2F1WA

Crystal structure of the traf-like domain of hausp/usp7
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
144
structure length
144
Chain Sequence
TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
publication title Structural Basis of Competitive Recognition of p53 and MDM2 by HAUSP/USP7: Implications for the Regulation of the p53-MDM2 Pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 144
sequence length 144
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00917 MATH MATH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.210.10 Mainly Beta Sandwich Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 2f1wA00
4CA1A 1CA9A 3IVQA 1D0JA 4GJHA 3MQSC 4O1VA 4K8UA 4I7DA 5H9MA 4GHUA 3HQIA 3IVVA 3HQLA 3ZJBA 1D0AA 4YSIA 4I7CA 1K2FA 3HQHA 1QSCA 2F1WA 2FOJA 1LB4A 3MQRA 2F1YA 1CZZA 1CZYA 1LB6A 1YZEA 4Z8MA 2XXNA 2CR2A 5E1TA 1D00A 2F1ZA 1FLLA 1RF3A 3HQMA 2AN6A 4GWNA 3HU6A 4JJQA 1D01A 1F3VB 2A25A 2F1XA 4C9ZA 1LB5A 1FLKA 2FOOA 4I7BA 4KG9A 1L0AA 3IVBA 1ZMSA 4M4EA 4X3GA 1YY6A 3HSVA 4GWMA 2GKWA 1KZZA 2FOPA 1CA4A
chains in the Genus database with same CATH superfamily
4CA1A 1CA9A 3IVQA 1D0JA 4GJHA 3MQSC 4O1VA 4K8UA 4I7DA 5H9MA 4GHUA 3HQIA 3IVVA 3HQLA 3ZJBA 1D0AA 4YSIA 4I7CA 1K2FA 3HQHA 1QSCA 2F1WA 2FOJA 1LB4A 3MQRA 2F1YA 1CZZA 1CZYA 1LB6A 1YZEA 4Z8MA 2XXNA 2CR2A 5E1TA 1D00A 2F1ZA 1FLLA 1RF3A 3HQMA 2AN6A 4GWNA 3HU6A 4JJQA 1D01A 1F3VB 2A25A 2F1XA 4C9ZA 1LB5A 1FLKA 2FOOA 4I7BA 4KG9A 1L0AA 3IVBA 1ZMSA 4M4EA 4X3GA 1YY6A 3HSVA 4GWMA 2GKWA 1KZZA 2FOPA 1CA4A
chains in the Genus database with same CATH topology
4CA1A 1CA9A 3IVQA 1D0JA 4GJHA 3MQSC 4O1VA 4K8UA 4I7DA 5H9MA 4GHUA 3HQIA 3IVVA 3HQLA 3ZJBA 1D0AA 4YSIA 4I7CA 1K2FA 3HQHA 1QSCA 2F1WA 2FOJA 1LB4A 3MQRA 2F1YA 1CZZA 1CZYA 1LB6A 1YZEA 4Z8MA 2XXNA 2CR2A 5E1TA 1D00A 2F1ZA 1FLLA 1RF3A 3HQMA 2AN6A 4GWNA 3HU6A 4JJQA 1D01A 1F3VB 2A25A 2F1XA 4C9ZA 1LB5A 1FLKA 2FOOA 4I7BA 4KG9A 1L0AA 3IVBA 1ZMSA 4M4EA 4X3GA 1YY6A 3HSVA 4GWMA 2GKWA 1KZZA 2FOPA 1CA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CA1 A;  1CA9 A;  3IVQ A;  1D0J A;  4GJH A;  3MQS C;  4O1V A;  4K8U A;  4I7D A;  5H9M A;  4GHU A;  3HQI A;  3IVV A;  3HQL A;  3ZJB A;  1D0A A;  4YSI A;  4I7C A;  1K2F A;  3HQH A;  1QSC A;  2F1W A;  2FOJ A;  1LB4 A;  3MQR A;  2F1Y A;  1CZZ A;  1CZY A;  1LB6 A;  1YZE A;  4Z8M A;  2XXN A;  2CR2 A;  5E1T A;  1D00 A;  2F1Z A;  1FLL A;  1RF3 A;  3HQM A;  2AN6 A;  4GWN A;  3HU6 A;  4JJQ A;  1D01 A;  1F3V B;  2A25 A;  2F1X A;  4C9Z A;  1LB5 A;  1FLK A;  2FOO A;  4I7B A;  4KG9 A;  1L0A A;  3IVB A;  1ZMS A;  4M4E A;  4X3G A;  1YY6 A;  3HSV A;  4GWM A;  2GKW A;  1KZZ A;  2FOP A;  1CA4 A; 
#chains in the Genus database with same CATH topology
 4CA1 A;  1CA9 A;  3IVQ A;  1D0J A;  4GJH A;  3MQS C;  4O1V A;  4K8U A;  4I7D A;  5H9M A;  4GHU A;  3HQI A;  3IVV A;  3HQL A;  3ZJB A;  1D0A A;  4YSI A;  4I7C A;  1K2F A;  3HQH A;  1QSC A;  2F1W A;  2FOJ A;  1LB4 A;  3MQR A;  2F1Y A;  1CZZ A;  1CZY A;  1LB6 A;  1YZE A;  4Z8M A;  2XXN A;  2CR2 A;  5E1T A;  1D00 A;  2F1Z A;  1FLL A;  1RF3 A;  3HQM A;  2AN6 A;  4GWN A;  3HU6 A;  4JJQ A;  1D01 A;  1F3V B;  2A25 A;  2F1X A;  4C9Z A;  1LB5 A;  1FLK A;  2FOO A;  4I7B A;  4KG9 A;  1L0A A;  3IVB A;  1ZMS A;  4M4E A;  4X3G A;  1YY6 A;  3HSV A;  4GWM A;  2GKW A;  1KZZ A;  2FOP A;  1CA4 A; 
#chains in the Genus database with same CATH homology
 4CA1 A;  1CA9 A;  3IVQ A;  1D0J A;  4GJH A;  3MQS C;  4O1V A;  4K8U A;  4I7D A;  5H9M A;  4GHU A;  3HQI A;  3IVV A;  3HQL A;  3ZJB A;  1D0A A;  4YSI A;  4I7C A;  1K2F A;  3HQH A;  1QSC A;  2F1W A;  2FOJ A;  1LB4 A;  3MQR A;  2F1Y A;  1CZZ A;  1CZY A;  1LB6 A;  1YZE A;  4Z8M A;  2XXN A;  2CR2 A;  5E1T A;  1D00 A;  2F1Z A;  1FLL A;  1RF3 A;  3HQM A;  2AN6 A;  4GWN A;  3HU6 A;  4JJQ A;  1D01 A;  1F3V B;  2A25 A;  2F1X A;  4C9Z A;  1LB5 A;  1FLK A;  2FOO A;  4I7B A;  4KG9 A;  1L0A A;  3IVB A;  1ZMS A;  4M4E A;  4X3G A;  1YY6 A;  3HSV A;  4GWM A;  2GKW A;  1KZZ A;  2FOP A;  1CA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...