6QA 4B86C 2VPDA 1V87A 2XXNA 2EGPA 2K16A 4GB0A 4N4FA 1RMDA 2G43A 4P5OB 3U5MA 3EB6A 1FP0A 5TRBA 3LQHA 4WA6A 1Z6UA 4A49A 5JG6A 1JM7B 3N9MA 2LXPC 3O35A 5C11A 2L75A 2EXUA 2JMIA 1CA9A 2M1RA 3EB5A 4YATA 2CKLB 3DQVR 2VJFB 3N9OA 4B7YC 2PUYA 3M63A 3E2DA 1LB6A 3GL6A 4M4EA 2YSJA 3MHSA 4JJQA 1D00A 1YY6A 3HCUA 2YT5A 1WEEA 3FANA 5FB1A 5KH7A 2IQJA 2LAUA 3MDBC 1FBVA 5FEYA 2HDPA 2UZGA 3HQMA 4L58A 3M7KA 4Q6FA 2LQ6A 2D8UA 3PHDA 4GNFA 3HCTA 4TKPB 3ZPV1 2XB1A 1WEUA 3ZVYA 2C2LA 1CZYA 2KWNA 3L1XA 3N9QA 4ZQLA 5SVIA 3RTRB 4Z0OA 3ASLA 4R2YA 2F1ZA 2KE1A 2MD7B 3PURA 2H0DA 1G25A 3C5KA 2XOZA 5B8DA 3ZJBA 3HQHA 1JOCA 3O36A 1N87A 3LRQA 4GNGA 5LCWB 4UP5A 1WEWA 4XI1A 2MA5A 4ZUXU 4Z8MA 1WEPA 1HYJA 4I7BA 2F42A 2MKEA 1VYXA 2F1WA 1LDKC 1T1HA 4IC2A 5E1TA 2KGIA 2FFWA 4AUQB 2ECJA
chains in the Genus database with same CATH topology
2FOOA 1ZBDB 2MT5A 2ECVA 2JMDA 2VNFA 3LQJA 5LKZA 2QJ0A 5B78A 1U6GB 5TDRA 3HQIA 2L5UA 2KGGA 2ZETC 2A25A 2EODA 1X4IA 2ECWA 3M99A 2L80A 2F1XA 3PUQA 2FUIA 2YQLA 4R8PK 3O34A 3MQRA 4AP4A 3KQIA 3NG2A 3GV4A 3IVQA 2KFTA 4YABA 4MVTA 3O33A 2ECTA 3ZNIA 1FLLA 2VJEB 2VPBA 3U5PA 2BAYA 3V43A 4R7EA 3IHPA 2I50A 5D1KB 5G04B 2KYUA 4YADA 5TDWA 4AYCA 3M62A 2GKWA 4GWNA 1QSCA 3U5NA 1ZMSA 4BHWA 2KR4A 2F6JA 2KWOA 3HCSA 3ZTGA 1WFKA 4PPEA 2C2VS 2YSMA 1YZEA 2KWJA 1X4UA 4WZ3B 1CA4A 1WGMA 1WEMA 2E6SA 2KWKA 3DPLR 2RI7A 2JMJA 4YBTA 2LGKA 2Y43A 3I2DA 1Z2QA 2LGLA 2LV9A 2K1JA 5TABA 2YHOA 2MD8C 2YUCA 1WILA 2YU4A 3L1ZB 2M6MA 5G0FA 2G45A 3U5OA 2MA6A 5LKXA 1IYMA 3ZPVE 5FERA 4F52B 5B75A 4YAXA 2ECNA 1WE9A 2CT2A 1WEQA 4ZDTA 3N9LA 2FUUA 4FK5A 2RSDA 2K17A 3KNVA 4LK9A 4BBQA 2MUMA 1FLKA 3O37A 4L7XA 5B79A 4MSXA 3SOWA 4N3WA 4V3LC 1WEOA 1CHCA 4NN2A 4QF2A 1BORA 4GNEA 2LN0A 4K8UA 5H9MA 4YSIA 2YW8A 3QZVA 5G05B 4UI9B 3HSVA 4KG9A 1F62A 3KV5A 3SOXA 3T7LA 2M3HA 3SHBA 1JM7A 2YYRA 4YC9A 2L0BA 5D1LB 1MM2A 3L11A 5H1VA 1X4JA 5J3XA 5B76A 5DINA 2ECGA 2PNXA 1MM3A 2CKLA 2LRIC 3O7AA 2VJFA 4V3KC 1WEVA 2KREA 3HQLA 4O64A 2H0DB 4AVXA 5B77A 2VPEA 4LJNA 4A4CA 5AITA 2YURA 2QIZA 4LADB 2KIZA 2IDAA 3LQIA 3T6RA 5TBNA 5H1TA 2MNYA 5I3LA 5KH3A 3FL2A 2FSAA 2M85A 2JRJA 3ZVZB 4PTBA 2E6RA 2LGGA 2KU3A 4LKAA 1CZZA 4A0CD 1KZZA 1D01A 2CSYA 3MHHA 1D0JA 2FOJA 5H1UA 1F3VB 5LKUA 1LB5A 1WENA 2CR2A 2F1YA 4WZ2A 4UP0A 3HU6A 3O70A 4WZ0A 2HYED 2Y1NA 5DKAA 2XEUA 2MIQA 2D8SA 4S3OC 2F6NA 4GJHA 4S3OB 5EYAF 4GNDA 2QICA 3N9NA 3SOUA 4I7DA 4GHUA 4QF3A 1E4UA 2YREA 4FO9A 1VD4A 3N9PA 3HTKC 1Z60A 4X3GA 2YQMA 1LB4A 3ZYQA 2MNZA 3IVVA 1DVPA 5KH9A 2L43A 4AYCB 2CSZA 4FJCA 4O1VA 1L0AA 3MQSC 4C9ZA 1WESA 4CCGX 1RF3A 2LGVA 2K4DA 2OXQC 2VPGA 4YBMA 1XWHA 4YBSA 1WIMA 4W4UA 2ECIA 2DX8A 2AN6A 3KV6A 5FB0A 5AIUA 1D0AA 3RPGC 2NAAA 2FOPA 2Y1MA 1VFYA 3C6WA 3RPGB 2VJEA 4CA1A 4A4BA 5C13A 2LDRA 4I7CA 2VP7A 2LXHC 5D1MB 5LKTA 4LLBA 3VK6A 4GWMA 4FIPA 2EA6A 1HYIA 1K2FA 2YHNA 4IC3A 3IVBA 1LDJB 2G6QA 4B86C 2VPDA 1V87A 2XXNA 2EGPA 2K16A 4GB0A 4N4FA 1RMDA 2G43A 4P5OB 3U5MA 3EB6A 1FP0A 5TRBA 3LQHA 4WA6A 1Z6UA 4A49A 5JG6A 1JM7B 3N9MA 2LXPC 3O35A 5C11A 2L75A 2JMIA 1CA9A 2M1RA 3EB5A 4YATA 2CKLB 3DQVR 2VJFB 3N9OA 4B7YC 2PUYA 3M63A 1LB6A 3GL6A 4M4EA 2YSJA 3MHSA 4JJQA 1D00A 1YY6A 3HCUA 2YT5A 1WEEA 5FB1A 5KH7A 1FBVA 5FEYA 2HDPA 2UZGA 3HQMA 4L58A 4Q6FA 2LQ6A 3PHDA 4GNFA 3HCTA 4TKPB 3ZPV1 2XB1A 1WEUA 3ZVYA 2C2LA 1CZYA 2KWNA 3L1XA 3N9QA 4ZQLA 3RTRB 3ASLA 4R2YA 2F1ZA 2KE1A 2MD7B 3PURA 2H0DA 1G25A 3C5KA 5B8DA 3ZJBA 3HQHA 1JOCA 3O36A 1N87A 3LRQA 4GNGA 5LCWB 4UP5A 1WEWA 4XI1A 2MA5A 4ZUXU 4Z8MA 1WEPA 1HYJA 4I7BA 2F42A 1VYXA 2F1WA 1LDKC 1T1HA 4IC2A 5E1TA 2KGIA 4AUQB 2ECJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOO A;  1ZBD B;  2MT5 A;  2ECV A;  2JMD A;  2VNF A;  3LQJ A;  5LKZ A;  2QJ0 A;  5B78 A;  1U6G B;  5TDR A;  3HQI A;  2L5U A;  2KGG A;  2ZET C;  2A25 A;  2EOD A;  1X4I A;  2ECW A;  3M99 A;  2L80 A;  2F1X A;  3PUQ A;  2FUI A;  2YQL A;  4R8P K;  3O34 A;  3MQR A;  4AP4 A;  3KQI A;  3NG2 A;  3GV4 A;  3IVQ A;  2KFT A;  4YAB A;  4MVT A;  3O33 A;  2ECT A;  3ZNI A;  1FLL A;  2VJE B;  2VPB A;  3U5P A;  2BAY A;  3V43 A;  4R7E A;  3IHP A;  2I50 A;  5D1K B;  5G04 B;  2KYU A;  4YAD A;  5TDW A;  4AYC A;  3M62 A;  2GKW A;  4GWN A;  1QSC A;  3U5N A;  1ZMS A;  4BHW A;  2KR4 A;  2F6J A;  2KWO A;  3HCS A;  3ZTG A;  1WFK A;  4PPE A;  2C2V S;  2YSM A;  1YZE A;  2KWJ A;  1X4U A;  4WZ3 B;  1CA4 A;  1WGM A;  1WEM A;  2E6S A;  2KWK A;  3DPL R;  2RI7 A;  2JMJ A;  4YBT A;  2LGK A;  2Y43 A;  3I2D A;  1Z2Q A;  2LGL A;  2LV9 A;  2K1J A;  5TAB A;  2YHO A;  2MD8 C;  2YUC A;  1WIL A;  2YU4 A;  3L1Z B;  2M6M A;  5G0F A;  2G45 A;  3U5O A;  2MA6 A;  5LKX A;  1IYM A;  3ZPV E;  5FER A;  4F52 B;  5B75 A;  4YAX A;  2ECN A;  1WE9 A;  2CT2 A;  1WEQ A;  4ZDT A;  3N9L A;  2FUU A;  4FK5 A;  2RSD A;  2K17 A;  3KNV A;  4LK9 A;  4BBQ A;  2MUM A;  1FLK A;  3O37 A;  4L7X A;  5B79 A;  4MSX A;  3SOW A;  4N3W A;  4V3L C;  1WEO A;  1CHC A;  4NN2 A;  4QF2 A;  1BOR A;  4GNE A;  2LN0 A;  4K8U A;  5H9M A;  4YSI A;  2YW8 A;  3QZV A;  5G05 B;  4UI9 B;  3HSV A;  4KG9 A;  1F62 A;  3KV5 A;  3SOX A;  3T7L A;  2M3H A;  3SHB A;  1JM7 A;  2YYR A;  4YC9 A;  2L0B A;  5D1L B;  1MM2 A;  3L11 A;  5H1V A;  1X4J A;  5J3X A;  5B76 A;  5DIN A;  2ECG A;  2PNX A;  1MM3 A;  2CKL A;  2LRI C;  3O7A A;  2VJF A;  4V3K C;  1WEV A;  2KRE A;  3HQL A;  4O64 A;  2H0D B;  4AVX A;  5B77 A;  2VPE A;  4LJN A;  4A4C A;  5AIT A;  2YUR A;  2QIZ A;  4LAD B;  2KIZ A;  2IDA A;  3LQI A;  3T6R A;  5TBN A;  5H1T A;  2MNY A;  5I3L A;  5KH3 A;  3FL2 A;  2FSA A;  2M85 A;  2JRJ A;  3ZVZ B;  4PTB A;  2E6R A;  2LGG A;  2KU3 A;  4LKA A;  1CZZ A;  4A0C D;  1KZZ A;  1D01 A;  2CSY A;  3MHH A;  1D0J A;  2FOJ A;  5H1U A;  1F3V B;  5LKU A;  1LB5 A;  1WEN A;  2CR2 A;  2F1Y A;  4WZ2 A;  4UP0 A;  3HU6 A;  3O70 A;  4WZ0 A;  2HYE D;  2Y1N A;  5DKA A;  2XEU A;  2MIQ A;  2D8S A;  4S3O C;  2F6N A;  4GJH A;  4S3O B;  5EYA F;  4GND A;  2QIC A;  3N9N A;  3SOU A;  4I7D A;  4GHU A;  4QF3 A;  1E4U A;  2YRE A;  4FO9 A;  1VD4 A;  3N9P A;  3HTK C;  1Z60 A;  4X3G A;  2YQM A;  1LB4 A;  3ZYQ A;  2MNZ A;  3IVV A;  1DVP A;  5KH9 A;  2L43 A;  4AYC B;  2CSZ A;  4FJC A;  4O1V A;  1L0A A;  3MQS C;  4C9Z A;  1WES A;  4CCG X;  1RF3 A;  2LGV A;  2K4D A;  2OXQ C;  2VPG A;  4YBM A;  1XWH A;  4YBS A;  1WIM A;  4W4U A;  2ECI A;  2DX8 A;  2AN6 A;  3KV6 A;  5FB0 A;  5AIU A;  1D0A A;  3RPG C;  2NAA A;  2FOP A;  2Y1M A;  1VFY A;  3C6W A;  3RPG B;  2VJE A;  4CA1 A;  4A4B A;  5C13 A;  2LDR A;  4I7C A;  2VP7 A;  2LXH C;  5D1M B;  5LKT A;  4LLB A;  3VK6 A;  4GWM A;  4FIP A;  2EA6 A;  1HYI A;  1K2F A;  2YHN A;  4IC3 A;  3IVB A;  1LDJ B;  2G6Q A;  4B86 C;  2VPD A;  1V87 A;  2XXN A;  2EGP A;  2K16 A;  4GB0 A;  4N4F A;  1RMD A;  2G43 A;  4P5O B;  3U5M A;  3EB6 A;  1FP0 A;  5TRB A;  3LQH A;  4WA6 A;  1Z6U A;  4A49 A;  5JG6 A;  1JM7 B;  3N9M A;  2LXP C;  3O35 A;  5C11 A;  2L75 A;  2JMI A;  1CA9 A;  2M1R A;  3EB5 A;  4YAT A;  2CKL B;  3DQV R;  2VJF B;  3N9O A;  4B7Y C;  2PUY A;  3M63 A;  1LB6 A;  3GL6 A;  4M4E A;  2YSJ A;  3MHS A;  4JJQ A;  1D00 A;  1YY6 A;  3HCU A;  2YT5 A;  1WEE A;  5FB1 A;  5KH7 A;  1FBV A;  5FEY A;  2HDP A;  2UZG A;  3HQM A;  4L58 A;  4Q6F A;  2LQ6 A;  3PHD A;  4GNF A;  3HCT A;  4TKP B;  3ZPV 1;  2XB1 A;  1WEU A;  3ZVY A;  2C2L A;  1CZY A;  2KWN A;  3L1X A;  3N9Q A;  4ZQL A;  3RTR B;  3ASL A;  4R2Y A;  2F1Z A;  2KE1 A;  2MD7 B;  3PUR A;  2H0D A;  1G25 A;  3C5K A;  5B8D A;  3ZJB A;  3HQH A;  1JOC A;  3O36 A;  1N87 A;  3LRQ A;  4GNG A;  5LCW B;  4UP5 A;  1WEW A;  4XI1 A;  2MA5 A;  4ZUX U;  4Z8M A;  1WEP A;  1HYJ A;  4I7B A;  2F42 A;  1VYX A;  2F1W A;  1LDK C;  1T1H A;  4IC2 A;  5E1T A;  2KGI A;  4AUQ B;  2ECJ A; 
#chains in the Genus database with same CATH topology
 2FOO A;  1ZBD B;  2MT5 A;  2ECV A;  2JMD A;  2VNF A;  3LQJ A;  5LKZ A;  2QJ0 A;  5B78 A;  1U6G B;  5TDR A;  3HQI A;  2L5U A;  2KGG A;  2ZET C;  2DSM A;  2A25 A;  2EOD A;  1X4I A;  2CRW A;  2ECW A;  3M99 A;  2L80 A;  4Z0R A;  2F1X A;  3PUQ A;  4F1P A;  2FUI A;  2YQL A;  4R8P K;  3O34 A;  3MQR A;  4AP4 A;  3KQI A;  3NG2 A;  3GV4 A;  3FEH A;  3IVQ A;  2KFT A;  4YAB A;  4MVT A;  3O33 A;  2ECT A;  3FJU B;  1FLL A;  3ZNI A;  2VJE B;  5SVX A;  2VPB A;  3U5P A;  2BAY A;  2CON A;  4R7E A;  3V43 A;  3IHP A;  2I50 A;  5D1K B;  5G04 B;  2KYU A;  2M13 A;  3DDT A;  4YAD A;  5TDW A;  4AYC A;  3M62 A;  2GKW A;  4GWN A;  3PLW A;  1QSC A;  3U5N A;  1ZMS A;  4BHW A;  2KR4 A;  2F6J A;  2KWO A;  3HCS A;  3ZTG A;  1WFK A;  4PPE A;  2C2V S;  2YSM A;  1YZE A;  2KWJ A;  1X4U A;  4WZ3 B;  1CA4 A;  3DWD A;  1WGM A;  1WEM A;  2E6S A;  2KWK A;  3DPL R;  2RI7 A;  2JMJ A;  4YBT A;  2LGK A;  2Y43 A;  3I2D A;  1Z2Q A;  2LGL A;  2LV9 A;  2K1J A;  5TAB A;  2YHO A;  4QQ4 A;  2MD8 C;  2YUC A;  3LDY A;  1WIL A;  2YU4 A;  3L1Z B;  2M6M A;  5G0F A;  2G45 A;  3U5O A;  2MA6 A;  5LKX A;  1IYM A;  3ZPV E;  5FER A;  4F52 B;  5B75 A;  4YAX A;  3T9K A;  2ECN A;  1WE9 A;  2CT2 A;  1WEQ A;  4ZDT A;  3N9L A;  4OGE A;  2FUU A;  4FK5 A;  2RSD A;  2K17 A;  2JUN A;  3KNV A;  1MBM A;  4LK9 A;  4BBQ A;  3H7H A;  2KKY A;  2KKX A;  2MUM A;  2P57 A;  5K3Q A;  1FLK A;  3O37 A;  4L7X A;  5B79 A;  4MSX A;  3SOW A;  3FAO A;  4N3W A;  4V3L C;  1WEO A;  1CHC A;  4NN2 A;  4QF2 A;  1BOR A;  4GNE A;  2LN0 A;  4K8U A;  5H9M A;  4YSI A;  2YW8 A;  3QZV A;  5G05 B;  4UI9 B;  3HSV A;  4KG9 A;  1F62 A;  3KV5 A;  3SOX A;  3T7L A;  2M3H A;  3SHB A;  1JM7 A;  2YYR A;  4YC9 A;  2L0B A;  5D1L B;  1MM2 A;  3L11 A;  5H1V A;  1X4J A;  5J3X A;  5B76 A;  2OWA A;  5DIN A;  2ECG A;  2PNX A;  1MM3 A;  2CKL A;  2LRI C;  3O7A A;  2VJF A;  4V3K C;  5SVI B;  1WEV A;  2KRE A;  3HQL A;  4O64 A;  2H0D B;  4AVX A;  5B77 A;  2VPE A;  4LJN A;  4A4C A;  2RR4 A;  5AIT A;  2YUR A;  2QIZ A;  4H9D A;  3LQI A;  2KIZ A;  2IDA A;  3FM8 C;  4LAD B;  3T6R A;  5TBN A;  5H1T A;  2MNY A;  5I3L A;  5KH3 A;  2FD4 A;  3FL2 A;  2E61 A;  2FSA A;  2M85 A;  2JRJ A;  3ZVZ B;  4PTB A;  2E6R A;  2LGG A;  2XOY A;  2KU3 A;  2JM3 A;  4LKA A;  1CZZ A;  4A0C D;  1KZZ A;  1D01 A;  3KDE C;  2CSY A;  3MHH A;  1D0J A;  2FOJ A;  5H1U A;  1F3V B;  5LKU A;  1LB5 A;  1WEN A;  2CR2 A;  2XOC A;  2CSV A;  2F1Y A;  4WZ2 A;  4O62 A;  3HU6 A;  4UP0 A;  3O70 A;  4WZ0 A;  2HYE D;  2Y1N A;  5DKA A;  2XEU A;  2MIQ A;  2D8S A;  4S3O C;  2F6N A;  4GJH A;  4S3O B;  2CRR A;  5EYA F;  4GND A;  2QIC A;  3N9N A;  2DJA A;  2L7P A;  3Q1D A;  3SOU A;  4I7D A;  4GHU A;  4QF3 A;  1E4U A;  2B0O E;  2YRE A;  3O47 A;  4FO9 A;  1VD4 A;  3N9P A;  3HTK C;  1Z60 A;  4X3G A;  2YQM A;  1LB4 A;  3ZYQ A;  2MNZ A;  3IVV A;  1DVP A;  5KH9 A;  2L43 A;  4AYC B;  2CSZ A;  1DCQ A;  4FJC A;  4O1V A;  1L0A A;  3LVR E;  3SUB A;  3MQS C;  4C9Z A;  1WES A;  4CCG X;  1RF3 A;  2LGV A;  2K4D A;  2OXQ C;  2VPG A;  4YBM A;  1XWH A;  4YBS A;  1WIM A;  4W4U A;  2ECI A;  2DX8 A;  2AN6 A;  3KV6 A;  5SVY A;  5FB0 A;  5AIU A;  1D0A A;  3RPG C;  2NAA A;  2FOP A;  2Y1M A;  1VFY A;  3C6W A;  3RPG B;  2VJE A;  4CA1 A;  2YVR A;  3LJU X;  4A4B A;  2XP0 A;  5C13 A;  4OGC A;  2LDR A;  4I7C A;  2VP7 A;  3JUE A;  2EGM A;  2LXH C;  5D1M B;  5LKT A;  4LLB A;  3VK6 A;  4GWM A;  4FIP A;  2EA6 A;  3LVQ E;  1HYI A;  1K2F A;  2YHN A;  4IC3 A;  3IVB A;  1LDJ B;  2G6Q A;  4B86 C;  2VPD A;  1V87 A;  2XXN A;  2EGP A;  2K16 A;  4GB0 A;  4N4F A;  1RMD A;  2G43 A;  4P5O B;  3U5M A;  3EB6 A;  1FP0 A;  5TRB A;  3LQH A;  4WA6 A;  1Z6U A;  4A49 A;  5JG6 A;  1JM7 B;  3N9M A;  2LXP C;  3O35 A;  5C11 A;  2L75 A;  2EXU A;  2JMI A;  1CA9 A;  2M1R A;  3EB5 A;  4YAT A;  2CKL B;  3DQV R;  2VJF B;  3N9O A;  4B7Y C;  2PUY A;  3M63 A;  3E2D A;  1LB6 A;  3GL6 A;  4M4E A;  2YSJ A;  3MHS A;  4JJQ A;  1D00 A;  1YY6 A;  3HCU A;  2YT5 A;  1WEE A;  3FAN A;  5FB1 A;  5KH7 A;  2IQJ A;  2LAU A;  3MDB C;  1FBV A;  5FEY A;  2HDP A;  2UZG A;  3HQM A;  4L58 A;  3M7K A;  4Q6F A;  2LQ6 A;  2D8U A;  3PHD A;  4GNF A;  3HCT A;  4TKP B;  3ZPV 1;  2XB1 A;  1WEU A;  3ZVY A;  2C2L A;  1CZY A;  2KWN A;  3L1X A;  3N9Q A;  4ZQL A;  5SVI A;  3RTR B;  4Z0O A;  3ASL A;  4R2Y A;  2F1Z A;  2KE1 A;  2MD7 B;  3PUR A;  2H0D A;  1G25 A;  3C5K A;  2XOZ A;  5B8D A;  3ZJB A;  3HQH A;  1JOC A;  3O36 A;  1N87 A;  3LRQ A;  4GNG A;  5LCW B;  4UP5 A;  1WEW A;  4XI1 A;  2MA5 A;  4ZUX U;  4Z8M A;  1WEP A;  1HYJ A;  4I7B A;  2F42 A;  2MKE A;  1VYX A;  2F1W A;  1LDK C;  1T1H A;  4IC2 A;  5E1T A;  2KGI A;  2FFW A;  4AUQ B;  2ECJ A; 
#chains in the Genus database with same CATH homology
 2FOO A;  1ZBD B;  2MT5 A;  2ECV A;  2JMD A;  2VNF A;  3LQJ A;  5LKZ A;  2QJ0 A;  5B78 A;  1U6G B;  5TDR A;  3HQI A;  2L5U A;  2KGG A;  2ZET C;  2A25 A;  2EOD A;  1X4I A;  2ECW A;  3M99 A;  2L80 A;  2F1X A;  3PUQ A;  2FUI A;  2YQL A;  4R8P K;  3O34 A;  3MQR A;  4AP4 A;  3KQI A;  3NG2 A;  3GV4 A;  3IVQ A;  2KFT A;  4YAB A;  4MVT A;  3O33 A;  2ECT A;  3ZNI A;  1FLL A;  2VJE B;  2VPB A;  3U5P A;  2BAY A;  3V43 A;  4R7E A;  3IHP A;  2I50 A;  5D1K B;  5G04 B;  2KYU A;  4YAD A;  5TDW A;  4AYC A;  3M62 A;  2GKW A;  4GWN A;  1QSC A;  3U5N A;  1ZMS A;  4BHW A;  2KR4 A;  2F6J A;  2KWO A;  3HCS A;  3ZTG A;  1WFK A;  4PPE A;  2C2V S;  2YSM A;  1YZE A;  2KWJ A;  1X4U A;  4WZ3 B;  1CA4 A;  1WGM A;  1WEM A;  2E6S A;  2KWK A;  3DPL R;  2RI7 A;  2JMJ A;  4YBT A;  2LGK A;  2Y43 A;  3I2D A;  1Z2Q A;  2LGL A;  2LV9 A;  2K1J A;  5TAB A;  2YHO A;  2MD8 C;  2YUC A;  1WIL A;  2YU4 A;  3L1Z B;  2M6M A;  5G0F A;  2G45 A;  3U5O A;  2MA6 A;  5LKX A;  1IYM A;  3ZPV E;  5FER A;  4F52 B;  5B75 A;  4YAX A;  2ECN A;  1WE9 A;  2CT2 A;  1WEQ A;  4ZDT A;  3N9L A;  2FUU A;  4FK5 A;  2RSD A;  2K17 A;  3KNV A;  4LK9 A;  4BBQ A;  2MUM A;  1FLK A;  3O37 A;  4L7X A;  5B79 A;  4MSX A;  3SOW A;  4N3W A;  4V3L C;  1WEO A;  1CHC A;  4NN2 A;  4QF2 A;  1BOR A;  4GNE A;  2LN0 A;  4K8U A;  5H9M A;  4YSI A;  2YW8 A;  3QZV A;  5G05 B;  4UI9 B;  3HSV A;  4KG9 A;  1F62 A;  3KV5 A;  3SOX A;  3T7L A;  2M3H A;  3SHB A;  1JM7 A;  2YYR A;  4YC9 A;  2L0B A;  5D1L B;  1MM2 A;  3L11 A;  5H1V A;  1X4J A;  5J3X A;  5B76 A;  5DIN A;  2ECG A;  2PNX A;  1MM3 A;  2CKL A;  2LRI C;  3O7A A;  2VJF A;  4V3K C;  1WEV A;  2KRE A;  3HQL A;  4O64 A;  2H0D B;  4AVX A;  5B77 A;  2VPE A;  4LJN A;  4A4C A;  5AIT A;  2YUR A;  2QIZ A;  4LAD B;  2KIZ A;  2IDA A;  3LQI A;  3T6R A;  5TBN A;  5H1T A;  2MNY A;  5I3L A;  5KH3 A;  3FL2 A;  2FSA A;  2M85 A;  2JRJ A;  3ZVZ B;  4PTB A;  2E6R A;  2LGG A;  2KU3 A;  4LKA A;  1CZZ A;  4A0C D;  1KZZ A;  1D01 A;  2CSY A;  3MHH A;  1D0J A;  2FOJ A;  5H1U A;  1F3V B;  5LKU A;  1LB5 A;  1WEN A;  2CR2 A;  2F1Y A;  4WZ2 A;  4UP0 A;  3HU6 A;  3O70 A;  4WZ0 A;  2HYE D;  2Y1N A;  5DKA A;  2XEU A;  2MIQ A;  2D8S A;  4S3O C;  2F6N A;  4GJH A;  4S3O B;  5EYA F;  4GND A;  2QIC A;  3N9N A;  3SOU A;  4I7D A;  4GHU A;  4QF3 A;  1E4U A;  2YRE A;  4FO9 A;  1VD4 A;  3N9P A;  3HTK C;  1Z60 A;  4X3G A;  2YQM A;  1LB4 A;  3ZYQ A;  2MNZ A;  3IVV A;  1DVP A;  5KH9 A;  2L43 A;  4AYC B;  2CSZ A;  4FJC A;  4O1V A;  1L0A A;  3MQS C;  4C9Z A;  1WES A;  4CCG X;  1RF3 A;  2LGV A;  2K4D A;  2OXQ C;  2VPG A;  4YBM A;  1XWH A;  4YBS A;  1WIM A;  4W4U A;  2ECI A;  2DX8 A;  2AN6 A;  3KV6 A;  5FB0 A;  5AIU A;  1D0A A;  3RPG C;  2NAA A;  2FOP A;  2Y1M A;  1VFY A;  3C6W A;  3RPG B;  2VJE A;  4CA1 A;  4A4B A;  5C13 A;  2LDR A;  4I7C A;  2VP7 A;  2LXH C;  5D1M B;  5LKT A;  4LLB A;  3VK6 A;  4GWM A;  4FIP A;  2EA6 A;  1HYI A;  1K2F A;  2YHN A;  4IC3 A;  3IVB A;  1LDJ B;  2G6Q A;  4B86 C;  2VPD A;  1V87 A;  2XXN A;  2EGP A;  2K16 A;  4GB0 A;  4N4F A;  1RMD A;  2G43 A;  4P5O B;  3U5M A;  3EB6 A;  1FP0 A;  5TRB A;  3LQH A;  4WA6 A;  1Z6U A;  4A49 A;  5JG6 A;  1JM7 B;  3N9M A;  2LXP C;  3O35 A;  5C11 A;  2L75 A;  2JMI A;  1CA9 A;  2M1R A;  3EB5 A;  4YAT A;  2CKL B;  3DQV R;  2VJF B;  3N9O A;  4B7Y C;  2PUY A;  3M63 A;  1LB6 A;  3GL6 A;  4M4E A;  2YSJ A;  3MHS A;  4JJQ A;  1D00 A;  1YY6 A;  3HCU A;  2YT5 A;  1WEE A;  5FB1 A;  5KH7 A;  1FBV A;  5FEY A;  2HDP A;  2UZG A;  3HQM A;  4L58 A;  4Q6F A;  2LQ6 A;  3PHD A;  4GNF A;  3HCT A;  4TKP B;  3ZPV 1;  2XB1 A;  1WEU A;  3ZVY A;  2C2L A;  1CZY A;  2KWN A;  3L1X A;  3N9Q A;  4ZQL A;  3RTR B;  3ASL A;  4R2Y A;  2F1Z A;  2KE1 A;  2MD7 B;  3PUR A;  2H0D A;  1G25 A;  3C5K A;  5B8D A;  3ZJB A;  3HQH A;  1JOC A;  3O36 A;  1N87 A;  3LRQ A;  4GNG A;  5LCW B;  4UP5 A;  1WEW A;  4XI1 A;  2MA5 A;  4ZUX U;  4Z8M A;  1WEP A;  1HYJ A;  4I7B A;  2F42 A;  1VYX A;  2F1W A;  1LDK C;  1T1H A;  4IC2 A;  5E1T A;  2KGI A;  4AUQ B;  2ECJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...