5H9MA

Crystal structure of siah2 sbd domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
190
structure length
190
Chain Sequence
b'SAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTIST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SIAH2
publication title Crystal structure of siah2 SBD domain
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 45
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 5h9mA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h9mA01
4JJQA 2MD7B 3O35A 1F3VB 2D8SA 3V43A 1FLLA 1LDKC 3EB5A 1WEOA 3DPLR 5G05B 4AYCB 1YY6A 4LJNA 3ZJBA 2DX8A 4CA1A 1WEEA 3MHHA 3SHBA 5JG6A 1G25A 2ECTA 3O70A 4YABA 2ECIA 2E6RA 5H9MA 3RPGB 1JOCA 1KZZA 2G6QA 4GB0A 2ECVA 2ECWA 2QJ0A 1D00A 2VPGA 4XI1A 2F42A 4A4BA 2HYED 1DVPA 2YW8A 3N9PA 2JMIA 2MD8C 3GL6A 5AIUA 4ZUXU 5AITA 4AYCA 3QZVA 5TBNA 4GWMA 1U6GB 2YUCA 2YREA 5B75A 4GNGA 5DKAA 4LKAA 1FP0A 4GJHA 3U5PA 2F1WA 2KWNA 3PUQA 2VJEA 5FEYA 4MSXA 3KQIA 3HCUA 3FL2A 3ZTGA 2L43A 4B7YC 2KE1A 3IVQA 4BBQA 2XEUA 5FB0A 4YADA 4YBSA 4FJCA 3IVVA 5LCWB 1QSCA 4PTBA 2BAYA 1ZBDB 3DQVR 3MQRA 2LN0A 2KIZA 4YC9A 3M62A 2IDAA 1V87A 3RTRB 2VNFA 4WZ0A 1LB6A 1CZZA 4YBMA 2HDPA 4LK9A 3LQJA 2M3HA 1LB5A 3RPGC 3HQHA 2M1RA 4N3WA 1JM7B 4R2YA 2PUYA 2LXPC 2G43A 4F52B 4I7BA 2YQMA 4GHUA 5LKZA 1CA9A 4A0CD 3HCSA 1CHCA 4O64A 4YAXA 1K2FA 1D0AA 2YU4A 4AVXA 3HQLA 2EA6A 2F6JA 1MM3A 2LGGA 1Z2QA 1WESA 3ZNIA 4ZQLA 3NG2A 2CR2A 1WE9A 4AUQB 1X4UA 2QIZA 5H1TA 4A4CA 2VPDA 1VFYA 2E6SA 3SOWA 4CCGX 2VJEB 2YHOA 1JM7A 4C9ZA 5E1TA 4QF3A 5LKXA 2ECJA 2FUUA 4S3OB 3VK6A 2AN6A 2L5UA 2I50A 2XXNA 5TDWA 3ZPVE 4V3LC 4GNEA 1FLKA 1WENA 4R7EA 2FSAA 5J3XA 1RMDA 3PURA 3U5OA 2KGGA 2LRIC 3HSVA 1HYJA 4LADB 4GWNA 3T6RA 1E4UA 2ECNA 4O1VA 5H1UA 3C6WA 3N9MA 2LGKA 5B77A 2C2LA 2Y43A 3L11A 3KV5A 3LRQA 2UZGA 1N87A 5TDRA 2JMJA 2Y1MA 4WZ2A 2M6MA 2LGLA 3N9QA 2LXHC 3SOXA 2MIQA 2LQ6A 4YATA 4P5OB 1WEPA 4N4FA 5TRBA 1WEUA 4GNDA 5G0FA 3U5NA 3HTKC 2KU3A 1WEVA 4YBTA 4V3KC 2K1JA 2PNXA 3M99A 1ZMSA 3HU6A 5B78A 3ZVZB 2KGIA 1L0AA 2FOOA 2EGPA 2F1YA 2XB1A 3MHSA 4KG9A 4R8PK 1CA4A 2K16A 2K17A 3N9OA 3EB6A 3U5MA 2H0DB 4Q6FA 1LB4A 2KWJA 2L80A 4FO9A 4S3OC 2MA6A 4TKPB 4K8UA 4YSIA 5KH3A 4QF2A 3M63A 2MUMA 1WEMA 4PPEA 5C13A 4I7CA 2RSDA 2YURA 3MQSC 3LQHA 1FBVA 3N9NA 2Y1NA 4WA6A 2G45A 4LLBA 2QICA 5LKUA 5TABA 1HYIA 3HQMA 1BORA 4A49A 5G04B 3HCTA 5D1LB 3IHPA 4IC3A 4M4EA 4IC2A 3T7LA 1WFKA 1X4JA 2YQLA 2EODA 2H0DA 3GV4A 2YT5A 2F1ZA 4WZ3B 3SOUA 3HQIA 2ECGA 2JMDA 2JRJA 5I3LA 2KYUA 3C5KA 2F1XA 2CKLB 2GKWA 2LGVA 3O7AA 4UI9B 2RI7A 1WGMA 3IVBA 5B8DA 2CSYA 1D0JA 2L75A 3O33A 2MA5A 3ZYQA 4UP0A 2A25A 4I7DA 1WEQA 1YZEA 1Z6UA 2VP7A 1WEWA 5KH7A 4UP5A 5B79A 4L7XA 1WILA 2VPBA 3L1ZB 4NN2A 2MNZA 5H1VA 2KR4A 5DINA 1T1HA 4Z8MA 2ZETC 2MT5A 3ZPV1 1IYMA 1CZYA 2MNYA 5EYAF 1WIMA 5FB1A 3O37A 3KV6A 2L0BA 4X3GA 2KWOA 2OXQC 2CKLA 2NAAA 5C11A 4GNFA 5KH9A 4AP4A 2VJFB 4ZDTA 1F62A 4L58A 3LQIA 3N9LA 2YHNA 2LDRA 2F6NA 2CSZA 1VD4A 1XWHA 3O34A 5D1KB 2FOPA 1D01A 2CT2A 1LDJB 1X4IA 3O36A 4W4UA 2YSJA 4BHWA 4MVTA 2LV9A 2VPEA 3I2DA 3L1XA 1RF3A 2C2VS 3PHDA 2KWKA 5FERA 2FUIA 2YSMA 2YYRA 2VJFA 2KFTA 2FOJA 5B76A 3KNVA 4B86C 1MM2A 5D1MB 3ZVYA 4FIPA 5LKTA 2KREA 2K4DA 1Z60A 4FK5A 3ASLA 1VYXA 2M85A
chains in the Genus database with same CATH superfamily
4H9DA 4JJQA 2MD7B 3O35A 1F3VB 2D8SA 3V43A 1FLLA 1LDKC 3EB5A 1WEOA 2MKEA 3DPLR 5G05B 4AYCB 1YY6A 4LJNA 3ZJBA 2DX8A 4CA1A 2OWAA 1WEEA 3MHHA 3SHBA 5JG6A 1G25A 2ECTA 3O70A 4YABA 2ECIA 2KKYA 2E6RA 5H9MA 3RPGB 1JOCA 1KZZA 2G6QA 4GB0A 2ECVA 2ECWA 2QJ0A 1D00A 2VPGA 4XI1A 2F42A 4A4BA 2HYED 1DVPA 2YW8A 3N9PA 2JMIA 2MD8C 3GL6A 3KDEC 5AIUA 4ZUXU 5AITA 4AYCA 3QZVA 5TBNA 2DSMA 4GWMA 2D8UA 1U6GB 2YUCA 2YREA 5B75A 4GNGA 5DKAA 4LKAA 1FP0A 4GJHA 3U5PA 2F1WA 2KWNA 3PUQA 4Z0OA 2VJEA 5FEYA 4MSXA 3KQIA 3HCUA 3FL2A 3ZTGA 2FFWA 2L43A 4B7YC 2KE1A 3IVQA 4BBQA 2XEUA 3PLWA 5FB0A 4YADA 4YBSA 4FJCA 3FEHA 3IVVA 2P57A 3FM8C 5LCWB 1QSCA 4PTBA 2BAYA 1ZBDB 3DQVR 3MQRA 2LN0A 2KIZA 4O62A 2E61A 4YC9A 3M62A 4QQ4A 2IDAA 1V87A 3RTRB 2VNFA 4WZ0A 1LB6A 1CZZA 4YBMA 2HDPA 4LK9A 3LQJA 2M3HA 1LB5A 3RPGC 3HQHA 2M1RA 4N3WA 1JM7B 4R2YA 2PUYA 2LXPC 2G43A 4F52B 4I7BA 2YQMA 4GHUA 5LKZA 1CA9A 4A0CD 3HCSA 1CHCA 2CRWA 4O64A 4YAXA 1K2FA 1D0AA 2YU4A 4AVXA 3HQLA 2IQJA 2EA6A 2F6JA 1MM3A 2LGGA 1Z2QA 1WESA 3ZNIA 4ZQLA 3NG2A 2CR2A 1WE9A 4AUQB 1X4UA 2QIZA 5H1TA 5SVXA 4A4CA 2VPDA 5K3QA 1VFYA 2E6SA 3SOWA 4CCGX 2VJEB 2CRRA 2YHOA 1JM7A 4Z0RA 4C9ZA 5E1TA 4QF3A 5LKXA 2ECJA 2FUUA 4S3OB 3VK6A 3O47A 2AN6A 2L5UA 2I50A 2RR4A 2XXNA 5TDWA 3ZPVE 4V3LC 4F1PA 4GNEA 1FLKA 1WENA 4R7EA 2FSAA 4OGCA 5J3XA 1RMDA 3PURA 3U5OA 2KGGA 2LRIC 3T9KA 3HSVA 1HYJA 4LADB 4GWNA 3T6RA 1E4UA 2ECNA 4O1VA 5H1UA 3C6WA 3N9MA 2LGKA 5B77A 2C2LA 3FJUB 2Y43A 3L11A 3KV5A 2DJAA 3LRQA 3JUEA 3FANA 2UZGA 1N87A 5TDRA 2JMJA 2Y1MA 4WZ2A 2M6MA 2LGLA 3N9QA 2LXHC 3SOXA 2MIQA 2LQ6A 4YATA 2M13A 4P5OB 1WEPA 4N4FA 5TRBA 1WEUA 4GNDA 5G0FA 3U5NA 2XOZA 3HTKC 2KU3A 1WEVA 4YBTA 4V3KC 2K1JA 2PNXA 3LDYA 3M99A 1ZMSA 3HU6A 5B78A 3ZVZB 2KGIA 1L0AA 2FOOA 2EGPA 2F1YA 2XB1A 3MHSA 4KG9A 4R8PK 1CA4A 2K16A 2K17A 3N9OA 3EB6A 3U5MA 2H0DB 3LJUX 4Q6FA 1LB4A 2KWJA 2L80A 4FO9A 4S3OC 2MA6A 4TKPB 4K8UA 2XP0A 4YSIA 1MBMA 5KH3A 4QF2A 3M63A 2MUMA 1WEMA 4PPEA 5C13A 4I7CA 2RSDA 2YURA 3MQSC 3LQHA 1FBVA 3N9NA 2Y1NA 4WA6A 2G45A 4LLBA 2QICA 3DWDA 5LKUA 2YVRA 3MDBC 5TABA 1HYIA 3HQMA 1BORA 4A49A 5G04B 3HCTA 5D1LB 2XOYA 3IHPA 4IC3A 4M4EA 4IC2A 3T7LA 1WFKA 1X4JA 2YQLA 2EODA 2CSVA 2H0DA 3GV4A 2YT5A 2F1ZA 4WZ3B 3SOUA 3HQIA 2ECGA 5SVIB 3FAOA 2JMDA 2JRJA 5I3LA 2KYUA 3LVQE 3C5KA 2F1XA 2CKLB 2KKXA 2GKWA 2LGVA 2EXUA 2EGMA 3O7AA 4UI9B 2RI7A 1WGMA 3IVBA 5B8DA 2CSYA 1D0JA 2L75A 3O33A 2MA5A 3ZYQA 4UP0A 2A25A 4I7DA 1WEQA 1YZEA 1Z6UA 2VP7A 1WEWA 5KH7A 4UP5A 5B79A 3Q1DA 4L7XA 3H7HA 1WILA 2VPBA 3L1ZB 4NN2A 2MNZA 5H1VA 2KR4A 5DINA 1T1HA 4Z8MA 2ZETC 2MT5A 3ZPV1 1IYMA 4OGEA 3SUBA 1CZYA 2MNYA 5EYAF 1WIMA 5SVIA 5FB1A 3O37A 3KV6A 2L0BA 4X3GA 2KWOA 2OXQC 2CKLA 2FD4A 2NAAA 5C11A 4GNFA 2L7PA 5KH9A 1DCQA 4AP4A 2VJFB 4ZDTA 1F62A 4L58A 3DDTA 3LQIA 3N9LA 2YHNA 2LDRA 2F6NA 2CSZA 1VD4A 1XWHA 3O34A 5D1KB 2JUNA 2FOPA 1D01A 2CT2A 1LDJB 1X4IA 3O36A 4W4UA 2YSJA 4BHWA 3LVRE 2XOCA 4MVTA 2LV9A 2VPEA 3I2DA 3L1XA 1RF3A 2C2VS 3PHDA 2KWKA 5FERA 2FUIA 2CONA 2YSMA 2YYRA 2B0OE 2VJFA 2LAUA 2KFTA 2FOJA 5B76A 3KNVA 4B86C 1MM2A 5D1MB 3ZVYA 4FIPA 5LKTA 2KREA 3E2DA 2K4DA 5SVYA 1Z60A 4FK5A 3ASLA 1VYXA 2JM3A 2M85A 3M7KA
chains in the Genus database with same CATH topology
4JJQA 2MD7B 3O35A 1F3VB 2D8SA 3V43A 1FLLA 1LDKC 3EB5A 1WEOA 3DPLR 5G05B 4AYCB 1YY6A 4LJNA 3ZJBA 2DX8A 4CA1A 1WEEA 3MHHA 3SHBA 5JG6A 1G25A 2ECTA 3O70A 4YABA 2ECIA 2E6RA 5H9MA 3RPGB 1JOCA 1KZZA 2G6QA 4GB0A 2ECVA 2ECWA 2QJ0A 1D00A 2VPGA 4XI1A 2F42A 4A4BA 2HYED 1DVPA 2YW8A 3N9PA 2JMIA 2MD8C 3GL6A 5AIUA 4ZUXU 5AITA 4AYCA 3QZVA 5TBNA 4GWMA 1U6GB 2YUCA 2YREA 5B75A 4GNGA 5DKAA 4LKAA 1FP0A 4GJHA 3U5PA 2F1WA 2KWNA 3PUQA 2VJEA 5FEYA 4MSXA 3KQIA 3HCUA 3FL2A 3ZTGA 2L43A 4B7YC 2KE1A 3IVQA 4BBQA 2XEUA 5FB0A 4YADA 4YBSA 4FJCA 3IVVA 5LCWB 1QSCA 4PTBA 2BAYA 1ZBDB 3DQVR 3MQRA 2LN0A 2KIZA 4YC9A 3M62A 2IDAA 1V87A 3RTRB 2VNFA 4WZ0A 1LB6A 1CZZA 4YBMA 2HDPA 4LK9A 3LQJA 2M3HA 1LB5A 3RPGC 3HQHA 2M1RA 4N3WA 1JM7B 4R2YA 2PUYA 2LXPC 2G43A 4F52B 4I7BA 2YQMA 4GHUA 5LKZA 1CA9A 4A0CD 3HCSA 1CHCA 4O64A 4YAXA 1K2FA 1D0AA 2YU4A 4AVXA 3HQLA 2EA6A 2F6JA 1MM3A 2LGGA 1Z2QA 1WESA 3ZNIA 4ZQLA 3NG2A 2CR2A 1WE9A 4AUQB 1X4UA 2QIZA 5H1TA 4A4CA 2VPDA 1VFYA 2E6SA 3SOWA 4CCGX 2VJEB 2YHOA 1JM7A 4C9ZA 5E1TA 4QF3A 5LKXA 2ECJA 2FUUA 4S3OB 3VK6A 2AN6A 2L5UA 2I50A 2XXNA 5TDWA 3ZPVE 4V3LC 4GNEA 1FLKA 1WENA 4R7EA 2FSAA 5J3XA 1RMDA 3PURA 3U5OA 2KGGA 2LRIC 3HSVA 1HYJA 4LADB 4GWNA 3T6RA 1E4UA 2ECNA 4O1VA 5H1UA 3C6WA 3N9MA 2LGKA 5B77A 2C2LA 2Y43A 3L11A 3KV5A 3LRQA 2UZGA 1N87A 5TDRA 2JMJA 2Y1MA 4WZ2A 2M6MA 2LGLA 3N9QA 2LXHC 3SOXA 2MIQA 2LQ6A 4YATA 4P5OB 1WEPA 4N4FA 5TRBA 1WEUA 4GNDA 5G0FA 3U5NA 3HTKC 2KU3A 1WEVA 4YBTA 4V3KC 2K1JA 2PNXA 3M99A 1ZMSA 3HU6A 5B78A 3ZVZB 2KGIA 1L0AA 2FOOA 2EGPA 2F1YA 2XB1A 3MHSA 4KG9A 4R8PK 1CA4A 2K16A 2K17A 3N9OA 3EB6A 3U5MA 2H0DB 4Q6FA 1LB4A 2KWJA 2L80A 4FO9A 4S3OC 2MA6A 4TKPB 4K8UA 4YSIA 5KH3A 4QF2A 3M63A 2MUMA 1WEMA 4PPEA 5C13A 4I7CA 2RSDA 2YURA 3MQSC 3LQHA 1FBVA 3N9NA 2Y1NA 4WA6A 2G45A 4LLBA 2QICA 5LKUA 5TABA 1HYIA 3HQMA 1BORA 4A49A 5G04B 3HCTA 5D1LB 3IHPA 4IC3A 4M4EA 4IC2A 3T7LA 1WFKA 1X4JA 2YQLA 2EODA 2H0DA 3GV4A 2YT5A 2F1ZA 4WZ3B 3SOUA 3HQIA 2ECGA 2JMDA 2JRJA 5I3LA 2KYUA 3C5KA 2F1XA 2CKLB 2GKWA 2LGVA 3O7AA 4UI9B 2RI7A 1WGMA 3IVBA 5B8DA 2CSYA 1D0JA 2L75A 3O33A 2MA5A 3ZYQA 4UP0A 2A25A 4I7DA 1WEQA 1YZEA 1Z6UA 2VP7A 1WEWA 5KH7A 4UP5A 5B79A 4L7XA 1WILA 2VPBA 3L1ZB 4NN2A 2MNZA 5H1VA 2KR4A 5DINA 1T1HA 4Z8MA 2ZETC 2MT5A 3ZPV1 1IYMA 1CZYA 2MNYA 5EYAF 1WIMA 5FB1A 3O37A 3KV6A 2L0BA 4X3GA 2KWOA 2OXQC 2CKLA 2NAAA 5C11A 4GNFA 5KH9A 4AP4A 2VJFB 4ZDTA 1F62A 4L58A 3LQIA 3N9LA 2YHNA 2LDRA 2F6NA 2CSZA 1VD4A 1XWHA 3O34A 5D1KB 2FOPA 1D01A 2CT2A 1LDJB 1X4IA 3O36A 4W4UA 2YSJA 4BHWA 4MVTA 2LV9A 2VPEA 3I2DA 3L1XA 1RF3A 2C2VS 3PHDA 2KWKA 5FERA 2FUIA 2YSMA 2YYRA 2VJFA 2KFTA 2FOJA 5B76A 3KNVA 4B86C 1MM2A 5D1MB 3ZVYA 4FIPA 5LKTA 2KREA 2K4DA 1Z60A 4FK5A 3ASLA 1VYXA 2M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJQ A;  2MD7 B;  3O35 A;  1F3V B;  2D8S A;  3V43 A;  1FLL A;  1LDK C;  3EB5 A;  1WEO A;  3DPL R;  5G05 B;  4AYC B;  1YY6 A;  4LJN A;  3ZJB A;  2DX8 A;  4CA1 A;  1WEE A;  3MHH A;  3SHB A;  5JG6 A;  1G25 A;  2ECT A;  3O70 A;  4YAB A;  2ECI A;  2E6R A;  5H9M A;  3RPG B;  1JOC A;  1KZZ A;  2G6Q A;  4GB0 A;  2ECV A;  2ECW A;  2QJ0 A;  1D00 A;  2VPG A;  4XI1 A;  2F42 A;  4A4B A;  2HYE D;  1DVP A;  2YW8 A;  3N9P A;  2JMI A;  2MD8 C;  3GL6 A;  5AIU A;  4ZUX U;  5AIT A;  4AYC A;  3QZV A;  5TBN A;  4GWM A;  1U6G B;  2YUC A;  2YRE A;  5B75 A;  4GNG A;  5DKA A;  4LKA A;  1FP0 A;  4GJH A;  3U5P A;  2F1W A;  2KWN A;  3PUQ A;  2VJE A;  5FEY A;  4MSX A;  3KQI A;  3HCU A;  3FL2 A;  3ZTG A;  2L43 A;  4B7Y C;  2KE1 A;  3IVQ A;  4BBQ A;  2XEU A;  5FB0 A;  4YAD A;  4YBS A;  4FJC A;  3IVV A;  5LCW B;  1QSC A;  4PTB A;  2BAY A;  1ZBD B;  3DQV R;  3MQR A;  2LN0 A;  2KIZ A;  4YC9 A;  3M62 A;  2IDA A;  1V87 A;  3RTR B;  2VNF A;  4WZ0 A;  1LB6 A;  1CZZ A;  4YBM A;  2HDP A;  4LK9 A;  3LQJ A;  2M3H A;  1LB5 A;  3RPG C;  3HQH A;  2M1R A;  4N3W A;  1JM7 B;  4R2Y A;  2PUY A;  2LXP C;  2G43 A;  4F52 B;  4I7B A;  2YQM A;  4GHU A;  5LKZ A;  1CA9 A;  4A0C D;  3HCS A;  1CHC A;  4O64 A;  4YAX A;  1K2F A;  1D0A A;  2YU4 A;  4AVX A;  3HQL A;  2EA6 A;  2F6J A;  1MM3 A;  2LGG A;  1Z2Q A;  1WES A;  3ZNI A;  4ZQL A;  3NG2 A;  2CR2 A;  1WE9 A;  4AUQ B;  1X4U A;  2QIZ A;  5H1T A;  4A4C A;  2VPD A;  1VFY A;  2E6S A;  3SOW A;  4CCG X;  2VJE B;  2YHO A;  1JM7 A;  4C9Z A;  5E1T A;  4QF3 A;  5LKX A;  2ECJ A;  2FUU A;  4S3O B;  3VK6 A;  2AN6 A;  2L5U A;  2I50 A;  2XXN A;  5TDW A;  3ZPV E;  4V3L C;  4GNE A;  1FLK A;  1WEN A;  4R7E A;  2FSA A;  5J3X A;  1RMD A;  3PUR A;  3U5O A;  2KGG A;  2LRI C;  3HSV A;  1HYJ A;  4LAD B;  4GWN A;  3T6R A;  1E4U A;  2ECN A;  4O1V A;  5H1U A;  3C6W A;  3N9M A;  2LGK A;  5B77 A;  2C2L A;  2Y43 A;  3L11 A;  3KV5 A;  3LRQ A;  2UZG A;  1N87 A;  5TDR A;  2JMJ A;  2Y1M A;  4WZ2 A;  2M6M A;  2LGL A;  3N9Q A;  2LXH C;  3SOX A;  2MIQ A;  2LQ6 A;  4YAT A;  4P5O B;  1WEP A;  4N4F A;  5TRB A;  1WEU A;  4GND A;  5G0F A;  3U5N A;  3HTK C;  2KU3 A;  1WEV A;  4YBT A;  4V3K C;  2K1J A;  2PNX A;  3M99 A;  1ZMS A;  3HU6 A;  5B78 A;  3ZVZ B;  2KGI A;  1L0A A;  2FOO A;  2EGP A;  2F1Y A;  2XB1 A;  3MHS A;  4KG9 A;  4R8P K;  1CA4 A;  2K16 A;  2K17 A;  3N9O A;  3EB6 A;  3U5M A;  2H0D B;  4Q6F A;  1LB4 A;  2KWJ A;  2L80 A;  4FO9 A;  4S3O C;  2MA6 A;  4TKP B;  4K8U A;  4YSI A;  5KH3 A;  4QF2 A;  3M63 A;  2MUM A;  1WEM A;  4PPE A;  5C13 A;  4I7C A;  2RSD A;  2YUR A;  3MQS C;  3LQH A;  1FBV A;  3N9N A;  2Y1N A;  4WA6 A;  2G45 A;  4LLB A;  2QIC A;  5LKU A;  5TAB A;  1HYI A;  3HQM A;  1BOR A;  4A49 A;  5G04 B;  3HCT A;  5D1L B;  3IHP A;  4IC3 A;  4M4E A;  4IC2 A;  3T7L A;  1WFK A;  1X4J A;  2YQL A;  2EOD A;  2H0D A;  3GV4 A;  2YT5 A;  2F1Z A;  4WZ3 B;  3SOU A;  3HQI A;  2ECG A;  2JMD A;  2JRJ A;  5I3L A;  2KYU A;  3C5K A;  2F1X A;  2CKL B;  2GKW A;  2LGV A;  3O7A A;  4UI9 B;  2RI7 A;  1WGM A;  3IVB A;  5B8D A;  2CSY A;  1D0J A;  2L75 A;  3O33 A;  2MA5 A;  3ZYQ A;  4UP0 A;  2A25 A;  4I7D A;  1WEQ A;  1YZE A;  1Z6U A;  2VP7 A;  1WEW A;  5KH7 A;  4UP5 A;  5B79 A;  4L7X A;  1WIL A;  2VPB A;  3L1Z B;  4NN2 A;  2MNZ A;  5H1V A;  2KR4 A;  5DIN A;  1T1H A;  4Z8M A;  2ZET C;  2MT5 A;  3ZPV 1;  1IYM A;  1CZY A;  2MNY A;  5EYA F;  1WIM A;  5FB1 A;  3O37 A;  3KV6 A;  2L0B A;  4X3G A;  2KWO A;  2OXQ C;  2CKL A;  2NAA A;  5C11 A;  4GNF A;  5KH9 A;  4AP4 A;  2VJF B;  4ZDT A;  1F62 A;  4L58 A;  3LQI A;  3N9L A;  2YHN A;  2LDR A;  2F6N A;  2CSZ A;  1VD4 A;  1XWH A;  3O34 A;  5D1K B;  2FOP A;  1D01 A;  2CT2 A;  1LDJ B;  1X4I A;  3O36 A;  4W4U A;  2YSJ A;  4BHW A;  4MVT A;  2LV9 A;  2VPE A;  3I2D A;  3L1X A;  1RF3 A;  2C2V S;  3PHD A;  2KWK A;  5FER A;  2FUI A;  2YSM A;  2YYR A;  2VJF A;  2KFT A;  2FOJ A;  5B76 A;  3KNV A;  4B86 C;  1MM2 A;  5D1M B;  3ZVY A;  4FIP A;  5LKT A;  2KRE A;  2K4D A;  1Z60 A;  4FK5 A;  3ASL A;  1VYX A;  2M85 A; 
#chains in the Genus database with same CATH topology
 4H9D A;  4JJQ A;  2MD7 B;  3O35 A;  1F3V B;  2D8S A;  3V43 A;  1FLL A;  1LDK C;  3EB5 A;  1WEO A;  2MKE A;  3DPL R;  5G05 B;  4AYC B;  1YY6 A;  4LJN A;  3ZJB A;  2DX8 A;  4CA1 A;  2OWA A;  1WEE A;  3MHH A;  3SHB A;  5JG6 A;  1G25 A;  2ECT A;  3O70 A;  4YAB A;  2ECI A;  2KKY A;  2E6R A;  5H9M A;  3RPG B;  1JOC A;  1KZZ A;  2G6Q A;  4GB0 A;  2ECV A;  2ECW A;  2QJ0 A;  1D00 A;  2VPG A;  4XI1 A;  2F42 A;  4A4B A;  2HYE D;  1DVP A;  2YW8 A;  3N9P A;  2JMI A;  2MD8 C;  3GL6 A;  3KDE C;  5AIU A;  4ZUX U;  5AIT A;  4AYC A;  3QZV A;  5TBN A;  2DSM A;  4GWM A;  2D8U A;  1U6G B;  2YUC A;  2YRE A;  5B75 A;  4GNG A;  5DKA A;  4LKA A;  1FP0 A;  4GJH A;  3U5P A;  2F1W A;  2KWN A;  3PUQ A;  4Z0O A;  2VJE A;  5FEY A;  4MSX A;  3KQI A;  3HCU A;  3FL2 A;  3ZTG A;  2FFW A;  2L43 A;  4B7Y C;  2KE1 A;  3IVQ A;  4BBQ A;  2XEU A;  3PLW A;  5FB0 A;  4YAD A;  4YBS A;  4FJC A;  3FEH A;  3IVV A;  2P57 A;  3FM8 C;  5LCW B;  1QSC A;  4PTB A;  2BAY A;  1ZBD B;  3DQV R;  3MQR A;  2LN0 A;  2KIZ A;  4O62 A;  2E61 A;  4YC9 A;  3M62 A;  4QQ4 A;  2IDA A;  1V87 A;  3RTR B;  2VNF A;  4WZ0 A;  1LB6 A;  1CZZ A;  4YBM A;  2HDP A;  4LK9 A;  3LQJ A;  2M3H A;  1LB5 A;  3RPG C;  3HQH A;  2M1R A;  4N3W A;  1JM7 B;  4R2Y A;  2PUY A;  2LXP C;  2G43 A;  4F52 B;  4I7B A;  2YQM A;  4GHU A;  5LKZ A;  1CA9 A;  4A0C D;  3HCS A;  1CHC A;  2CRW A;  4O64 A;  4YAX A;  1K2F A;  1D0A A;  2YU4 A;  4AVX A;  3HQL A;  2IQJ A;  2EA6 A;  2F6J A;  1MM3 A;  2LGG A;  1Z2Q A;  1WES A;  3ZNI A;  4ZQL A;  3NG2 A;  2CR2 A;  1WE9 A;  4AUQ B;  1X4U A;  2QIZ A;  5H1T A;  5SVX A;  4A4C A;  2VPD A;  5K3Q A;  1VFY A;  2E6S A;  3SOW A;  4CCG X;  2VJE B;  2CRR A;  2YHO A;  1JM7 A;  4Z0R A;  4C9Z A;  5E1T A;  4QF3 A;  5LKX A;  2ECJ A;  2FUU A;  4S3O B;  3VK6 A;  3O47 A;  2AN6 A;  2L5U A;  2I50 A;  2RR4 A;  2XXN A;  5TDW A;  3ZPV E;  4V3L C;  4F1P A;  4GNE A;  1FLK A;  1WEN A;  4R7E A;  2FSA A;  4OGC A;  5J3X A;  1RMD A;  3PUR A;  3U5O A;  2KGG A;  2LRI C;  3T9K A;  3HSV A;  1HYJ A;  4LAD B;  4GWN A;  3T6R A;  1E4U A;  2ECN A;  4O1V A;  5H1U A;  3C6W A;  3N9M A;  2LGK A;  5B77 A;  2C2L A;  3FJU B;  2Y43 A;  3L11 A;  3KV5 A;  2DJA A;  3LRQ A;  3JUE A;  3FAN A;  2UZG A;  1N87 A;  5TDR A;  2JMJ A;  2Y1M A;  4WZ2 A;  2M6M A;  2LGL A;  3N9Q A;  2LXH C;  3SOX A;  2MIQ A;  2LQ6 A;  4YAT A;  2M13 A;  4P5O B;  1WEP A;  4N4F A;  5TRB A;  1WEU A;  4GND A;  5G0F A;  3U5N A;  2XOZ A;  3HTK C;  2KU3 A;  1WEV A;  4YBT A;  4V3K C;  2K1J A;  2PNX A;  3LDY A;  3M99 A;  1ZMS A;  3HU6 A;  5B78 A;  3ZVZ B;  2KGI A;  1L0A A;  2FOO A;  2EGP A;  2F1Y A;  2XB1 A;  3MHS A;  4KG9 A;  4R8P K;  1CA4 A;  2K16 A;  2K17 A;  3N9O A;  3EB6 A;  3U5M A;  2H0D B;  3LJU X;  4Q6F A;  1LB4 A;  2KWJ A;  2L80 A;  4FO9 A;  4S3O C;  2MA6 A;  4TKP B;  4K8U A;  2XP0 A;  4YSI A;  1MBM A;  5KH3 A;  4QF2 A;  3M63 A;  2MUM A;  1WEM A;  4PPE A;  5C13 A;  4I7C A;  2RSD A;  2YUR A;  3MQS C;  3LQH A;  1FBV A;  3N9N A;  2Y1N A;  4WA6 A;  2G45 A;  4LLB A;  2QIC A;  3DWD A;  5LKU A;  2YVR A;  3MDB C;  5TAB A;  1HYI A;  3HQM A;  1BOR A;  4A49 A;  5G04 B;  3HCT A;  5D1L B;  2XOY A;  3IHP A;  4IC3 A;  4M4E A;  4IC2 A;  3T7L A;  1WFK A;  1X4J A;  2YQL A;  2EOD A;  2CSV A;  2H0D A;  3GV4 A;  2YT5 A;  2F1Z A;  4WZ3 B;  3SOU A;  3HQI A;  2ECG A;  5SVI B;  3FAO A;  2JMD A;  2JRJ A;  5I3L A;  2KYU A;  3LVQ E;  3C5K A;  2F1X A;  2CKL B;  2KKX A;  2GKW A;  2LGV A;  2EXU A;  2EGM A;  3O7A A;  4UI9 B;  2RI7 A;  1WGM A;  3IVB A;  5B8D A;  2CSY A;  1D0J A;  2L75 A;  3O33 A;  2MA5 A;  3ZYQ A;  4UP0 A;  2A25 A;  4I7D A;  1WEQ A;  1YZE A;  1Z6U A;  2VP7 A;  1WEW A;  5KH7 A;  4UP5 A;  5B79 A;  3Q1D A;  4L7X A;  3H7H A;  1WIL A;  2VPB A;  3L1Z B;  4NN2 A;  2MNZ A;  5H1V A;  2KR4 A;  5DIN A;  1T1H A;  4Z8M A;  2ZET C;  2MT5 A;  3ZPV 1;  1IYM A;  4OGE A;  3SUB A;  1CZY A;  2MNY A;  5EYA F;  1WIM A;  5SVI A;  5FB1 A;  3O37 A;  3KV6 A;  2L0B A;  4X3G A;  2KWO A;  2OXQ C;  2CKL A;  2FD4 A;  2NAA A;  5C11 A;  4GNF A;  2L7P A;  5KH9 A;  1DCQ A;  4AP4 A;  2VJF B;  4ZDT A;  1F62 A;  4L58 A;  3DDT A;  3LQI A;  3N9L A;  2YHN A;  2LDR A;  2F6N A;  2CSZ A;  1VD4 A;  1XWH A;  3O34 A;  5D1K B;  2JUN A;  2FOP A;  1D01 A;  2CT2 A;  1LDJ B;  1X4I A;  3O36 A;  4W4U A;  2YSJ A;  4BHW A;  3LVR E;  2XOC A;  4MVT A;  2LV9 A;  2VPE A;  3I2D A;  3L1X A;  1RF3 A;  2C2V S;  3PHD A;  2KWK A;  5FER A;  2FUI A;  2CON A;  2YSM A;  2YYR A;  2B0O E;  2VJF A;  2LAU A;  2KFT A;  2FOJ A;  5B76 A;  3KNV A;  4B86 C;  1MM2 A;  5D1M B;  3ZVY A;  4FIP A;  5LKT A;  2KRE A;  3E2D A;  2K4D A;  5SVY A;  1Z60 A;  4FK5 A;  3ASL A;  1VYX A;  2JM3 A;  2M85 A;  3M7K A; 
#chains in the Genus database with same CATH homology
 4JJQ A;  2MD7 B;  3O35 A;  1F3V B;  2D8S A;  3V43 A;  1FLL A;  1LDK C;  3EB5 A;  1WEO A;  3DPL R;  5G05 B;  4AYC B;  1YY6 A;  4LJN A;  3ZJB A;  2DX8 A;  4CA1 A;  1WEE A;  3MHH A;  3SHB A;  5JG6 A;  1G25 A;  2ECT A;  3O70 A;  4YAB A;  2ECI A;  2E6R A;  5H9M A;  3RPG B;  1JOC A;  1KZZ A;  2G6Q A;  4GB0 A;  2ECV A;  2ECW A;  2QJ0 A;  1D00 A;  2VPG A;  4XI1 A;  2F42 A;  4A4B A;  2HYE D;  1DVP A;  2YW8 A;  3N9P A;  2JMI A;  2MD8 C;  3GL6 A;  5AIU A;  4ZUX U;  5AIT A;  4AYC A;  3QZV A;  5TBN A;  4GWM A;  1U6G B;  2YUC A;  2YRE A;  5B75 A;  4GNG A;  5DKA A;  4LKA A;  1FP0 A;  4GJH A;  3U5P A;  2F1W A;  2KWN A;  3PUQ A;  2VJE A;  5FEY A;  4MSX A;  3KQI A;  3HCU A;  3FL2 A;  3ZTG A;  2L43 A;  4B7Y C;  2KE1 A;  3IVQ A;  4BBQ A;  2XEU A;  5FB0 A;  4YAD A;  4YBS A;  4FJC A;  3IVV A;  5LCW B;  1QSC A;  4PTB A;  2BAY A;  1ZBD B;  3DQV R;  3MQR A;  2LN0 A;  2KIZ A;  4YC9 A;  3M62 A;  2IDA A;  1V87 A;  3RTR B;  2VNF A;  4WZ0 A;  1LB6 A;  1CZZ A;  4YBM A;  2HDP A;  4LK9 A;  3LQJ A;  2M3H A;  1LB5 A;  3RPG C;  3HQH A;  2M1R A;  4N3W A;  1JM7 B;  4R2Y A;  2PUY A;  2LXP C;  2G43 A;  4F52 B;  4I7B A;  2YQM A;  4GHU A;  5LKZ A;  1CA9 A;  4A0C D;  3HCS A;  1CHC A;  4O64 A;  4YAX A;  1K2F A;  1D0A A;  2YU4 A;  4AVX A;  3HQL A;  2EA6 A;  2F6J A;  1MM3 A;  2LGG A;  1Z2Q A;  1WES A;  3ZNI A;  4ZQL A;  3NG2 A;  2CR2 A;  1WE9 A;  4AUQ B;  1X4U A;  2QIZ A;  5H1T A;  4A4C A;  2VPD A;  1VFY A;  2E6S A;  3SOW A;  4CCG X;  2VJE B;  2YHO A;  1JM7 A;  4C9Z A;  5E1T A;  4QF3 A;  5LKX A;  2ECJ A;  2FUU A;  4S3O B;  3VK6 A;  2AN6 A;  2L5U A;  2I50 A;  2XXN A;  5TDW A;  3ZPV E;  4V3L C;  4GNE A;  1FLK A;  1WEN A;  4R7E A;  2FSA A;  5J3X A;  1RMD A;  3PUR A;  3U5O A;  2KGG A;  2LRI C;  3HSV A;  1HYJ A;  4LAD B;  4GWN A;  3T6R A;  1E4U A;  2ECN A;  4O1V A;  5H1U A;  3C6W A;  3N9M A;  2LGK A;  5B77 A;  2C2L A;  2Y43 A;  3L11 A;  3KV5 A;  3LRQ A;  2UZG A;  1N87 A;  5TDR A;  2JMJ A;  2Y1M A;  4WZ2 A;  2M6M A;  2LGL A;  3N9Q A;  2LXH C;  3SOX A;  2MIQ A;  2LQ6 A;  4YAT A;  4P5O B;  1WEP A;  4N4F A;  5TRB A;  1WEU A;  4GND A;  5G0F A;  3U5N A;  3HTK C;  2KU3 A;  1WEV A;  4YBT A;  4V3K C;  2K1J A;  2PNX A;  3M99 A;  1ZMS A;  3HU6 A;  5B78 A;  3ZVZ B;  2KGI A;  1L0A A;  2FOO A;  2EGP A;  2F1Y A;  2XB1 A;  3MHS A;  4KG9 A;  4R8P K;  1CA4 A;  2K16 A;  2K17 A;  3N9O A;  3EB6 A;  3U5M A;  2H0D B;  4Q6F A;  1LB4 A;  2KWJ A;  2L80 A;  4FO9 A;  4S3O C;  2MA6 A;  4TKP B;  4K8U A;  4YSI A;  5KH3 A;  4QF2 A;  3M63 A;  2MUM A;  1WEM A;  4PPE A;  5C13 A;  4I7C A;  2RSD A;  2YUR A;  3MQS C;  3LQH A;  1FBV A;  3N9N A;  2Y1N A;  4WA6 A;  2G45 A;  4LLB A;  2QIC A;  5LKU A;  5TAB A;  1HYI A;  3HQM A;  1BOR A;  4A49 A;  5G04 B;  3HCT A;  5D1L B;  3IHP A;  4IC3 A;  4M4E A;  4IC2 A;  3T7L A;  1WFK A;  1X4J A;  2YQL A;  2EOD A;  2H0D A;  3GV4 A;  2YT5 A;  2F1Z A;  4WZ3 B;  3SOU A;  3HQI A;  2ECG A;  2JMD A;  2JRJ A;  5I3L A;  2KYU A;  3C5K A;  2F1X A;  2CKL B;  2GKW A;  2LGV A;  3O7A A;  4UI9 B;  2RI7 A;  1WGM A;  3IVB A;  5B8D A;  2CSY A;  1D0J A;  2L75 A;  3O33 A;  2MA5 A;  3ZYQ A;  4UP0 A;  2A25 A;  4I7D A;  1WEQ A;  1YZE A;  1Z6U A;  2VP7 A;  1WEW A;  5KH7 A;  4UP5 A;  5B79 A;  4L7X A;  1WIL A;  2VPB A;  3L1Z B;  4NN2 A;  2MNZ A;  5H1V A;  2KR4 A;  5DIN A;  1T1H A;  4Z8M A;  2ZET C;  2MT5 A;  3ZPV 1;  1IYM A;  1CZY A;  2MNY A;  5EYA F;  1WIM A;  5FB1 A;  3O37 A;  3KV6 A;  2L0B A;  4X3G A;  2KWO A;  2OXQ C;  2CKL A;  2NAA A;  5C11 A;  4GNF A;  5KH9 A;  4AP4 A;  2VJF B;  4ZDT A;  1F62 A;  4L58 A;  3LQI A;  3N9L A;  2YHN A;  2LDR A;  2F6N A;  2CSZ A;  1VD4 A;  1XWH A;  3O34 A;  5D1K B;  2FOP A;  1D01 A;  2CT2 A;  1LDJ B;  1X4I A;  3O36 A;  4W4U A;  2YSJ A;  4BHW A;  4MVT A;  2LV9 A;  2VPE A;  3I2D A;  3L1X A;  1RF3 A;  2C2V S;  3PHD A;  2KWK A;  5FER A;  2FUI A;  2YSM A;  2YYR A;  2VJF A;  2KFT A;  2FOJ A;  5B76 A;  3KNV A;  4B86 C;  1MM2 A;  5D1M B;  3ZVY A;  4FIP A;  5LKT A;  2KRE A;  2K4D A;  1Z60 A;  4FK5 A;  3ASL A;  1VYX A;  2M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...