The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
54
|
structure length |
54
|
Chain Sequence |
KVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The three-dimensional structure of the C-terminal DNA-binding domain of human Ku70.
pubmed rcsb |
| molecule tags |
Dna binding protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
THYROID AUTOANTIGEN
|
| total genus |
10
|
| structure length |
54
|
| sequence length |
54
|
| ec nomenclature | |
| pdb deposition date | 2001-07-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02037 | SAP | SAP domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | SAP domain |
#chains in the Genus database with same CATH superfamily 1JEQ A; 1H1J S; 2KVU A; 2KVE A; 4UZW A; 2RNN A; 4BIT A; 1ZBH A; 2RNO A; 2KVD A; 2WQG A; 2KW9 A; 2JVW A; 1JJR A; 1V66 A; #chains in the Genus database with same CATH topology 2KVU A; 2KVE A; 4BIT A; 2A8V A; 3LLR A; 2DK4 A; 1H9F A; 2LD7 A; 2ODG C; 1A63 A; 4UZW A; 1ZS9 A; 1GJJ A; 2QNF A; 1A62 A; 1KHC A; 2JVW A; 1JEQ A; 1GL9 B; 1GKU B; 1Y02 A; 3QKJ A; 2RNN A; 1ZBH A; 1E7L A; 2RNO A; 2KW9 A; 1E7D A; 1EN7 A; 3FLG A; 2G80 A; 5CIU A; 2QNC A; 2KFV A; 1YNS A; 1V66 A; 1A8V A; 2ODC I; 1JEI A; 1JJR A; 3L0O A; 1H1J S; 2W51 A; 1H9E A; 2WQG A; 2MPH A; 2KVD A; 2HJQ A; 2LC3 A; #chains in the Genus database with same CATH homology 1JEQ A; 1H1J S; 2KVU A; 2KVE A; 4UZW A; 2RNN A; 4BIT A; 1ZBH A; 2RNO A; 2KVD A; 2WQG A; 2KW9 A; 2JVW A; 1JJR A; 1V66 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
