The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
61
|
sequence length |
194
|
structure length |
194
|
Chain Sequence |
RPRSEEDNELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the stimulatory complex of GTP cyclohydrolase I and its feedback regulatory protein GFRP.
pubmed doi rcsb |
| molecule keywords |
GTP Cyclohydrolase I
|
| molecule tags |
Hydrolase/protein binding
|
| source organism |
Rattus norvegicus
|
| total genus |
61
|
| structure length |
194
|
| sequence length |
194
|
| chains with identical sequence |
B, C, D, E, F, G, H, I, J
|
| ec nomenclature |
ec
3.5.4.16: GTP cyclohydrolase I. |
| pdb deposition date | 2001-11-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01227 | GTP_cyclohydroI | GTP cyclohydrolase I |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | GTP Cyclohydrolase I; Chain A, domain 1 | GTP Cyclohydrolase I; Chain A, domain 1 | ||
| Alpha Beta | 2-Layer Sandwich | GTP Cyclohydrolase I, domain 2 | GTP Cyclohydrolase I, domain 2 |
#chains in the Genus database with same CATH superfamily 1NBU B; 3RZP A; 4AEY A; 2NM3 A; 1NBU A; 1NBU C; 3S19 A; 3O1K A; 1RRW A; 4UQF A; 1RS2 A; 3V9O A; 4IQI A; 1FBX A; 5FAR A; 1DHN A; 1FB1 A; 1SQL A; 1GTP A; 1WM9 A; 3RJ4 A; 1WUR A; 4GHM A; 1IS8 A; 1WPL A; 1A9C A; 5F3M A; 4DU6 A; 1RSD A; 1N3R A; 1RS4 A; 1Z9W A; 1A8R A; 1N3S A; 1RRI A; 3BP1 A; 1N3T A; 1RRY A; 2O90 A; 3R2E A; 4FGC A; 1B9L A; 3UXV A; 1RSI A; 3UXJ A; 2DHN A; 4F8B A; 2CG8 A; 2NM2 A; 1WUQ A; 1IS7 A; 1U68 A; #chains in the Genus database with same CATH topology 4AEY A; 4R8Q A; 3S19 A; 4UQF A; 1RS2 A; 4IQI A; 1FB1 A; 1GTP A; 3RJ4 A; 1WUR A; 2WSF G; 1A9C A; 4DU6 A; 1Z9W A; 1N3S A; 3BP1 A; 1N3T A; 2WSE G; 3BMB A; 4FGC A; 4NE5 B; 1RSI A; 3UXJ A; 4F8B A; 1WUQ A; 1IS7 A; 1U68 A; 2NM3 A; 4E44 B; 2O01 G; 1TFE A; 3V9O A; 2LNZ A; 4NE6 B; 1FBX A; 1EFU B; 2PN0 A; 1DHN A; 4GHM A; 1IS8 A; 4JA3 A; 3LW5 K; 1RS4 A; 1RRY A; 5DMZ A; 2CG8 A; 1AIP C; 2LO0 A; 1NBU B; 4E45 B; 1NBU A; 1NBU C; 1RRW A; 4NE3 B; 2WSF K; 1WM9 A; 1WPL A; 5F3M A; 3LW5 G; 2WSC K; 1RRI A; 3UXV A; 4DRB J; 3RZP A; 3O1K A; 4DRA E; 2KR1 A; 3VEJ A; 5FAR A; 4QPM A; 1SQL A; 3B0B C; 1EL6 A; 1RSD A; 1N3R A; 2P11 A; 4Q7J A; 2WSE K; 1A8R A; 2O90 A; 2WSC G; 3R2E A; 1B9L A; 2DHN A; 2NM2 A; #chains in the Genus database with same CATH homology 1NBU B; 3RZP A; 4E45 B; 2NM3 A; 1NBU A; 4R8Q A; 4E44 B; 1NBU C; 4AEY A; 3O1K A; 3S19 A; 1TFE A; 1RRW A; 4UQF A; 4DRA E; 1RS2 A; 3V9O A; 4NE3 B; 2LNZ A; 4IQI A; 4NE6 B; 1FBX A; 2KR1 A; 3VEJ A; 5FAR A; 1EFU B; 4QPM A; 2PN0 A; 1FB1 A; 1DHN A; 1SQL A; 1GTP A; 1WM9 A; 3RJ4 A; 1WUR A; 4GHM A; 3B0B C; 1IS8 A; 1WPL A; 1A9C A; 4JA3 A; 1EL6 A; 5F3M A; 4DU6 A; 1RSD A; 1N3R A; 2P11 A; 4Q7J A; 1RS4 A; 1Z9W A; 1A8R A; 1N3S A; 1RRI A; 3BP1 A; 1N3T A; 1RRY A; 5DMZ A; 2O90 A; 3BMB A; 3R2E A; 4FGC A; 1B9L A; 3UXV A; 4NE5 B; 1RSI A; 3UXJ A; 2DHN A; 4F8B A; 2CG8 A; 1AIP C; 2LO0 A; 2NM2 A; 1WUQ A; 4DRB J; 1IS7 A; 1U68 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...