5CIUA

Structural basis of the recognition of h3k36me3 by dnmt3b pwwp domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
127
Chain Sequence
b'EYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFDQLKPMLEWAHGGFKPTGIEGLKPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (cytosine-5)-methyltransferase 3B
molecule tags Transferase
source organism Homo sapiens
publication title Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.
pubmed doi rcsb
total genus 33
structure length 127
sequence length 136
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 5ciuA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ciuA01
3OMCA 1WGSA 3LGFA 2BIVA 2MWPA 1WJRA 4FU6A 3OY9A 2LCCA 2RHIA 3BDLA 2R5MA 2RHYA 4E7IA 5KH6A 4E7JA 2DAQA 2BUDA 5FROA 2L8DA 3P8DA 2L3RA 4NS5A 3OYCA 2RO0A 2RHUA 3L42A 3OYAA 3S3NA 4C5IA 4ZTFA 2M16A 5D6WA 5KCHA 4II1A 3L2QA 3FLGA 2X35A 3OYKA 5M9OA 5CIUA 4IUPA 4PL6A 3QIIA 3OYNA 3OYFA 4IKFA 3FEOA 2B8AA 2RHZA 3MEVA 3ZEHA 4RG2A 4BE0A 3OS2A 4L59A 4BE2A 2QQSA 4E7HA 2BKDN 2LVMA 2YRVA 4IUUA 4BDZA 2RJDA 3QBYA 3MP1A 4QQDA 2HQEA 5KE2A 2X4YA 3NTHA 4N4IA 3Q1JA 2FHDA 3OYHA 2GFAA 3GOXA 4N4GA 4QW2A 5FRNA 3ME9A 3QKJA 1OYXA 4IUQA 3OYLA 2VYTA 3DB4A 3OYIA 4B9XA 4C5GA 2E5QA 3O8VA 5C0MA 2NLUA 5IAYA 3EAEA 3OS0A 2MWOA 1MHNA 2M1HA 4C5EA 3L2VA 3ASKA 2M0OA 4IUTA 2K3XA 3QJ6A 3META 4IURA 4BACA 2PQWA 2E6NA 3OYMA 2EQKA 2IG0A 3P8HA 4A4EA 3S6WA 2O4XB 4LD6A 2RI5A 3NTKA 4PLLA 3OYEA 3L2UA 1RI0A 3H6ZA 3OQ5A 3PNWC 3OYBA 2XDPA 3OMGA 4ZTJA 1WJQA 2EKOA 2LTOA 4HCZA 2DIGA 2DIQA 2R58A 2LRQA 2RJFA 5C6SA 1SSFA 3UWNA 4QQ6A 3S3MA 1OI1A 5FRMA 2JZ2A 3E9GA 3LGLA 3UT1A 4A4FA 3L2WA 1H3ZA 3LX7A 3CEYA 4FL6A 3DLMA 2JTFA 3MP8A 5KE3A 2LDMA 4E7KA 1WJSA 2D9TA 2K3YA 1G5VA 5D6YA 1OZ3A 3FDRA 2GF7A 5IN1A 1OZ2A 3PFSA 2R5AA 2RHXA 4QVZA 3SD4A 2GFUA 4UC4A 4Q5WA 2L89A 4A4GA 2EQJA 1XNIA 2XK0A 2EQUA 3H8ZA 4BD3A 4BE1A 3C4SA 3OYJA 4QQGA 3M9QA 2QQRA 3E9FA 5KCOA 4IUVA 2X4XA 2RI3A 2RI2A 3DB3A 4PLIA 2G3RA 3OS1A 2CKKA 3OA6A 2HQXA 4Z02A 3PMTA 1N27A 4GY5A 5J26A 2X4WA 3LYIA 5D6XA 5J39A 2EQMA 3MP6A 4EDUA 4X34A 2EFIA 3MEUA 2O4XA 3S3OA 3OYDA 2P0KA 4CRIA 2WACA 3MEAA 3MEWA 4OVAA 3NTIA 3OYGA 4E7LA 3LLRA 2RJCA 4N4HA 3F70A 3PMIA 3L2RA 3LH0A 4C5HA 2F5KA 1KHCA 4B9WA 2R57A 3OB9A 2RJEA 3KUFA 4A4HA 4BDYA 3MO8A 3FC3A
chains in the Genus database with same CATH superfamily
1KFZA 2ECZA 4DOVA 2EYWA 4PK4A 3JCMP 3G6EQ 3VU3C 4M7DC 3A8LB 4FYWB 1T0HA 1OV3A 2MYSA 4C0DC 2LQWA 3VS5A 2LX9A 1QCNA 2RQTA 4J6YA 4OMOA 4EMHA 1B34A 3PVLA 2RJDA 3EG9B 2F2VA 2P0QA 1U1SA 3CPWP 2DL5A 1Y7XA 2QK0A 2HSPA 3O8VA 1QP3A 1IB8A 3OS0A 1MHNA 1I81A 2DRMA 4J9FA 3L2VA 4JRKA 4OB2B 2H3EB 5CKBA 3JCMQ 1GCPA 2CP6A 5CQYA 2LC4A 2W10A 1H1JS 5HY6A 1I1JA 2E64A 4BY6B 2KI7A 2DNUA 4F16A 2KVDA 1VQKQ 3JB9F 1BB9A 2NUTA 3A8GB 2CZ0B 1QP2A 3I5SA 3G71T 2O31A 2NUPA 1BCOA 1WHLA 5GAMe 5GMKm 4M7DD 4RTUA 1OEBA 3CCQA 2EJFA 2R5AA 4Q5WA 1YJNQ 2HJQA 2QEXA 1TG0A 3M9QA 4M75G 2FG0A 4OGCA 2QI2A 4OP0A 4HT8A 3JAME 4E47A 3PMTA 5CR2A 5J26A 1QVGA 3V8LA 2DZCA 4DBFA 4OVAA 2ZPFB 2HL5C 1WXBA 3L1AA 3J81E 1AVZC 1IHVA 3LH0A 1A62A 4M77A 2E6NA 1Y07A 1H8KA 4M75A 5IH2A 1A0NB 2ATCB 2CH4A 4FSXA 3P8DA 2KAFA 2ZPGB 1K4US 2AKLA 1H641 3HFOA 3OYKA 5FWCA 5GANh 1PM3A 3EH1A 1YCYA 4M7AC 2QQSA 1AOJA 1E7OA 1MV0B 4HVWA 1ZBXA 2HBWA 4RTTA 3GOXA 4N4GA 4QW2A 5LJ5j 5GAOl 2FPFA 3A8OB 4MZTA 4XQ3A 5FU6C 1R77A 2KVUA 5C0MA 4HXJA 3EGXB 2K79A 4RCCA 1WHKA 1RAEB 3CD6T 2EYQA 1X2QA 2HKQB 2A28A 3QG1A 1EIFA 1NE8A 5DM7R 1VQNQ 1MMNA 1VQ6Q 3HRUA 3I56Q 2A37A 1KD1U 4RTWA 4KGZB 8ATCB 2KT8A 1IHWA 1TTHB 3HHTB 2JM8A 1KIKA 1UGPB 2RA2A 3G4SA 4XU3A 4J6WA 5KE3A 2OTJA 1F1BB 4M77C 2CP5A 1M1FA 1D1AA 4M75C 5LL6S 1BI2A 4UC4A 3VS6A 1S72Q 2LQKA 4BE1A 3UF4A 1M1KC 2H3JA 3EH2A 2QDYB 3RNJA 1D1BA 2M0YA 4M75F 3C0CA 2EQMA 3MP6A 1FMWA 3RMSA 1BU1A 2VGMA 3FB9A 1YCSB 2F2XA 2F5KA 2L5QA 2RJEA 2DF6A 3KUFA 4LD6A 3CD6Q 4HT9A 4M7DE 1QWEA 1RUWA 5FU6B 3URGA 4FU6A 1WJRA 1C1AA 2GCXA 2RHIA 2RHYA 5KH6A 1YBYA 3M58A 2LP5A 2EGAA 1RL2A 4ANJA 1VQ9Q 1ZUYA 4V2SA 3AHUA 2YRCA 2YLBA 4PL6A 2A7YA 4TVRA 1VQPT 1TXQA 1K73R 5LJ5e 3OBWA 1IZ6A 4FIBA 1M90R 1AT1B 4Z8AA 1ZSZA 5KYWB 5KE2A 1UB4A 5GAN6 3VYHB 3OYHA 1JEIA 4HCCA 4KH0B 2VASA 2HDAA 3OYIA 2EWNA 3CCJA 2NLUA 1N8RR 2OTLQ 3VS2A 5GAMd 2M1HA 3ASKA 4IUTA 3UA6A 4CC2A 3JRZA 2V8IA 1S72A 1LNXA 3OW2A 4ESRA 1NLOC 3HSBA 4KULA 1ZUKA 2PU9B 2QQBA 4C8QB 2DYIA 1QVFP 2YDLA 3H6ZA 3WVDB 3RDVA 2E1HA 3CPWS 2I2LA 3EFRA 4HCKA 3G7ZA 1Q81C 5KYYB 1KK7A 1ZLMA 5A0LA 1WQ7A 3LGLA 3CXCP 2DZ9A 1ZSZC 4WF2A 1UJ0A 3TU4K 2L3SA 1MUZA 4FW2A 1YJWA 4AFQC 2AK5A 2CZ6B 1UGVA 3ZFJA 2A36A 1H9FA 2FL7A 3OYJA 2HKNA 1M90U 5L23A 3MCAB 1OU8A 4RMOA 2CT3A 4BITA 1YP5A 2RI2A 3CCUA 2KE9A 1M2OA 2CKKA 4LN2A 1VQMQ 1K73U 5GAN5 1PNJA 5CKDA 4C92A 1KQ2A 4XTXA 1UHCA 4KGVB 3JB9H 1M1KU 1M1GA 3ZL7C 2RK1A 1Z9QA 5GAN2 4LUDA 3CCJT 4J7FA 1WHHA 3CMET 2DE0X 2KXDA 3CC4A 1VYUA 4M78D 4MDWA 4A63B 2DD4A 2MI6A 3L42A 1SRLA 1W2BP 1K0XA 1JEQA 3GNFB 1VYVA 3FLGA 2DD5A 2OTJQ 2COYA 4LD9K 2A3LA 4M78G 2KBTA 4L59A 1W2BA 4BDZA 1WNLA 4D6WA 5L8RE 4J9IA 2X4YA 4JZ4A 3NTHA 2LNVA 2QG9B 1E6HA 3HRTA 5CK9A 5FLXE 3GBQA 4B9XA 1NJIU 3MKDA 2DO3A 1GXIE 4FSSA 2ENMA 2KVQG 1SHFA 2WQGA 2DFUA 1FMVA 4X1VA 1DJ7B 1VQ7Q 3THKA 3PNWC 3PIOA 2LTOA 5A0DA 2O9SA 2GTOA 1SSFA 4P5NA 1JJRA 1E6GA 1N5ZA 2JZ2A 3UT1A 5GAOm 3REBB 5GMKh 2K5LA 5GAN4 2DEUA 3FDRA 4DA4A 2GFUA 2DEQA 1VQNT 3PT9A 1JO8A 2BZ8A 2ROLA 4JZ3A 3CCRT 1YJWQ 4J9BA 2KY9A 1BBZA 4M7DB 2DXUA 2X4XA 1GL9B 2K3BA 2JUFA 3VV0A 4GLMA 1RAHB 1WI7A 4C0DB 5EG2A 4Z02A 4OB1B 2G6FX 3CCLQ 3OW2P 4X34A 3QUIA 3MEUA 1NEBA 5GANd 2CP7A 2CP0A 3M5AA 2BE7D 4ZGDB 4PJOC 3M56A 1HXDA 2A0FB 3JCMX 2QDLA 5GANg 2V8KA 5GAMf 2KGTA 1WGSA 3LGFA 1NPRA 1OU9A 1K73C 4PJOB 2LCCA 5LJ3h 3BDLA 2WSCE 2KR3A 5FROA 1W4SA 4NS5A 1M2VB 2C0IA 2KRNA 2MF2A 2DVEA 2JN0A 2DPPB 3OYNA 1I5LA 4KT0E 2RNAA 1M27C 1CSKA 4KGXB 4QVCA 1UFFA 2RNOA 2ODCI 1B7TA 1R8OB 3QKJA 4AFSC 3QO3A 1AWWA 3CBPA 2X4JA 4OB0B 1MGQA 4ZN1A 5CAIA 1CKAA 1X69A 3MPUB 2K3XA 3TREA 3META 3RKXA 1YITT 2LT4A 5ECAA 1Y02A 2YUPA 1RAAB 3CMAT 2EGEA 1TWBA 5IHIA 4M78E 2EJ9A 2QNFA 2DBKA 2ZPBB 2AZVA 2L0AA 3OMGA 2CREA 4JLIA 1KHIA 3M0QA 2PUKB 4ELZC 2IVWA 5C6SA 5FU7C 2OI3A 4M77B 1HSQA 1Q82C 1VQ8Q 1V66A 2QA4Q 1UDLA 1VQNA 2K57A 1SSHA 2BE9B 2KXCA 5I11A 3JCMV 4Z88A 1OZ3A 3U23A 2RMOA 2PNIA 2BZXA 1VQ4Q 4AT1B 1OPLA 2MMPA 4JDSA 3C4SA 4QQGA 1WPYA 3E9FA 2JMAA 4C92E 2EFIA 1ZBJA 2RQUA 2E3IA 2EVRA 1JBMA 3PMIA 2MK5A 4JJNK 1MMGA 2HD0A 3PVQA 2DJZA 4J7IA 2DJQA 1GCQC 2YUOA 1G3SA 2R5MA 1IO6A 2QTXA 2J6KA 1UHFA 2RHUA 4PJOF 3QHSA 1VQ5Q 2V26A 3X26B 3CXCS 3I35A 1T3SA 3LW5E 5CKEA 2C0TA 4M7AD 4IKFA 2MIOA 4E7HA 4RG2A 1VQ9A 3BY7A 3M59A 4AG1C 4PFPA 3GIBA 4QQDA 2YLCA 2KFVA 1OQKA 5A0GA 5AYFA 2CH4W 3EG1A 3CCQT 4M7AG 1RACB 1FWZA 2LQNA 2VC8A 3VKIA 3HL8A 1GL5A 3D7SB 1QMCA 3JCMh 4C8QC 4IURA 4NL2A 2D1XA 2O2OA 4LDWA 1TUDA 2KYBA 1NZ9A 3S6WA 2CZ7B 3JCMf 1KC8C 2DILA 3CCVA 2GQVA 1VQPQ 4PLLA 3H9NA 3OQ5A 3EGDB 1BIAA 1PSFA 2XD0A 2DIQA 4BY6C 2C06A 1PD0A 1SRMA 3GF5A 3SFMA 4PJOG 2CYZB 3M0UA 3CCRA 3LH5A 3LX7A 4F7UB 1M90C 2JTFA 2YT6A 2LDMA 1RADB 1VQ8A 4C92G 2GF7A 1Z9ZA 3CCEQ 5IN1A 2W51A 2QQAA 1YHQT 3HKSA 5IXBA 1VUBA 4LXCA 1JU5C 4M7DA 2DK4A 2LMJA 2B86A 2RQVA 1SHGA 5GAN7 1N27A 1M8VA 2KNBB 5KYUA 5I2SA 4OF1A 3MEWA 1NYGA 2HBPA 3NFCA 2V1QA 4B9WA 2XDDA 2JT4A 1YHQA 4J6XA 3ULRB 2J6FA 2V1RA 4EMKC 4ZGEB 4E7JA 1M1KR 2O9VA 2L3RA 4XAXB 5GAOq 2E70A 4M77G 1AZEA 5D6WA 5KCHA 2QA4A 1D3BA 3VS1A 9ATCB 4UZWA 1LPLA 4JRQA 1QCOA 3EGDA 3MP1A 4RG8A 4J9HA 2KT1A 1Y0MA 4C92D 2QASA 3QWXX 2HMAA 2SRCA 1WHJA 1QKWA 4Z89A 1O75A 4VUBA 2PZ1A 4FM4B 2QGFB 1PWTA 2IG0A 1D0ZA 1HYOA 1X6BA 2L3QA 5GAMj 4XTYA 3OYBA 2DMOA 1UTIA 2LC3A 3UDCA 1WHMA 5GANj 2J7IA 2RJFA 2EYZA 1ZX6A 1OI1A 3GPLA 2ROTA 4LE9A 1YWPA 1QKXA 4E7KA 3VUZA 3PFSA 3EG2A 3C95A 4A4GA 5CO7A 2XMFA 2XU8A 4XU0A 2C0OA 2K7AA 1YJNT 1B07A 1MMAA 1TSFA 3BE3A 3KBGA 3EFOA 4M7DG 3TEEA 3RKYA 1PD1A 1BK2A 3RESA 2XDBA 2HQXA 1LVKA 3FJ5A 1VOMA 4L6V5 2QGGA 3PE0A 2K4YA 3EHQA 2QNCA 2JOYA 1IREB 3CCRQ 2DX1A 3JCMb 2DVJA 2ABLA 1K8AU 1ABOA 3ZBDA 4NOYA 1AWXA 5KYYA 4BDYA 4OMMA 2LD7A 2GQIA 1HJDA 2E65A 3HFNA 2M9UA 1VQKT 4R0KA 3G4ST 4C0ZA 2DKGA 1PKTA 4Y28E 4FT4A 2LNHB 2RF0A 4F7UE 2O88A 3CC7A 1G83A 2RM4A 2J05A 1MNEA 2FZKB 2EAYA 5CKFA 2RH2A 3ME9A 3HTRA 2VXFA 1VQOQ 4HVVA 3SWNA 1T0JA 1WYXA 2K5IA 2OX7A 2X9HA 3O5ZA 1FXXA 1ZQ1A 4ZGJB 1K9MU 2XICA 3I55T 2DM1A 2O4XB 4M77F 3OYEA 3A8HB 3NTKA 2LJ1A 3VS4A 4C8QE 5FU7B 1WHGA 2HQHA 1K9AA 7AT1B 3PTAA 4A4FA 3CCST 2NYSA 5LJ3g 1P92A 3GLXA 5GAMh 2ZGWA 4RCBA 4LDXA 5LJ3d 1H92A 3KXTA 2HCKA 2VB6A 1WA7A 4BD3A 1Q82U 1VQLQ 1EZZB 4PJOA 1JRIA 2GNCA 3R6NA 1KSWA 1VQ4T 4DEYA 1VQ5A 3SEMA 3CC2Q 3OS5A 4EMKA 4OMFB 3C94A 1RABB 2X4WA 3QDRB 2KVEA 4JJDA 5CCAA 3HRSA 2L2PA 1KQ1A 2FYKA 1VQMA 3VRYA 2AT1B 2KYMA 1AEYA 2D8JA 1KHCA 2KSSA 1IRXA 3OB9A 5DLOA 1UJYA 3MO8A 2DXBA 1W2BS 1QVPA 2CSQA 5FWBA 5GMKj 2BUDA 4KH1B 5LJ3j 1GBRA 2L8DA 2K2MA 2LT1A 4C0GA 4N0AC 4ZTFA 3I55A 3ER0A 2JJ9A 3L2QA 1N8RC 4DEXA 2XIDA 3M57A 1K76A 1BI0A 5LJ5d 6AT1B 1UGQB 1HK9A 2BKDN 5GANf 1NYFA 4IUUA 4DQ2A 1RAGB 4RTZA 1WZOA 3TQ7P 2AKKA 3Q1JA 3CC4T 2E6ZA 1N6AA 2CP3A 3OYLA 2DERA 2D8HA 5IAYA 3CCEA 2CS7A 1VQ6T 4J9DA 2I0NA 3V7SA 5IXFA 2YUQA 2JM9A 2KEAA 4F7UF 2OJ2A 2RNNA 2CGHA 1N9SA 1N9RA 2DXCA 4JS4A 3EG0A 4HCZA 5A2QE 4ZN3A 1IGQA 2QA4T 4M78C 1EN7A 4MZMA 3TSWA 1QVFS 3L2WA 1H3ZA 3CEYA 2J06A 3REAB 3QZ5B 1PG5B 1WJSA 2D9TA 1G5VA 5D6YA 4LNPA 4M7AA 1KD1C 3SD4A 1O9SA 4PJJA 3HPWA 2COWA 3H8ZA 4M77D 1FMKA 5CKHA 2QQRA 4EPCA 4BUGA 4E7ZA 5IHNA 2DLPA 1CKBA 2MPXC 4PLIA 5HCKA 3M0TA 4A54A 3CC2A 3S3OA 1UGSB 2F2WA 1YIJT 1M3BA 3CCUT 2EYYA 4XTUA 3G71A 5LJ3e 1OZ2A 3HP9A 1N8RU 4MZPA 2JS2A 3M0SA 2OTLA 5LJ5f 1PSEA 2EJGA 3JCMe 2PVGB 1I07A 2F69A 4M7AE 2Y4YA 3OSVA 1FX7A 4FYYB 2X35A 3G6EA 3MEVA 2EKHA 1AZGB 2AHJB 1D3BB 5HKCA 1JB0E 2PTKA 4A53A 1K9MC 1MV3A 2JMCA 1Q82R 4M7AB 2GFAA 2LCLA 1LCKA 1ZUUA 3EAEA 2EGCA 2YRDA 2MWOA 5GAOp 1BI3A 3CC7T 2MCNA 2RD1A 3EHRA 5FW9A 3E1SA 3E2UA 2CZ1B 1H3HA 4RUGA 2LJ3A 2PQWA 5IT9E 1Q86C 2SEMA 1PRLC 3L2UA 3MJXA 3SWNC 4WTOB 2EKOA 2OAUA 3AT1B 5GJWB 4QT7A 1X01A 1NJIC 1KQSA 2E41A 1IXDA 1HD3A 1YJ9A 2RHXA 1A8VA 1M4ZA 2L89A 3R6OA 1XNIA 2EQJA 1W1FA 2VUBA 3CCUQ 5CVIA 4M75E 2CUBA 4FT2A 1D0XA 4IUVA 3N5BB 3OS1A 2G3RA 1Q7YR 2ZPEB 4J83A 3MHXA 2DA9A 1YIJA 3OA6A 1ZS9A 1G2BA 1GJJA 1I8FA 2MAMA 1YJNA 2VVKA 4E6RA 4KBMB 3BW1A 2HEQA 1Y71A 2FPDA 3KFVA 1QQJA 2A08A 2HSEB 1YNZA 3NTIA 4XTVA 4M7DF 4EIKA 3X28B 2OAWA 1LOJA 2IPOB 3VUBA 4A4HA 3OMCA 2X3XD 2E4HA 4PJOE 1OX8A 4E7IA 2DAQA 2A8VA 3OYCA 1KG1A 2COZA 4F7UG 3CC2T 3CCVT 1TOVA 3QSUA 4R55A 1RLPC 3H0HA 5KYXB 1KQSP 1VQPA 5KYNA 2DL4A 3ZEHA 2MOXA 2VV5A 4BE2A 2DL8A 3L2ZA 1XJWB 3X20B 3OSSC 1G3WA 2L3PA 3X24B 3CCSQ 5FRNA 4F14A 4E2FB 1Q95G 1T3LA 3CCMT 4C5EA 1VQ9T 2XHCA 4XTZA 1X6OA 3M0PA 2M0OA 1ZSGA 4ORZA 2O01E 3LWIA 1VYTA 2DTOA 3CQTA 2EW3A 4QVDA 1UGRB 3CCLA 2CUDA 1VQ5T 1VQ6A 2KW9A 1KD1R 2K9GA 1XQHA 3CBMA 4M75D 2YUNA 3DLMA 4ATOA 4PFZA 4FCYA 1V76A 5GAOn 4D8KA 4D8DA 3QXEB 1KC8R 2XK0A 2XI9A 1UG1A 2JTMA 2RPNA 3QZ9B 4JS5A 4CC3A 4J9CA 4LDYA 4MDXA 3TSZA 2QTVA 1Q81U 1YJ9Q 5GMKl 5IHKA 1M30A 3P8BB 1X43A 5GMKe 1SPKA 2ODGC 4NL3A 4E7LA 3MEAA 3CD6A 1TS9A 3I5RA 3JB9J 3PGGA 3CXCA 3CCMA 1S1NA 1YI2A 4IUQA 2VXEA 1YI2T 3G1JA 2BIVA 2MWPA 3CMAQ 4LDUA 4BI8B 2FRWA 1FYNA 1LJOA 1X75C 2VKNA 2DK3A 4II1A 1YHQQ 4LUEA 3EFOB 2NUTB 3VJPA 1JJ2A 2B8AA 2KRMA 2FZGB 3QWYA 4ME7A 2ZZDA 1UUEA 2LVMA 2YRVA 4R56A 1EX4A 3LWHA 5J3BA 1YITQ 3L0OA 2NWMA 2PVDB 2ESWA 4JRIA 1ZA2B 1M5Q1 1M2VA 2HAXA 1OYXA 2E10A 4C5GA 1H9EA 3CCSA 3CCJQ 4A4KA 3QJ6A 4RKUE 1U3OA 1K9MR 4MMKA 2QEXQ 2F1LA 2EQKA 3P8HA 1Q81R 4OMPA 4RTVA 1XTDA 2H8HA 3PIPA 2V8JA 1BIBA 3EG9A 5DLQE 1B34B 3M4YA 3H0FA 1J3TA 2RQWA 2E5KA 1U8RA 2IIMA 1R0BG 3MP8A 3JCMW 1JXOA 3NPFA 1D09B 3QYHB 1E7LA 2LJ0A 3A1PA 3FIFA 3I56T 1QWFA 2P4RA 1TH7A 2XG8D 1SF9A 1NM7A 1SG5A 2QAZA 2FB7A 4ELYC 3RUXA 1BI1A 1VQ4A 2DTHA 5GANe 1V29B 1QVGS 1WDXA 4JRPA 4B6MA 2O4XA 3OYDA 4CRIA 1OPKA 1YN8A 1ABQA 1YI2Q 3F70A 2KQWA 2R57A 3INZA 1RLQC 2FRYA 5HK0A 3JB9G 2DL7A 1VA7A 5KYUB 4EMGA 1YFNA 1K8AR 2RN8A 1K0SA 3CMAA 3OW2S 2DRKA 4RTYA 3CPWA 1VQ7A 3QIIA 3OYFA 2CSIA 1V1CA 4FYVB 1VQ7T 4BE0A 3QPHA 2CT4A 4HKEA 4PJMA 3OYYA 3V7RA 5LJ5g 2QQ9A 2HQEA 4OGEA 2ED0A 3CC7Q 4M78B 5LJ5h 1PC0A 2KROA 1YIJQ 1Q86U 3DB4A 4F7UA 4BI3A 1YNSA 2D6FA 1AHJB 1ZBHA 5GAN8 3T9NA 3NMZC 4M78F 4PFOA 3G71Q 3VS7A 4BB7A 2DTIA 2RI5A 1WLPB 2DETA 1RI0A 3JV3A 3H0IA 1RAFB 4FW1A 5AT1B 1AWJA 3CMEA 2LRQA 1G3TA 1WQWA 3UWNA 3S3MA 3IQLA 4OB3B 1U06A 1QCFA 2DXTA 3SB2A 1KQSS 4AFUC 1ACMB 3I56A 2VGNA 3M53A 4XU2A 2KMTA 3OBYA 2JNGA 1B3QA 1OOTA 3A8MB 3RMQA 5KCOA 1JXMA 3DB3A 2W0ZA 3CCVQ 2RB6A 4HVUA 8AT1B 4GBQA 1VQMT 1VQOA 1TU0B 2Y4XA 3RR6A 4GY5A 3EGUA 4ZNXA 4C8QD 3NHNA 3WXMB 2AZSA 4EDUA 3EG3A 2DYBA 4X9DA 1Y57A 2RJCA 4N4HA 2YXYA 3VS0A 3CCET 3FC3A 1WIEA 4C8QG 1GRIA 2KRSA 2CDTA 2RO0A 3OYAA 1GBQA 4C5IA 1GFDA 5KYWA 2M16A 1VQOT 3DLLA 3G6ET 5M9OA 4IUPA 5LJ3f 1S72T 3OS2A 1M3CA 4CC4B 2K6DA 3JCMJ 1WX6A 5HK3A 4J9EA 1VQLA 1R0CB 4C8QA 1UE9A 4M78A 4N4IA 3I9QA 2DL3A 2OTLT 2MPHA 4C0FA 1VQ8T 1SEMA 2E5QA 2J6OA 1PCXA 3M0RA 1C6VX 3V7CA 3RKWA 3UPUA 3DKMA 1ZA1B 4M7AF 5GAN3 4HCBA 5D7UA 2ZPHB 4JJCA 3M54A 1MMDA 2Z0WA 1VIFA 1GFCA 2QYZA 3RBBB 4PJLA 1NBEB 3QJYA 2QXFA 3QDFA 2JVVA 4QQ6A 1VQKA 4YTLA 4FL6A 2K3YA 1AD5A 1GCQA 5I21A 2PVOB 2HL3A 2OTJT 5GAMg 2JVWA 3UATA 4Y92A 2YHTA 2CP2A 2EQUA 1QVGP 1ZHIA 2ZAEA 1Q86R 1PRMC 3VRZA 1E7DA 4F04B 3V8KA 4KUIA 1M3AA 1NPPA 1NJIR 2JW4A 2F5TX 1NEGA 2P0KA 3H41A 2WACA 2AIRB 1UEBA 2WSEE 2DBMA 1W6XA 4C5HA 3SDZA 1QVFA 4L5GA 2M51A 3OY9A 4BI4A 1YJ9T 1Q7YC 5GAOr 2X51A 2PUOB 3NGPA 4LDVA 4EMKB 3CC4Q 1D0YA 4PJNA 3JCMd 3J7AF 3CBOA 3FEOA 2P84A 2VWFA 3JCMg 3V8JA 1EFNA 2D0QB 2LQ8A 4IIOA 2YSQA 4JJBA 2FPEA 1UECA 3JB9I 1SKUB 1Q7YU 1YITA 5GMKi 2G80A 2EIFA 2FEIA 2WSFE 4OMLA 3EGXA 4PNOA 3M4GA 4OMNA 1JEGA 1JJ2S 3JB9D 2FZCB 4HA8A 3OYMA 4A4EA 5CQXA 3CCMQ 2LCSA 1WFWA 2P0PA 4Y91A 3A5ZB 5I22A 3JSCA 1I0CA 2R58A 4OMQA 1D1CA 1WXTA 3SWNB 3E9GA 1JQQA 1BCMA 3RERA 1U1TA 2ZPIB 4O5VA 1VIEA 2NUZA 3TCJA 3GNGA 2LX7A 1ARKA 1RAIB 4M4ZA 2BZYA 2NUPB 4IIMA 2E3HA 3G4SQ 4M75B 4GLKA 1BYMA 3CCLT 1K1ZA 2GTJA 1TUGB 3FRNA 2GBQA 4JLGA 4QKUA 1PKSA 3LYIA 5D6XA 2JTEA 3VYGA 4KUDK 1X27A 4JPBW 2RK2A 3UA7A 4C92C 2LZ6B 2JS0A 1NG2A 1X2KA 2RQRA 1KJWA 2X3WD 4C92B 4DBQA 5DY9A 3JCMc 1U5SA 3FJPA 4RTXA 1QLYA 1G8XA 2EQIA 1GKUB 2Y90A 3S3NA 2FVUA 1YWOA 3VS3A 2K2VA 4AMCA 1JJ2P 1XOVA 4F17A 5CIUA 2E12A 3EFSA 3C12A 4XTWA 1M8MA 2RHZA 3TVTA 2ZCFB 4DOWA 4DBHA 2QEXT 2HNIA 4K11A 4XK8E 3QBYA 1KC8U 1C0MA 4JUVA 2GGRA 1OX9A 1AWOA 3BDUA 2FHDA 1X6GA 1NLPC 2VYTA 4AG2C 3J80E 4MMLA 4CC7A 4WCIA 2KK4A 2P4TA 3A98A 2ED1A 4XU1A 5KYXA 2KDSA 3SHWA 3RIRA 4BACA 3I55Q 3BFMA 1IGUA 2K5FA 1M9SA 1TUCA 2EPDA 2XDPA 4ZTJA 3M55A 1WJQA 1QW1A 4KRTA 3WVEB 5GJVB 4O6JA 2DIGA 4DBRA 4M77E 2EYXA 5FRMA 4N0AA 1I4K1 4C8QF 1BKBA 1W70A 4AFZC 1RI9A 3CMEQ 3X25B 4J8OA 1YJWT 1G3YA 1WXUA 5EC7A 1ZSZB 2BTTA 2HZYA 4QVZA 1VQLT 3QYGB 1Y96B 1PHTA 5I2MA 2RI3A 1K8AC 4J5YA 4X9CA 3CCQQ 3E19A 3GP8A 4PKCC 1A63A 4FYXB 2FO0A 2M02A 5J39A 4J9GA 4CI0C 3CPFA 2YWWA 4E7SA 1MNDA 3OYGA 3LLRA 1I5OB 1OULA 2EBPA 4C92F 2D0NA 3L2RA 4PJOD 2XKOC 2JXBA 1Y96A
chains in the Genus database with same CATH topology
1WGSA 3LGFA 1NPRA 1K73C 4PJOB 1W2BS 4DOVA 1QVPA 2LCCA 5LJ3h 3BDLA 5GMKj 5HK0A 2WSCE 3JB9G 3JCMP 2BUDA 5LJ3j 5FROA 2L8DA 1W4SA 4NS5A 4EMGA 3VU3C 4M7DC 3A8LB 2LT1A 4C0GA 4N0AC 4ZTFA 2MF2A 3I55A 2DVEA 2JN0A 3ER0A 4C0DC 1N8RC 2LX9A 3L2QA 2DPPB 3CMAA 3OW2S 3CPWA 2XIDA 3OYNA 1VQ7A 3M57A 3QIIA 3OYFA 1BI0A 5LJ5d 4KT0E 1I5LA 1VQ7T 4BE0A 1UGQB 4J6YA 1HK9A 2BKDN 1B34A 3QPHA 4HKEA 4IUUA 4DQ2A 4EMHA 2RJDA 4QVCA 5GANf 3OYYA 3V7RA 5LJ5g 2P0QA 2QQ9A 2HQEA 4OGEA 1U1SA 4M78B 5LJ5h 3Q1JA 3CC4T 2E6ZA 1R8OB 3QKJA 1N6AA 1Y7XA 3DB4A 3QO3A 4BI3A 4F7UA 3OYLA 1Q86U 2D6FA 3O8VA 1QP3A 5IAYA 3OS0A 1AHJB 3CCEA 1MHNA 2CS7A 5GAN8 3T9NA 3CBPA 2X4JA 4OB0B 1I81A 1MGQA 4ZN1A 5CAIA 3L2VA 1VQ6T 2K3XA 3TREA 3META 3RKXA 4JRKA 4M78F 1YITT 4OB2B 2LT4A 3V7SA 5CKBA 3CMAT 2OTLT 3JCMQ 4BB7A 5CQYA 2LC4A 5HY6A 2DTIA 2RI5A 4M78E 2E64A 2EJ9A 1RI0A 4BY6B 4F7UF 2ZPBB 3OMGA 2CGHA 1N9SA 4JLIA 1N9RA 2DXCA 1KHIA 4JS4A 4HCZA 5A2QE 3CMEA 2PUKB 3JB9F 2LRQA 1G3TA 4ZN3A 4ELZC 2IVWA 1WQWA 3UWNA 5C6SA 3S3MA 4OB3B 4M78C 5FU7C 2QA4T 4M77B 4MZMA 3A8GB 1Q82C 1QVFS 2CZ0B 3L2WA 2DXTA 3SB2A 3CEYA 1H3ZA 1KQSS 1QP2A 1VQNA 2K57A 3QZ5B 3I56A 3G71T 1WJSA 2D9TA 2VGNA 5GAMe 3JCMV 5D6YA 1OZ3A 5GMKm 4M7DD 3M53A 4M7AA 1G5VA 1KD1C 3CCQA 4XU2A 2EJFA 3SD4A 2R5AA 2KMTA 1O9SA 3OBYA 4Q5WA 3HPWA 2JNGA 2MMPA 3H8ZA 4M77D 4JDSA 3C4SA 2QEXA 4QQGA 3M9QA 3A8MB 2QQRA 4M75G 5CKHA 1WPYA 3E9FA 3RMQA 4BUGA 4OGCA 4EPCA 5KCOA 2QI2A 3DB3A 4OP0A 4PLIA 2RB6A 4HT8A 1VQMT 3JAME 4E47A 1VQOA 2Y4XA 3PMTA 4GY5A 4A54A 5J26A 4C8QD 5CR2A 1QVGA 3WXMB 4C92E 3V8LA 4EDUA 3CC2A 2EFIA 3S3OA 1UGSB 2DZCA 1YIJT 4X9DA 4OVAA 2ZPFB 2RJCA 3CCUT 3L1AA 1JBMA 4N4HA 3J81E 3PMIA 4XTUA 3G71A 3LH0A 4M77A 5LJ3e 2E6NA 1OZ2A 1Y07A 4JJNK 3HP9A 3CCET 3FC3A 1N8RU 4MZPA 2HD0A 2DJZA 4J7IA 4M75A 4C8QG 1G3SA 2R5MA 2OTLA 5LJ5f 4FSXA 2QTXA 1PSEA 2EJGA 5GANe 3P8DA 2KAFA 3JCMe 2PVGB 2RO0A 2RHUA 2ZPGB 3OYAA 2F69A 4PJOF 3QHSA 4C5IA 4M7AE 3X26B 2Y4YA 2M16A 1VQOT 3CXCS 3DLLA 3OSVA 5CKEA 1H641 3LW5E 1FX7A 3HFOA 3G6ET 2X35A 3OYKA 5M9OA 4M7AD 4IUPA 5LJ3f 5GANh 1S72T 4IKFA 4M7AG 1YCYA 3MEVA 3G6EA 4RG2A 4E7HA 3OS2A 1VQ9A 4M7AC 2QQSA 2AHJB 1D3BB 3BY7A 1JB0E 5HKCA 4A53A 3JCMJ 1K9MC 3M59A 3GIBA 5HK3A 4QQDA 2YLCA 1VQLA 4C8QA 4M7AB 5A0GA 1ZBXA 5AYFA 4M78A 4N4IA 3CCQT 2GFAA 3GOXA 4N4GA 4QW2A 2LCLA 5LJ5j 4C0FA 5GAOl 1VQ8T 3A8OB 4MZTA 1FWZA 4XQ3A 5FU6C 2E5QA 5C0MA 2VC8A 3VKIA 3EAEA 3HL8A 2MWOA 5GAOp 1BI3A 3CC7T 3V7CA 2RD1A 3RKWA 3UPUA 3DKMA 4RCCA 4M7AF 3E1SA 4PJOD 5GAN3 3JCMh 2CZ1B 4HCBA 4C8QC 2EYQA 4IURA 4NL2A 3CD6T 2PQWA 2ZPHB 3M54A 4LDWA 1VIFA 5IT9E 1NZ9A 3S6WA 2CZ7B 3QG1A 3JCMf 1Q86C 1EIFA 1NE8A 1KC8C 3CCVA 2GQVA 5DM7R 4PLLA 3L2UA 3HRUA 3OQ5A 3SWNC 2EKOA 1KD1U 2OAUA 1BIAA 1PSFA 2XD0A 3QJYA 2DIQA 2QXFA 4BY6C 1X01A 3HHTB 2C06A 1UGPB 2JVVA 2RA2A 3GF5A 4QQ6A 3SFMA 3G4SA 1NJIC 4XU3A 4PJOG 1KQSA 1VQKA 4J6WA 2CYZB 4YTLA 3CCRA 3LX7A 4FL6A 4F7UB 1M90C 2E41A 2JTFA 5KE3A 2LDMA 2K3YA 2OTJA 4M77C 1VQ8A 4C92G 1M1FA 5I21A 4M75C 2GF7A 1BI2A 2PVOB 5LL6S 5IN1A 2QQAA 2OTJT 5GAMg 1YJ9A 2RHXA 1YHQT 4UC4A 1M4ZA 2L89A 2YHTA 3R6OA 1XNIA 2EQJA 3HKSA 2VUBA 2EQUA 2LQKA 4BE1A 5CVIA 1VUBA 1ZHIA 4M75E 4FT2A 4IUVA 4M7DA 3N5BB 3OS1A 2G3RA 1M1KC 2ZPEB 3MHXA 4J83A 2H3JA 1YIJA 2QDYB 3OA6A 3V8KA 4KUIA 5GAN7 4M75F 1I8FA 1N27A 2MAMA 1YJNA 4KBMB 2EQMA 3BW1A 3MP6A 1NPPA 1Y71A 1M8VA 5I2SA 3RMSA 4OF1A 2F5TX 2P0KA 2WACA 3MEWA 3NTIA 4XTVA 2HBPA 4M7DF 2VGMA 3X28B 1UEBA 1LOJA 3FB9A 2WSEE 3NFCA 3VUBA 4C5HA 2F5KA 3SDZA 2L5QA 4B9WA 2XDDA 2RJEA 3KUFA 1Y96A 4LD6A 4A4HA 4HT9A 4M7DE 3OMCA 1QVFA 4L5GA 5FU6B 3URGA 4FU6A 1WJRA 1YHQA 3OY9A 2GCXA 4J6XA 4BI4A 2RHIA 1YJ9T 4PJOE 2RHYA 4ZGEB 4E7IA 4EMKC 5KH6A 4E7JA 2DAQA 1YBYA 1Q7YC 5GAOr 2PUOB 3M58A 4LDVA 2L3RA 1RL2A 3OYCA 1KG1A 4XAXB 5GAOq 2E70A 4F7UG 3CC2T 4EMKB 4V2SA 3CCVT 4M77G 3QSUA 4R55A 5D6WA 5KCHA 2QA4A 3JCMd 3AHUA 3J7AF 1D3BA 1VQPA 2YLBA 4PL6A 2A7YA 4TVRA 1VQPT 3CBOA 3FEOA 3ZEHA 2VV5A 4BE2A 4JRQA 3JCMg 3V8JA 5LJ5e 3OBWA 1IZ6A 2D0QB 4FIBA 3MP1A 2LQ8A 4RG8A 3L2ZA 5KE2A 1UB4A 5GAN6 3X20B 3JB9I 3VYHB 3OSSC 3OYHA 1Q7YU 1G3WA 1YITA 3X24B 5GMKi 4HCCA 5FRNA 4C92D 2EIFA 3OYIA 2EWNA 2WSFE 3CCJA 2NLUA 4PNOA 3M4GA 5GAMd 2M1HA 3CCMT 4C5EA 1O75A 4VUBA 2XHCA 1VQ9T 4XTZA 1X6OA 3ASKA 2M0OA 4IUTA 4FM4B 3JRZA 2V8IA 1S72A 1JJ2S 1LNXA 3JB9D 4HA8A 3OYMA 3OW2A 2IG0A 4A4EA 5CQXA 3HSBA 4KULA 2O01E 5GAMj 3LWIA 2PU9B 2QQBA 4XTYA 4C8QB 2DTOA 3OYBA 2P0PA 3H6ZA 4Y91A 3WVDB 3A5ZB 4QVDA 1UGRB 3CCLA 2E1HA 1VQ5T 3UDCA 3JSCA 3CPWS 5GANj 1VQ6A 2R58A 2I2LA 3EFRA 2RJFA 3G7ZA 3SWNB 1Q81C 1OI1A 5A0LA 3E9GA 3GPLA 1XQHA 1WQ7A 3CBMA 3LGLA 4M75D 2DZ9A 3RERA 1U1TA 2ZPIB 3DLMA 4O5VA 1VIEA 4WF2A 3TU4K 3TCJA 4ATOA 4E7KA 3VUZA 3GNGA 5GAOn 1YJWA 3PFSA 2CZ6B 3C95A 4A4GA 5CO7A 2XU8A 3QXEB 2XK0A 4XU0A 3ZFJA 4M75B 4GLKA 2XI9A 1YJNT 2FL7A 3OYJA 3QZ9B 2JTMA 1BYMA 1M90U 4JS5A 3MCAB 3KBGA 4RMOA 4M7DG 3TEEA 4LDYA 2RI2A 3CCLT 3RKYA 3CCUA 4MDXA 2CKKA 3RESA 1Q81U 2XDBA 2HQXA 5GMKl 3FRNA 3P8BB 4JLGA 1K73U 5GAN5 3LYIA 5D6XA 5GMKe 5CKDA 4L6V5 2K4YA 4NL3A 3VYGA 4E7LA 3MEAA 2JOYA 4KUDK 4C92A 1KQ2A 4XTXA 3CD6A 1IREB 3JB9J 3JCMb 1K8AU 3JB9H 3PGGA 1M1KU 2RK2A 3CXCA 1M1GA 4C92C 3ZBDA 4NOYA 2RK1A 3CCMA 1YI2A 5GAN2 4IUQA 2VXEA 4BDYA 1YI2T 3CCJT 4J7FA 2BIVA 2MWPA 4LDUA 4C92B 5DY9A 4BI8B 3CMET 3JCMc 3CC4A 4M78D 4MDWA 2E65A 2DD4A 3FJPA 3HFNA 2MI6A 3L42A 3S3NA 2Y90A 1LJOA 2FVUA 2M9UA 1VQKT 1X75C 3G4ST 4C0ZA 2K2VA 2DK3A 2DKGA 3GNFB 4II1A 3FLGA 4FT4A 1XOVA 4Y28E 2DD5A 4LD9K 5CIUA 2A3LA 2E12A 3EFSA 3VJPA 1JJ2A 3C12A 4XTWA 4M78G 2B8AA 2RHZA 4L59A 4ME7A 2ZCFB 2ZZDA 4F7UE 2LVMA 4DOWA 1W2BA 2QEXT 2YRVA 4R56A 3LWHA 2HNIA 1WNLA 5J3BA 4XK8E 3QBYA 4D6WA 3CC7A 4BDZA 1KC8U 5L8RE 2RM4A 4JUVA 2X4YA 2PVDB 3NTHA 4JRIA 2FHDA 2LNVA 3BDUA 1M5Q1 2EAYA 5CKFA 2RH2A 3ME9A 2HAXA 1OYXA 3HRTA 5CK9A 2VYTA 2VXFA 5FLXE 2E10A 4B9XA 4C5GA 3J80E 1NJIU 4MMLA 3SWNA 3CCSA 2DO3A 2KK4A 2P4TA 1GXIE 2KVQG 4XU1A 2KDSA 4A4KA 3QJ6A 2K5IA 4RKUE 3RIRA 4MMKA 4BACA 1FXXA 1ZQ1A 4ZGJB 2EQKA 1K9MU 2XICA 3P8HA 3BFMA 1DJ7B 3I55T 1XTDA 2K5FA 3PIPA 1M9SA 2V8JA 2O4XB 4M77F 3OYEA 3A8HB 3NTKA 1BIBA 3PNWC 3PIOA 2XDPA 4C8QE 3M55A 4ZTJA 1WJQA 5DLQE 1B34B 5FU7B 1QW1A 3M4YA 2LTOA 3WVEB 4O6JA 5A0DA 2DIGA 4M77E 5FRMA 1SSFA 4N0AA 1I4K1 4P5NA 2JZ2A 4C8QF 1BKBA 3PTAA 3UT1A 4A4FA 5GAOm 1U8RA 3CCST 5LJ3g 3MP8A 3JCMW 1P92A 3X25B 5GMKh 3GLXA 2K5LA 3QYHB 4J8OA 5GAMh 5GAN4 1G3YA 2ZGWA 3FDRA 1YJWT 4RCBA 4DA4A 4LDXA 5LJ3d 3KXTA 3FIFA 4QVZA 3I56T 2GFUA 2DEQA 1VQNT 3PT9A 1VQLT 1TH7A 2XG8D 3CCRT 4BD3A 1Q82U 4PJOA 3QYGB 2KY9A 1Y96B 1JRIA 4M7DB 2FB7A 1VQ4T 2DXUA 4ELYC 5I2MA 2X4XA 1VQ5A 2RI3A 3RUXA 1K8AC 4J5YA 3VV0A 2JUFA 1BI1A 4X9CA 1VQ4A 3OS5A 4C0DB 2DTHA 5EG2A 3E19A 4Z02A 4EMKA 1V29B 3C94A 4OB1B 4OMFB 4PKCC 3GP8A 1QVGS 4JRPA 2X4WA 5J39A 3QDRB 5CCAA 4X34A 3QUIA 3MEUA 3CPFA 2O4XA 3HRSA 4CI0C 5GANd 1KQ1A 3OYDA 2FYKA 3M5AA 4CRIA 1VQMA 4ZGDB 3OYGA 3LLRA 3F70A 4PJOC 4C92F 3M56A 1HXDA 3JCMX 3L2RA 5GANg 2V8KA 2KQWA 1KHCA 2KSSA 2R57A 3OB9A 5DLOA 5GAMf 3INZA 2XKOC 3MO8A 2DXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMC A;  1WGS A;  3LGF A;  2BIV A;  2MWP A;  1WJR A;  4FU6 A;  3OY9 A;  2LCC A;  2RHI A;  3BDL A;  2R5M A;  2RHY A;  4E7I A;  5KH6 A;  4E7J A;  2DAQ A;  2BUD A;  5FRO A;  2L8D A;  3P8D A;  2L3R A;  4NS5 A;  3OYC A;  2RO0 A;  2RHU A;  3L42 A;  3OYA A;  3S3N A;  4C5I A;  4ZTF A;  2M16 A;  5D6W A;  5KCH A;  4II1 A;  3L2Q A;  3FLG A;  2X35 A;  3OYK A;  5M9O A;  5CIU A;  4IUP A;  4PL6 A;  3QII A;  3OYN A;  3OYF A;  4IKF A;  3FEO A;  2B8A A;  2RHZ A;  3MEV A;  3ZEH A;  4RG2 A;  4BE0 A;  3OS2 A;  4L59 A;  4BE2 A;  2QQS A;  4E7H A;  2BKD N;  2LVM A;  2YRV A;  4IUU A;  4BDZ A;  2RJD A;  3QBY A;  3MP1 A;  4QQD A;  2HQE A;  5KE2 A;  2X4Y A;  3NTH A;  4N4I A;  3Q1J A;  2FHD A;  3OYH A;  2GFA A;  3GOX A;  4N4G A;  4QW2 A;  5FRN A;  3ME9 A;  3QKJ A;  1OYX A;  4IUQ A;  3OYL A;  2VYT A;  3DB4 A;  3OYI A;  4B9X A;  4C5G A;  2E5Q A;  3O8V A;  5C0M A;  2NLU A;  5IAY A;  3EAE A;  3OS0 A;  2MWO A;  1MHN A;  2M1H A;  4C5E A;  3L2V A;  3ASK A;  2M0O A;  4IUT A;  2K3X A;  3QJ6 A;  3MET A;  4IUR A;  4BAC A;  2PQW A;  2E6N A;  3OYM A;  2EQK A;  2IG0 A;  3P8H A;  4A4E A;  3S6W A;  2O4X B;  4LD6 A;  2RI5 A;  3NTK A;  4PLL A;  3OYE A;  3L2U A;  1RI0 A;  3H6Z A;  3OQ5 A;  3PNW C;  3OYB A;  2XDP A;  3OMG A;  4ZTJ A;  1WJQ A;  2EKO A;  2LTO A;  4HCZ A;  2DIG A;  2DIQ A;  2R58 A;  2LRQ A;  2RJF A;  5C6S A;  1SSF A;  3UWN A;  4QQ6 A;  3S3M A;  1OI1 A;  5FRM A;  2JZ2 A;  3E9G A;  3LGL A;  3UT1 A;  4A4F A;  3L2W A;  1H3Z A;  3LX7 A;  3CEY A;  4FL6 A;  3DLM A;  2JTF A;  3MP8 A;  5KE3 A;  2LDM A;  4E7K A;  1WJS A;  2D9T A;  2K3Y A;  1G5V A;  5D6Y A;  1OZ3 A;  3FDR A;  2GF7 A;  5IN1 A;  1OZ2 A;  3PFS A;  2R5A A;  2RHX A;  4QVZ A;  3SD4 A;  2GFU A;  4UC4 A;  4Q5W A;  2L89 A;  4A4G A;  2EQJ A;  1XNI A;  2XK0 A;  2EQU A;  3H8Z A;  4BD3 A;  4BE1 A;  3C4S A;  3OYJ A;  4QQG A;  3M9Q A;  2QQR A;  3E9F A;  5KCO A;  4IUV A;  2X4X A;  2RI3 A;  2RI2 A;  3DB3 A;  4PLI A;  2G3R A;  3OS1 A;  2CKK A;  3OA6 A;  2HQX A;  4Z02 A;  3PMT A;  1N27 A;  4GY5 A;  5J26 A;  2X4W A;  3LYI A;  5D6X A;  5J39 A;  2EQM A;  3MP6 A;  4EDU A;  4X34 A;  2EFI A;  3MEU A;  2O4X A;  3S3O A;  3OYD A;  2P0K A;  4CRI A;  2WAC A;  3MEA A;  3MEW A;  4OVA A;  3NTI A;  3OYG A;  4E7L A;  3LLR A;  2RJC A;  4N4H A;  3F70 A;  3PMI A;  3L2R A;  3LH0 A;  4C5H A;  2F5K A;  1KHC A;  4B9W A;  2R57 A;  3OB9 A;  2RJE A;  3KUF A;  4A4H A;  4BDY A;  3MO8 A;  3FC3 A; 
#chains in the Genus database with same CATH topology
 1KFZ A;  2ECZ A;  4DOV A;  2EYW A;  4PK4 A;  3JCM P;  3G6E Q;  3VU3 C;  4M7D C;  3A8L B;  4FYW B;  1T0H A;  1OV3 A;  2MYS A;  4C0D C;  2LQW A;  3VS5 A;  2LX9 A;  1QCN A;  2RQT A;  4J6Y A;  4OMO A;  4EMH A;  1B34 A;  3PVL A;  2RJD A;  3EG9 B;  2F2V A;  2P0Q A;  1U1S A;  3CPW P;  2DL5 A;  1Y7X A;  2QK0 A;  2HSP A;  3O8V A;  1QP3 A;  1IB8 A;  3OS0 A;  1MHN A;  1I81 A;  2DRM A;  4J9F A;  3L2V A;  4JRK A;  4OB2 B;  2H3E B;  5CKB A;  3JCM Q;  1GCP A;  2CP6 A;  5CQY A;  2LC4 A;  2W10 A;  1H1J S;  5HY6 A;  1I1J A;  2E64 A;  4BY6 B;  2KI7 A;  2DNU A;  4F16 A;  2KVD A;  1VQK Q;  3JB9 F;  1BB9 A;  2NUT A;  3A8G B;  2CZ0 B;  1QP2 A;  3I5S A;  3G71 T;  2O31 A;  2NUP A;  1BCO A;  1WHL A;  5GAM e;  5GMK m;  4M7D D;  4RTU A;  1OEB A;  3CCQ A;  2EJF A;  2R5A A;  4Q5W A;  1YJN Q;  2HJQ A;  2QEX A;  1TG0 A;  3M9Q A;  4M75 G;  2FG0 A;  4OGC A;  2QI2 A;  4OP0 A;  4HT8 A;  3JAM E;  4E47 A;  3PMT A;  5CR2 A;  5J26 A;  1QVG A;  3V8L A;  2DZC A;  4DBF A;  4OVA A;  2ZPF B;  2HL5 C;  1WXB A;  3L1A A;  3J81 E;  1AVZ C;  1IHV A;  3LH0 A;  1A62 A;  4M77 A;  2E6N A;  1Y07 A;  1H8K A;  4M75 A;  5IH2 A;  1A0N B;  2ATC B;  2CH4 A;  4FSX A;  3P8D A;  2KAF A;  2ZPG B;  1K4U S;  2AKL A;  1H64 1;  3HFO A;  3OYK A;  5FWC A;  5GAN h;  1PM3 A;  3EH1 A;  1YCY A;  4M7A C;  2QQS A;  1AOJ A;  1E7O A;  1MV0 B;  4HVW A;  1ZBX A;  2HBW A;  4RTT A;  3GOX A;  4N4G A;  4QW2 A;  5LJ5 j;  5GAO l;  2FPF A;  3A8O B;  4MZT A;  4XQ3 A;  5FU6 C;  1R77 A;  2KVU A;  5C0M A;  4HXJ A;  3EGX B;  2K79 A;  4RCC A;  1WHK A;  1RAE B;  3CD6 T;  2EYQ A;  1X2Q A;  2HKQ B;  2A28 A;  3QG1 A;  1EIF A;  1NE8 A;  5DM7 R;  1VQN Q;  1MMN A;  1VQ6 Q;  3HRU A;  3I56 Q;  2A37 A;  1KD1 U;  4RTW A;  4KGZ B;  8ATC B;  2KT8 A;  1IHW A;  1TTH B;  3HHT B;  2JM8 A;  1KIK A;  1UGP B;  2RA2 A;  3G4S A;  4XU3 A;  4J6W A;  5KE3 A;  2OTJ A;  1F1B B;  4M77 C;  2CP5 A;  1M1F A;  1D1A A;  4M75 C;  5LL6 S;  1BI2 A;  4UC4 A;  3VS6 A;  1S72 Q;  2LQK A;  4BE1 A;  3UF4 A;  1M1K C;  2H3J A;  3EH2 A;  2QDY B;  3RNJ A;  1D1B A;  2M0Y A;  4M75 F;  3C0C A;  2EQM A;  3MP6 A;  1FMW A;  3RMS A;  1BU1 A;  2VGM A;  3FB9 A;  1YCS B;  2F2X A;  2F5K A;  2L5Q A;  2RJE A;  2DF6 A;  3KUF A;  4LD6 A;  3CD6 Q;  4HT9 A;  4M7D E;  1QWE A;  1RUW A;  5FU6 B;  3URG A;  4FU6 A;  1WJR A;  1C1A A;  2GCX A;  2RHI A;  2RHY A;  5KH6 A;  1YBY A;  3M58 A;  2LP5 A;  2EGA A;  1RL2 A;  4ANJ A;  1VQ9 Q;  1ZUY A;  4V2S A;  3AHU A;  2YRC A;  2YLB A;  4PL6 A;  2A7Y A;  4TVR A;  1VQP T;  1TXQ A;  1K73 R;  5LJ5 e;  3OBW A;  1IZ6 A;  4FIB A;  1M90 R;  1AT1 B;  4Z8A A;  1ZSZ A;  5KYW B;  5KE2 A;  1UB4 A;  5GAN 6;  3VYH B;  3OYH A;  1JEI A;  4HCC A;  4KH0 B;  2VAS A;  2HDA A;  3OYI A;  2EWN A;  3CCJ A;  2NLU A;  1N8R R;  2OTL Q;  3VS2 A;  5GAM d;  2M1H A;  3ASK A;  4IUT A;  3UA6 A;  4CC2 A;  3JRZ A;  2V8I A;  1S72 A;  1LNX A;  3OW2 A;  4ESR A;  1NLO C;  3HSB A;  4KUL A;  1ZUK A;  2PU9 B;  2QQB A;  4C8Q B;  2DYI A;  1QVF P;  2YDL A;  3H6Z A;  3WVD B;  3RDV A;  2E1H A;  3CPW S;  2I2L A;  3EFR A;  4HCK A;  3G7Z A;  1Q81 C;  5KYY B;  1KK7 A;  1ZLM A;  5A0L A;  1WQ7 A;  3LGL A;  3CXC P;  2DZ9 A;  1ZSZ C;  4WF2 A;  1UJ0 A;  3TU4 K;  2L3S A;  1MUZ A;  4FW2 A;  1YJW A;  4AFQ C;  2AK5 A;  2CZ6 B;  1UGV A;  3ZFJ A;  2A36 A;  1H9F A;  2FL7 A;  3OYJ A;  2HKN A;  1M90 U;  5L23 A;  3MCA B;  1OU8 A;  4RMO A;  2CT3 A;  4BIT A;  1YP5 A;  2RI2 A;  3CCU A;  2KE9 A;  1M2O A;  2CKK A;  4LN2 A;  1VQM Q;  1K73 U;  5GAN 5;  1PNJ A;  5CKD A;  4C92 A;  1KQ2 A;  4XTX A;  1UHC A;  4KGV B;  3JB9 H;  1M1K U;  1M1G A;  3ZL7 C;  2RK1 A;  1Z9Q A;  5GAN 2;  4LUD A;  3CCJ T;  4J7F A;  1WHH A;  3CME T;  2DE0 X;  2KXD A;  3CC4 A;  1VYU A;  4M78 D;  4MDW A;  4A63 B;  2DD4 A;  2MI6 A;  3L42 A;  1SRL A;  1W2B P;  1K0X A;  1JEQ A;  3GNF B;  1VYV A;  3FLG A;  2DD5 A;  2OTJ Q;  2COY A;  4LD9 K;  2A3L A;  4M78 G;  2KBT A;  4L59 A;  1W2B A;  4BDZ A;  1WNL A;  4D6W A;  5L8R E;  4J9I A;  2X4Y A;  4JZ4 A;  3NTH A;  2LNV A;  2QG9 B;  1E6H A;  3HRT A;  5CK9 A;  5FLX E;  3GBQ A;  4B9X A;  1NJI U;  3MKD A;  2DO3 A;  1GXI E;  4FSS A;  2ENM A;  2KVQ G;  1SHF A;  2WQG A;  2DFU A;  1FMV A;  4X1V A;  1DJ7 B;  1VQ7 Q;  3THK A;  3PNW C;  3PIO A;  2LTO A;  5A0D A;  2O9S A;  2GTO A;  1SSF A;  4P5N A;  1JJR A;  1E6G A;  1N5Z A;  2JZ2 A;  3UT1 A;  5GAO m;  3REB B;  5GMK h;  2K5L A;  5GAN 4;  2DEU A;  3FDR A;  4DA4 A;  2GFU A;  2DEQ A;  1VQN T;  3PT9 A;  1JO8 A;  2BZ8 A;  2ROL A;  4JZ3 A;  3CCR T;  1YJW Q;  4J9B A;  2KY9 A;  1BBZ A;  4M7D B;  2DXU A;  2X4X A;  1GL9 B;  2K3B A;  2JUF A;  3VV0 A;  4GLM A;  1RAH B;  1WI7 A;  4C0D B;  5EG2 A;  4Z02 A;  4OB1 B;  2G6F X;  3CCL Q;  3OW2 P;  4X34 A;  3QUI A;  3MEU A;  1NEB A;  5GAN d;  2CP7 A;  2CP0 A;  3M5A A;  2BE7 D;  4ZGD B;  4PJO C;  3M56 A;  1HXD A;  2A0F B;  3JCM X;  2QDL A;  5GAN g;  2V8K A;  5GAM f;  2KGT A;  1WGS A;  3LGF A;  1NPR A;  1OU9 A;  1K73 C;  4PJO B;  2LCC A;  5LJ3 h;  3BDL A;  2WSC E;  2KR3 A;  5FRO A;  1W4S A;  4NS5 A;  1M2V B;  2C0I A;  2KRN A;  2MF2 A;  2DVE A;  2JN0 A;  2DPP B;  3OYN A;  1I5L A;  4KT0 E;  2RNA A;  1M27 C;  1CSK A;  4KGX B;  4QVC A;  1UFF A;  2RNO A;  2ODC I;  1B7T A;  1R8O B;  3QKJ A;  4AFS C;  3QO3 A;  1AWW A;  3CBP A;  2X4J A;  4OB0 B;  1MGQ A;  4ZN1 A;  5CAI A;  1CKA A;  1X69 A;  3MPU B;  2K3X A;  3TRE A;  3MET A;  3RKX A;  1YIT T;  2LT4 A;  5ECA A;  1Y02 A;  2YUP A;  1RAA B;  3CMA T;  2EGE A;  1TWB A;  5IHI A;  4M78 E;  2EJ9 A;  2QNF A;  2DBK A;  2ZPB B;  2AZV A;  2L0A A;  3OMG A;  2CRE A;  4JLI A;  1KHI A;  3M0Q A;  2PUK B;  4ELZ C;  2IVW A;  5C6S A;  5FU7 C;  2OI3 A;  4M77 B;  1HSQ A;  1Q82 C;  1VQ8 Q;  1V66 A;  2QA4 Q;  1UDL A;  1VQN A;  2K57 A;  1SSH A;  2BE9 B;  2KXC A;  5I11 A;  3JCM V;  4Z88 A;  1OZ3 A;  3U23 A;  2RMO A;  2PNI A;  2BZX A;  1VQ4 Q;  4AT1 B;  1OPL A;  2MMP A;  4JDS A;  3C4S A;  4QQG A;  1WPY A;  3E9F A;  2JMA A;  4C92 E;  2EFI A;  1ZBJ A;  2RQU A;  2E3I A;  2EVR A;  1JBM A;  3PMI A;  2MK5 A;  4JJN K;  1MMG A;  2HD0 A;  3PVQ A;  2DJZ A;  4J7I A;  2DJQ A;  1GCQ C;  2YUO A;  1G3S A;  2R5M A;  1IO6 A;  2QTX A;  2J6K A;  1UHF A;  2RHU A;  4PJO F;  3QHS A;  1VQ5 Q;  2V26 A;  3X26 B;  3CXC S;  3I35 A;  1T3S A;  3LW5 E;  5CKE A;  2C0T A;  4M7A D;  4IKF A;  2MIO A;  4E7H A;  4RG2 A;  1VQ9 A;  3BY7 A;  3M59 A;  4AG1 C;  4PFP A;  3GIB A;  4QQD A;  2YLC A;  2KFV A;  1OQK A;  5A0G A;  5AYF A;  2CH4 W;  3EG1 A;  3CCQ T;  4M7A G;  1RAC B;  1FWZ A;  2LQN A;  2VC8 A;  3VKI A;  3HL8 A;  1GL5 A;  3D7S B;  1QMC A;  3JCM h;  4C8Q C;  4IUR A;  4NL2 A;  2D1X A;  2O2O A;  4LDW A;  1TUD A;  2KYB A;  1NZ9 A;  3S6W A;  2CZ7 B;  3JCM f;  1KC8 C;  2DIL A;  3CCV A;  2GQV A;  1VQP Q;  4PLL A;  3H9N A;  3OQ5 A;  3EGD B;  1BIA A;  1PSF A;  2XD0 A;  2DIQ A;  4BY6 C;  2C06 A;  1PD0 A;  1SRM A;  3GF5 A;  3SFM A;  4PJO G;  2CYZ B;  3M0U A;  3CCR A;  3LH5 A;  3LX7 A;  4F7U B;  1M90 C;  2JTF A;  2YT6 A;  2LDM A;  1RAD B;  1VQ8 A;  4C92 G;  2GF7 A;  1Z9Z A;  3CCE Q;  5IN1 A;  2W51 A;  2QQA A;  1YHQ T;  3HKS A;  5IXB A;  1VUB A;  4LXC A;  1JU5 C;  4M7D A;  2DK4 A;  2LMJ A;  2B86 A;  2RQV A;  1SHG A;  5GAN 7;  1N27 A;  1M8V A;  2KNB B;  5KYU A;  5I2S A;  4OF1 A;  3MEW A;  1NYG A;  2HBP A;  3NFC A;  2V1Q A;  4B9W A;  2XDD A;  2JT4 A;  1YHQ A;  4J6X A;  3ULR B;  2J6F A;  2V1R A;  4EMK C;  4ZGE B;  4E7J A;  1M1K R;  2O9V A;  2L3R A;  4XAX B;  5GAO q;  2E70 A;  4M77 G;  1AZE A;  5D6W A;  5KCH A;  2QA4 A;  1D3B A;  3VS1 A;  9ATC B;  4UZW A;  1LPL A;  4JRQ A;  1QCO A;  3EGD A;  3MP1 A;  4RG8 A;  4J9H A;  2KT1 A;  1Y0M A;  4C92 D;  2QAS A;  3QWX X;  2HMA A;  2SRC A;  1WHJ A;  1QKW A;  4Z89 A;  1O75 A;  4VUB A;  2PZ1 A;  4FM4 B;  2QGF B;  1PWT A;  2IG0 A;  1D0Z A;  1HYO A;  1X6B A;  2L3Q A;  5GAM j;  4XTY A;  3OYB A;  2DMO A;  1UTI A;  2LC3 A;  3UDC A;  1WHM A;  5GAN j;  2J7I A;  2RJF A;  2EYZ A;  1ZX6 A;  1OI1 A;  3GPL A;  2ROT A;  4LE9 A;  1YWP A;  1QKX A;  4E7K A;  3VUZ A;  3PFS A;  3EG2 A;  3C95 A;  4A4G A;  5CO7 A;  2XMF A;  2XU8 A;  4XU0 A;  2C0O A;  2K7A A;  1YJN T;  1B07 A;  1MMA A;  1TSF A;  3BE3 A;  3KBG A;  3EFO A;  4M7D G;  3TEE A;  3RKY A;  1PD1 A;  1BK2 A;  3RES A;  2XDB A;  2HQX A;  1LVK A;  3FJ5 A;  1VOM A;  4L6V 5;  2QGG A;  3PE0 A;  2K4Y A;  3EHQ A;  2QNC A;  2JOY A;  1IRE B;  3CCR Q;  2DX1 A;  3JCM b;  2DVJ A;  2ABL A;  1K8A U;  1ABO A;  3ZBD A;  4NOY A;  1AWX A;  5KYY A;  4BDY A;  4OMM A;  2LD7 A;  2GQI A;  1HJD A;  2E65 A;  3HFN A;  2M9U A;  1VQK T;  4R0K A;  3G4S T;  4C0Z A;  2DKG A;  1PKT A;  4Y28 E;  4FT4 A;  2LNH B;  2RF0 A;  4F7U E;  2O88 A;  3CC7 A;  1G83 A;  2RM4 A;  2J05 A;  1MNE A;  2FZK B;  2EAY A;  5CKF A;  2RH2 A;  3ME9 A;  3HTR A;  2VXF A;  1VQO Q;  4HVV A;  3SWN A;  1T0J A;  1WYX A;  2K5I A;  2OX7 A;  2X9H A;  3O5Z A;  1FXX A;  1ZQ1 A;  4ZGJ B;  1K9M U;  2XIC A;  3I55 T;  2DM1 A;  2O4X B;  4M77 F;  3OYE A;  3A8H B;  3NTK A;  2LJ1 A;  3VS4 A;  4C8Q E;  5FU7 B;  1WHG A;  2HQH A;  1K9A A;  7AT1 B;  3PTA A;  4A4F A;  3CCS T;  2NYS A;  5LJ3 g;  1P92 A;  3GLX A;  5GAM h;  2ZGW A;  4RCB A;  4LDX A;  5LJ3 d;  1H92 A;  3KXT A;  2HCK A;  2VB6 A;  1WA7 A;  4BD3 A;  1Q82 U;  1VQL Q;  1EZZ B;  4PJO A;  1JRI A;  2GNC A;  3R6N A;  1KSW A;  1VQ4 T;  4DEY A;  1VQ5 A;  3SEM A;  3CC2 Q;  3OS5 A;  4EMK A;  4OMF B;  3C94 A;  1RAB B;  2X4W A;  3QDR B;  2KVE A;  4JJD A;  5CCA A;  3HRS A;  2L2P A;  1KQ1 A;  2FYK A;  1VQM A;  3VRY A;  2AT1 B;  2KYM A;  1AEY A;  2D8J A;  1KHC A;  2KSS A;  1IRX A;  3OB9 A;  5DLO A;  1UJY A;  3MO8 A;  2DXB A;  1W2B S;  1QVP A;  2CSQ A;  5FWB A;  5GMK j;  2BUD A;  4KH1 B;  5LJ3 j;  1GBR A;  2L8D A;  2K2M A;  2LT1 A;  4C0G A;  4N0A C;  4ZTF A;  3I55 A;  3ER0 A;  2JJ9 A;  3L2Q A;  1N8R C;  4DEX A;  2XID A;  3M57 A;  1K76 A;  1BI0 A;  5LJ5 d;  6AT1 B;  1UGQ B;  1HK9 A;  2BKD N;  5GAN f;  1NYF A;  4IUU A;  4DQ2 A;  1RAG B;  4RTZ A;  1WZO A;  3TQ7 P;  2AKK A;  3Q1J A;  3CC4 T;  2E6Z A;  1N6A A;  2CP3 A;  3OYL A;  2DER A;  2D8H A;  5IAY A;  3CCE A;  2CS7 A;  1VQ6 T;  4J9D A;  2I0N A;  3V7S A;  5IXF A;  2YUQ A;  2JM9 A;  2KEA A;  4F7U F;  2OJ2 A;  2RNN A;  2CGH A;  1N9S A;  1N9R A;  2DXC A;  4JS4 A;  3EG0 A;  4HCZ A;  5A2Q E;  4ZN3 A;  1IGQ A;  2QA4 T;  4M78 C;  1EN7 A;  4MZM A;  3TSW A;  1QVF S;  3L2W A;  1H3Z A;  3CEY A;  2J06 A;  3REA B;  3QZ5 B;  1PG5 B;  1WJS A;  2D9T A;  1G5V A;  5D6Y A;  4LNP A;  4M7A A;  1KD1 C;  3SD4 A;  1O9S A;  4PJJ A;  3HPW A;  2COW A;  3H8Z A;  4M77 D;  1FMK A;  5CKH A;  2QQR A;  4EPC A;  4BUG A;  4E7Z A;  5IHN A;  2DLP A;  1CKB A;  2MPX C;  4PLI A;  5HCK A;  3M0T A;  4A54 A;  3CC2 A;  3S3O A;  1UGS B;  2F2W A;  1YIJ T;  1M3B A;  3CCU T;  2EYY A;  4XTU A;  3G71 A;  5LJ3 e;  1OZ2 A;  3HP9 A;  1N8R U;  4MZP A;  2JS2 A;  3M0S A;  2OTL A;  5LJ5 f;  1PSE A;  2EJG A;  3JCM e;  2PVG B;  1I07 A;  2F69 A;  4M7A E;  2Y4Y A;  3OSV A;  1FX7 A;  4FYY B;  2X35 A;  3G6E A;  3MEV A;  2EKH A;  1AZG B;  2AHJ B;  1D3B B;  5HKC A;  1JB0 E;  2PTK A;  4A53 A;  1K9M C;  1MV3 A;  2JMC A;  1Q82 R;  4M7A B;  2GFA A;  2LCL A;  1LCK A;  1ZUU A;  3EAE A;  2EGC A;  2YRD A;  2MWO A;  5GAO p;  1BI3 A;  3CC7 T;  2MCN A;  2RD1 A;  3EHR A;  5FW9 A;  3E1S A;  3E2U A;  2CZ1 B;  1H3H A;  4RUG A;  2LJ3 A;  2PQW A;  5IT9 E;  1Q86 C;  2SEM A;  1PRL C;  3L2U A;  3MJX A;  3SWN C;  4WTO B;  2EKO A;  2OAU A;  3AT1 B;  5GJW B;  4QT7 A;  1X01 A;  1NJI C;  1KQS A;  2E41 A;  1IXD A;  1HD3 A;  1YJ9 A;  2RHX A;  1A8V A;  1M4Z A;  2L89 A;  3R6O A;  1XNI A;  2EQJ A;  1W1F A;  2VUB A;  3CCU Q;  5CVI A;  4M75 E;  2CUB A;  4FT2 A;  1D0X A;  4IUV A;  3N5B B;  3OS1 A;  2G3R A;  1Q7Y R;  2ZPE B;  4J83 A;  3MHX A;  2DA9 A;  1YIJ A;  3OA6 A;  1ZS9 A;  1G2B A;  1GJJ A;  1I8F A;  2MAM A;  1YJN A;  2VVK A;  4E6R A;  4KBM B;  3BW1 A;  2HEQ A;  1Y71 A;  2FPD A;  3KFV A;  1QQJ A;  2A08 A;  2HSE B;  1YNZ A;  3NTI A;  4XTV A;  4M7D F;  4EIK A;  3X28 B;  2OAW A;  1LOJ A;  2IPO B;  3VUB A;  4A4H A;  3OMC A;  2X3X D;  2E4H A;  4PJO E;  1OX8 A;  4E7I A;  2DAQ A;  2A8V A;  3OYC A;  1KG1 A;  2COZ A;  4F7U G;  3CC2 T;  3CCV T;  1TOV A;  3QSU A;  4R55 A;  1RLP C;  3H0H A;  5KYX B;  1KQS P;  1VQP A;  5KYN A;  2DL4 A;  3ZEH A;  2MOX A;  2VV5 A;  4BE2 A;  2DL8 A;  3L2Z A;  1XJW B;  3X20 B;  3OSS C;  1G3W A;  2L3P A;  3X24 B;  3CCS Q;  5FRN A;  4F14 A;  4E2F B;  1Q95 G;  1T3L A;  3CCM T;  4C5E A;  1VQ9 T;  2XHC A;  4XTZ A;  1X6O A;  3M0P A;  2M0O A;  1ZSG A;  4ORZ A;  2O01 E;  3LWI A;  1VYT A;  2DTO A;  3CQT A;  2EW3 A;  4QVD A;  1UGR B;  3CCL A;  2CUD A;  1VQ5 T;  1VQ6 A;  2KW9 A;  1KD1 R;  2K9G A;  1XQH A;  3CBM A;  4M75 D;  2YUN A;  3DLM A;  4ATO A;  4PFZ A;  4FCY A;  1V76 A;  5GAO n;  4D8K A;  4D8D A;  3QXE B;  1KC8 R;  2XK0 A;  2XI9 A;  1UG1 A;  2JTM A;  2RPN A;  3QZ9 B;  4JS5 A;  4CC3 A;  4J9C A;  4LDY A;  4MDX A;  3TSZ A;  2QTV A;  1Q81 U;  1YJ9 Q;  5GMK l;  5IHK A;  1M30 A;  3P8B B;  1X43 A;  5GMK e;  1SPK A;  2ODG C;  4NL3 A;  4E7L A;  3MEA A;  3CD6 A;  1TS9 A;  3I5R A;  3JB9 J;  3PGG A;  3CXC A;  3CCM A;  1S1N A;  1YI2 A;  4IUQ A;  2VXE A;  1YI2 T;  3G1J A;  2BIV A;  2MWP A;  3CMA Q;  4LDU A;  4BI8 B;  2FRW A;  1FYN A;  1LJO A;  1X75 C;  2VKN A;  2DK3 A;  4II1 A;  1YHQ Q;  4LUE A;  3EFO B;  2NUT B;  3VJP A;  1JJ2 A;  2B8A A;  2KRM A;  2FZG B;  3QWY A;  4ME7 A;  2ZZD A;  1UUE A;  2LVM A;  2YRV A;  4R56 A;  1EX4 A;  3LWH A;  5J3B A;  1YIT Q;  3L0O A;  2NWM A;  2PVD B;  2ESW A;  4JRI A;  1ZA2 B;  1M5Q 1;  1M2V A;  2HAX A;  1OYX A;  2E10 A;  4C5G A;  1H9E A;  3CCS A;  3CCJ Q;  4A4K A;  3QJ6 A;  4RKU E;  1U3O A;  1K9M R;  4MMK A;  2QEX Q;  2F1L A;  2EQK A;  3P8H A;  1Q81 R;  4OMP A;  4RTV A;  1XTD A;  2H8H A;  3PIP A;  2V8J A;  1BIB A;  3EG9 A;  5DLQ E;  1B34 B;  3M4Y A;  3H0F A;  1J3T A;  2RQW A;  2E5K A;  1U8R A;  2IIM A;  1R0B G;  3MP8 A;  3JCM W;  1JXO A;  3NPF A;  1D09 B;  3QYH B;  1E7L A;  2LJ0 A;  3A1P A;  3FIF A;  3I56 T;  1QWF A;  2P4R A;  1TH7 A;  2XG8 D;  1SF9 A;  1NM7 A;  1SG5 A;  2QAZ A;  2FB7 A;  4ELY C;  3RUX A;  1BI1 A;  1VQ4 A;  2DTH A;  5GAN e;  1V29 B;  1QVG S;  1WDX A;  4JRP A;  4B6M A;  2O4X A;  3OYD A;  4CRI A;  1OPK A;  1YN8 A;  1ABQ A;  1YI2 Q;  3F70 A;  2KQW A;  2R57 A;  3INZ A;  1RLQ C;  2FRY A;  5HK0 A;  3JB9 G;  2DL7 A;  1VA7 A;  5KYU B;  4EMG A;  1YFN A;  1K8A R;  2RN8 A;  1K0S A;  3CMA A;  3OW2 S;  2DRK A;  4RTY A;  3CPW A;  1VQ7 A;  3QII A;  3OYF A;  2CSI A;  1V1C A;  4FYV B;  1VQ7 T;  4BE0 A;  3QPH A;  2CT4 A;  4HKE A;  4PJM A;  3OYY A;  3V7R A;  5LJ5 g;  2QQ9 A;  2HQE A;  4OGE A;  2ED0 A;  3CC7 Q;  4M78 B;  5LJ5 h;  1PC0 A;  2KRO A;  1YIJ Q;  1Q86 U;  3DB4 A;  4F7U A;  4BI3 A;  1YNS A;  2D6F A;  1AHJ B;  1ZBH A;  5GAN 8;  3T9N A;  3NMZ C;  4M78 F;  4PFO A;  3G71 Q;  3VS7 A;  4BB7 A;  2DTI A;  2RI5 A;  1WLP B;  2DET A;  1RI0 A;  3JV3 A;  3H0I A;  1RAF B;  4FW1 A;  5AT1 B;  1AWJ A;  3CME A;  2LRQ A;  1G3T A;  1WQW A;  3UWN A;  3S3M A;  3IQL A;  4OB3 B;  1U06 A;  1QCF A;  2DXT A;  3SB2 A;  1KQS S;  4AFU C;  1ACM B;  3I56 A;  2VGN A;  3M53 A;  4XU2 A;  2KMT A;  3OBY A;  2JNG A;  1B3Q A;  1OOT A;  3A8M B;  3RMQ A;  5KCO A;  1JXM A;  3DB3 A;  2W0Z A;  3CCV Q;  2RB6 A;  4HVU A;  8AT1 B;  4GBQ A;  1VQM T;  1VQO A;  1TU0 B;  2Y4X A;  3RR6 A;  4GY5 A;  3EGU A;  4ZNX A;  4C8Q D;  3NHN A;  3WXM B;  2AZS A;  4EDU A;  3EG3 A;  2DYB A;  4X9D A;  1Y57 A;  2RJC A;  4N4H A;  2YXY A;  3VS0 A;  3CCE T;  3FC3 A;  1WIE A;  4C8Q G;  1GRI A;  2KRS A;  2CDT A;  2RO0 A;  3OYA A;  1GBQ A;  4C5I A;  1GFD A;  5KYW A;  2M16 A;  1VQO T;  3DLL A;  3G6E T;  5M9O A;  4IUP A;  5LJ3 f;  1S72 T;  3OS2 A;  1M3C A;  4CC4 B;  2K6D A;  3JCM J;  1WX6 A;  5HK3 A;  4J9E A;  1VQL A;  1R0C B;  4C8Q A;  1UE9 A;  4M78 A;  4N4I A;  3I9Q A;  2DL3 A;  2OTL T;  2MPH A;  4C0F A;  1VQ8 T;  1SEM A;  2E5Q A;  2J6O A;  1PCX A;  3M0R A;  1C6V X;  3V7C A;  3RKW A;  3UPU A;  3DKM A;  1ZA1 B;  4M7A F;  5GAN 3;  4HCB A;  5D7U A;  2ZPH B;  4JJC A;  3M54 A;  1MMD A;  2Z0W A;  1VIF A;  1GFC A;  2QYZ A;  3RBB B;  4PJL A;  1NBE B;  3QJY A;  2QXF A;  3QDF A;  2JVV A;  4QQ6 A;  1VQK A;  4YTL A;  4FL6 A;  2K3Y A;  1AD5 A;  1GCQ A;  5I21 A;  2PVO B;  2HL3 A;  2OTJ T;  5GAM g;  2JVW A;  3UAT A;  4Y92 A;  2YHT A;  2CP2 A;  2EQU A;  1QVG P;  1ZHI A;  2ZAE A;  1Q86 R;  1PRM C;  3VRZ A;  1E7D A;  4F04 B;  3V8K A;  4KUI A;  1M3A A;  1NPP A;  1NJI R;  2JW4 A;  2F5T X;  1NEG A;  2P0K A;  3H41 A;  2WAC A;  2AIR B;  1UEB A;  2WSE E;  2DBM A;  1W6X A;  4C5H A;  3SDZ A;  1QVF A;  4L5G A;  2M51 A;  3OY9 A;  4BI4 A;  1YJ9 T;  1Q7Y C;  5GAO r;  2X51 A;  2PUO B;  3NGP A;  4LDV A;  4EMK B;  3CC4 Q;  1D0Y A;  4PJN A;  3JCM d;  3J7A F;  3CBO A;  3FEO A;  2P84 A;  2VWF A;  3JCM g;  3V8J A;  1EFN A;  2D0Q B;  2LQ8 A;  4IIO A;  2YSQ A;  4JJB A;  2FPE A;  1UEC A;  3JB9 I;  1SKU B;  1Q7Y U;  1YIT A;  5GMK i;  2G80 A;  2EIF A;  2FEI A;  2WSF E;  4OML A;  3EGX A;  4PNO A;  3M4G A;  4OMN A;  1JEG A;  1JJ2 S;  3JB9 D;  2FZC B;  4HA8 A;  3OYM A;  4A4E A;  5CQX A;  3CCM Q;  2LCS A;  1WFW A;  2P0P A;  4Y91 A;  3A5Z B;  5I22 A;  3JSC A;  1I0C A;  2R58 A;  4OMQ A;  1D1C A;  1WXT A;  3SWN B;  3E9G A;  1JQQ A;  1BCM A;  3RER A;  1U1T A;  2ZPI B;  4O5V A;  1VIE A;  2NUZ A;  3TCJ A;  3GNG A;  2LX7 A;  1ARK A;  1RAI B;  4M4Z A;  2BZY A;  2NUP B;  4IIM A;  2E3H A;  3G4S Q;  4M75 B;  4GLK A;  1BYM A;  3CCL T;  1K1Z A;  2GTJ A;  1TUG B;  3FRN A;  2GBQ A;  4JLG A;  4QKU A;  1PKS A;  3LYI A;  5D6X A;  2JTE A;  3VYG A;  4KUD K;  1X27 A;  4JPB W;  2RK2 A;  3UA7 A;  4C92 C;  2LZ6 B;  2JS0 A;  1NG2 A;  1X2K A;  2RQR A;  1KJW A;  2X3W D;  4C92 B;  4DBQ A;  5DY9 A;  3JCM c;  1U5S A;  3FJP A;  4RTX A;  1QLY A;  1G8X A;  2EQI A;  1GKU B;  2Y90 A;  3S3N A;  2FVU A;  1YWO A;  3VS3 A;  2K2V A;  4AMC A;  1JJ2 P;  1XOV A;  4F17 A;  5CIU A;  2E12 A;  3EFS A;  3C12 A;  4XTW A;  1M8M A;  2RHZ A;  3TVT A;  2ZCF B;  4DOW A;  4DBH A;  2QEX T;  2HNI A;  4K11 A;  4XK8 E;  3QBY A;  1KC8 U;  1C0M A;  4JUV A;  2GGR A;  1OX9 A;  1AWO A;  3BDU A;  2FHD A;  1X6G A;  1NLP C;  2VYT A;  4AG2 C;  3J80 E;  4MML A;  4CC7 A;  4WCI A;  2KK4 A;  2P4T A;  3A98 A;  2ED1 A;  4XU1 A;  5KYX A;  2KDS A;  3SHW A;  3RIR A;  4BAC A;  3I55 Q;  3BFM A;  1IGU A;  2K5F A;  1M9S A;  1TUC A;  2EPD A;  2XDP A;  4ZTJ A;  3M55 A;  1WJQ A;  1QW1 A;  4KRT A;  3WVE B;  5GJV B;  4O6J A;  2DIG A;  4DBR A;  4M77 E;  2EYX A;  5FRM A;  4N0A A;  1I4K 1;  4C8Q F;  1BKB A;  1W70 A;  4AFZ C;  1RI9 A;  3CME Q;  3X25 B;  4J8O A;  1YJW T;  1G3Y A;  1WXU A;  5EC7 A;  1ZSZ B;  2BTT A;  2HZY A;  4QVZ A;  1VQL T;  3QYG B;  1Y96 B;  1PHT A;  5I2M A;  2RI3 A;  1K8A C;  4J5Y A;  4X9C A;  3CCQ Q;  3E19 A;  3GP8 A;  4PKC C;  1A63 A;  4FYX B;  2FO0 A;  2M02 A;  5J39 A;  4J9G A;  4CI0 C;  3CPF A;  2YWW A;  4E7S A;  1MND A;  3OYG A;  3LLR A;  1I5O B;  1OUL A;  2EBP A;  4C92 F;  2D0N A;  3L2R A;  4PJO D;  2XKO C;  2JXB A;  1Y96 A; 
#chains in the Genus database with same CATH homology
 1WGS A;  3LGF A;  1NPR A;  1K73 C;  4PJO B;  1W2B S;  4DOV A;  1QVP A;  2LCC A;  5LJ3 h;  3BDL A;  5GMK j;  5HK0 A;  2WSC E;  3JB9 G;  3JCM P;  2BUD A;  5LJ3 j;  5FRO A;  2L8D A;  1W4S A;  4NS5 A;  4EMG A;  3VU3 C;  4M7D C;  3A8L B;  2LT1 A;  4C0G A;  4N0A C;  4ZTF A;  2MF2 A;  3I55 A;  2DVE A;  2JN0 A;  3ER0 A;  4C0D C;  1N8R C;  2LX9 A;  3L2Q A;  2DPP B;  3CMA A;  3OW2 S;  3CPW A;  2XID A;  3OYN A;  1VQ7 A;  3M57 A;  3QII A;  3OYF A;  1BI0 A;  5LJ5 d;  4KT0 E;  1I5L A;  1VQ7 T;  4BE0 A;  1UGQ B;  4J6Y A;  1HK9 A;  2BKD N;  1B34 A;  3QPH A;  4HKE A;  4IUU A;  4DQ2 A;  4EMH A;  2RJD A;  4QVC A;  5GAN f;  3OYY A;  3V7R A;  5LJ5 g;  2P0Q A;  2QQ9 A;  2HQE A;  4OGE A;  1U1S A;  4M78 B;  5LJ5 h;  3Q1J A;  3CC4 T;  2E6Z A;  1R8O B;  3QKJ A;  1N6A A;  1Y7X A;  3DB4 A;  3QO3 A;  4BI3 A;  4F7U A;  3OYL A;  1Q86 U;  2D6F A;  3O8V A;  1QP3 A;  5IAY A;  3OS0 A;  1AHJ B;  3CCE A;  1MHN A;  2CS7 A;  5GAN 8;  3T9N A;  3CBP A;  2X4J A;  4OB0 B;  1I81 A;  1MGQ A;  4ZN1 A;  5CAI A;  3L2V A;  1VQ6 T;  2K3X A;  3TRE A;  3MET A;  3RKX A;  4JRK A;  4M78 F;  1YIT T;  4OB2 B;  2LT4 A;  3V7S A;  5CKB A;  3CMA T;  2OTL T;  3JCM Q;  4BB7 A;  5CQY A;  2LC4 A;  5HY6 A;  2DTI A;  2RI5 A;  4M78 E;  2E64 A;  2EJ9 A;  1RI0 A;  4BY6 B;  4F7U F;  2ZPB B;  3OMG A;  2CGH A;  1N9S A;  4JLI A;  1N9R A;  2DXC A;  1KHI A;  4JS4 A;  4HCZ A;  5A2Q E;  3CME A;  2PUK B;  3JB9 F;  2LRQ A;  1G3T A;  4ZN3 A;  4ELZ C;  2IVW A;  1WQW A;  3UWN A;  5C6S A;  3S3M A;  4OB3 B;  4M78 C;  5FU7 C;  2QA4 T;  4M77 B;  4MZM A;  3A8G B;  1Q82 C;  1QVF S;  2CZ0 B;  3L2W A;  2DXT A;  3SB2 A;  3CEY A;  1H3Z A;  1KQS S;  1QP2 A;  1VQN A;  2K57 A;  3QZ5 B;  3I56 A;  3G71 T;  1WJS A;  2D9T A;  2VGN A;  5GAM e;  3JCM V;  5D6Y A;  1OZ3 A;  5GMK m;  4M7D D;  3M53 A;  4M7A A;  1G5V A;  1KD1 C;  3CCQ A;  4XU2 A;  2EJF A;  3SD4 A;  2R5A A;  2KMT A;  1O9S A;  3OBY A;  4Q5W A;  3HPW A;  2JNG A;  2MMP A;  3H8Z A;  4M77 D;  4JDS A;  3C4S A;  2QEX A;  4QQG A;  3M9Q A;  3A8M B;  2QQR A;  4M75 G;  5CKH A;  1WPY A;  3E9F A;  3RMQ A;  4BUG A;  4OGC A;  4EPC A;  5KCO A;  2QI2 A;  3DB3 A;  4OP0 A;  4PLI A;  2RB6 A;  4HT8 A;  1VQM T;  3JAM E;  4E47 A;  1VQO A;  2Y4X A;  3PMT A;  4GY5 A;  4A54 A;  5J26 A;  4C8Q D;  5CR2 A;  1QVG A;  3WXM B;  4C92 E;  3V8L A;  4EDU A;  3CC2 A;  2EFI A;  3S3O A;  1UGS B;  2DZC A;  1YIJ T;  4X9D A;  4OVA A;  2ZPF B;  2RJC A;  3CCU T;  3L1A A;  1JBM A;  4N4H A;  3J81 E;  3PMI A;  4XTU A;  3G71 A;  3LH0 A;  4M77 A;  5LJ3 e;  2E6N A;  1OZ2 A;  1Y07 A;  4JJN K;  3HP9 A;  3CCE T;  3FC3 A;  1N8R U;  4MZP A;  2HD0 A;  2DJZ A;  4J7I A;  4M75 A;  4C8Q G;  1G3S A;  2R5M A;  2OTL A;  5LJ5 f;  4FSX A;  2QTX A;  1PSE A;  2EJG A;  5GAN e;  3P8D A;  2KAF A;  3JCM e;  2PVG B;  2RO0 A;  2RHU A;  2ZPG B;  3OYA A;  2F69 A;  4PJO F;  3QHS A;  4C5I A;  4M7A E;  3X26 B;  2Y4Y A;  2M16 A;  1VQO T;  3CXC S;  3DLL A;  3OSV A;  5CKE A;  1H64 1;  3LW5 E;  1FX7 A;  3HFO A;  3G6E T;  2X35 A;  3OYK A;  5M9O A;  4M7A D;  4IUP A;  5LJ3 f;  5GAN h;  1S72 T;  4IKF A;  4M7A G;  1YCY A;  3MEV A;  3G6E A;  4RG2 A;  4E7H A;  3OS2 A;  1VQ9 A;  4M7A C;  2QQS A;  2AHJ B;  1D3B B;  3BY7 A;  1JB0 E;  5HKC A;  4A53 A;  3JCM J;  1K9M C;  3M59 A;  3GIB A;  5HK3 A;  4QQD A;  2YLC A;  1VQL A;  4C8Q A;  4M7A B;  5A0G A;  1ZBX A;  5AYF A;  4M78 A;  4N4I A;  3CCQ T;  2GFA A;  3GOX A;  4N4G A;  4QW2 A;  2LCL A;  5LJ5 j;  4C0F A;  5GAO l;  1VQ8 T;  3A8O B;  4MZT A;  1FWZ A;  4XQ3 A;  5FU6 C;  2E5Q A;  5C0M A;  2VC8 A;  3VKI A;  3EAE A;  3HL8 A;  2MWO A;  5GAO p;  1BI3 A;  3CC7 T;  3V7C A;  2RD1 A;  3RKW A;  3UPU A;  3DKM A;  4RCC A;  4M7A F;  3E1S A;  4PJO D;  5GAN 3;  3JCM h;  2CZ1 B;  4HCB A;  4C8Q C;  2EYQ A;  4IUR A;  4NL2 A;  3CD6 T;  2PQW A;  2ZPH B;  3M54 A;  4LDW A;  1VIF A;  5IT9 E;  1NZ9 A;  3S6W A;  2CZ7 B;  3QG1 A;  3JCM f;  1Q86 C;  1EIF A;  1NE8 A;  1KC8 C;  3CCV A;  2GQV A;  5DM7 R;  4PLL A;  3L2U A;  3HRU A;  3OQ5 A;  3SWN C;  2EKO A;  1KD1 U;  2OAU A;  1BIA A;  1PSF A;  2XD0 A;  3QJY A;  2DIQ A;  2QXF A;  4BY6 C;  1X01 A;  3HHT B;  2C06 A;  1UGP B;  2JVV A;  2RA2 A;  3GF5 A;  4QQ6 A;  3SFM A;  3G4S A;  1NJI C;  4XU3 A;  4PJO G;  1KQS A;  1VQK A;  4J6W A;  2CYZ B;  4YTL A;  3CCR A;  3LX7 A;  4FL6 A;  4F7U B;  1M90 C;  2E41 A;  2JTF A;  5KE3 A;  2LDM A;  2K3Y A;  2OTJ A;  4M77 C;  1VQ8 A;  4C92 G;  1M1F A;  5I21 A;  4M75 C;  2GF7 A;  1BI2 A;  2PVO B;  5LL6 S;  5IN1 A;  2QQA A;  2OTJ T;  5GAM g;  1YJ9 A;  2RHX A;  1YHQ T;  4UC4 A;  1M4Z A;  2L89 A;  2YHT A;  3R6O A;  1XNI A;  2EQJ A;  3HKS A;  2VUB A;  2EQU A;  2LQK A;  4BE1 A;  5CVI A;  1VUB A;  1ZHI A;  4M75 E;  4FT2 A;  4IUV A;  4M7D A;  3N5B B;  3OS1 A;  2G3R A;  1M1K C;  2ZPE B;  3MHX A;  4J83 A;  2H3J A;  1YIJ A;  2QDY B;  3OA6 A;  3V8K A;  4KUI A;  5GAN 7;  4M75 F;  1I8F A;  1N27 A;  2MAM A;  1YJN A;  4KBM B;  2EQM A;  3BW1 A;  3MP6 A;  1NPP A;  1Y71 A;  1M8V A;  5I2S A;  3RMS A;  4OF1 A;  2F5T X;  2P0K A;  2WAC A;  3MEW A;  3NTI A;  4XTV A;  2HBP A;  4M7D F;  2VGM A;  3X28 B;  1UEB A;  1LOJ A;  3FB9 A;  2WSE E;  3NFC A;  3VUB A;  4C5H A;  2F5K A;  3SDZ A;  2L5Q A;  4B9W A;  2XDD A;  2RJE A;  3KUF A;  1Y96 A;  4LD6 A;  4A4H A;  4HT9 A;  4M7D E;  3OMC A;  1QVF A;  4L5G A;  5FU6 B;  3URG A;  4FU6 A;  1WJR A;  1YHQ A;  3OY9 A;  2GCX A;  4J6X A;  4BI4 A;  2RHI A;  1YJ9 T;  4PJO E;  2RHY A;  4ZGE B;  4E7I A;  4EMK C;  5KH6 A;  4E7J A;  2DAQ A;  1YBY A;  1Q7Y C;  5GAO r;  2PUO B;  3M58 A;  4LDV A;  2L3R A;  1RL2 A;  3OYC A;  1KG1 A;  4XAX B;  5GAO q;  2E70 A;  4F7U G;  3CC2 T;  4EMK B;  4V2S A;  3CCV T;  4M77 G;  3QSU A;  4R55 A;  5D6W A;  5KCH A;  2QA4 A;  3JCM d;  3AHU A;  3J7A F;  1D3B A;  1VQP A;  2YLB A;  4PL6 A;  2A7Y A;  4TVR A;  1VQP T;  3CBO A;  3FEO A;  3ZEH A;  2VV5 A;  4BE2 A;  4JRQ A;  3JCM g;  3V8J A;  5LJ5 e;  3OBW A;  1IZ6 A;  2D0Q B;  4FIB A;  3MP1 A;  2LQ8 A;  4RG8 A;  3L2Z A;  5KE2 A;  1UB4 A;  5GAN 6;  3X20 B;  3JB9 I;  3VYH B;  3OSS C;  3OYH A;  1Q7Y U;  1G3W A;  1YIT A;  3X24 B;  5GMK i;  4HCC A;  5FRN A;  4C92 D;  2EIF A;  3OYI A;  2EWN A;  2WSF E;  3CCJ A;  2NLU A;  4PNO A;  3M4G A;  5GAM d;  2M1H A;  3CCM T;  4C5E A;  1O75 A;  4VUB A;  2XHC A;  1VQ9 T;  4XTZ A;  1X6O A;  3ASK A;  2M0O A;  4IUT A;  4FM4 B;  3JRZ A;  2V8I A;  1S72 A;  1JJ2 S;  1LNX A;  3JB9 D;  4HA8 A;  3OYM A;  3OW2 A;  2IG0 A;  4A4E A;  5CQX A;  3HSB A;  4KUL A;  2O01 E;  5GAM j;  3LWI A;  2PU9 B;  2QQB A;  4XTY A;  4C8Q B;  2DTO A;  3OYB A;  2P0P A;  3H6Z A;  4Y91 A;  3WVD B;  3A5Z B;  4QVD A;  1UGR B;  3CCL A;  2E1H A;  1VQ5 T;  3UDC A;  3JSC A;  3CPW S;  5GAN j;  1VQ6 A;  2R58 A;  2I2L A;  3EFR A;  2RJF A;  3G7Z A;  3SWN B;  1Q81 C;  1OI1 A;  5A0L A;  3E9G A;  3GPL A;  1XQH A;  1WQ7 A;  3CBM A;  3LGL A;  4M75 D;  2DZ9 A;  3RER A;  1U1T A;  2ZPI B;  3DLM A;  4O5V A;  1VIE A;  4WF2 A;  3TU4 K;  3TCJ A;  4ATO A;  4E7K A;  3VUZ A;  3GNG A;  5GAO n;  1YJW A;  3PFS A;  2CZ6 B;  3C95 A;  4A4G A;  5CO7 A;  2XU8 A;  3QXE B;  2XK0 A;  4XU0 A;  3ZFJ A;  4M75 B;  4GLK A;  2XI9 A;  1YJN T;  2FL7 A;  3OYJ A;  3QZ9 B;  2JTM A;  1BYM A;  1M90 U;  4JS5 A;  3MCA B;  3KBG A;  4RMO A;  4M7D G;  3TEE A;  4LDY A;  2RI2 A;  3CCL T;  3RKY A;  3CCU A;  4MDX A;  2CKK A;  3RES A;  1Q81 U;  2XDB A;  2HQX A;  5GMK l;  3FRN A;  3P8B B;  4JLG A;  1K73 U;  5GAN 5;  3LYI A;  5D6X A;  5GMK e;  5CKD A;  4L6V 5;  2K4Y A;  4NL3 A;  3VYG A;  4E7L A;  3MEA A;  2JOY A;  4KUD K;  4C92 A;  1KQ2 A;  4XTX A;  3CD6 A;  1IRE B;  3JB9 J;  3JCM b;  1K8A U;  3JB9 H;  3PGG A;  1M1K U;  2RK2 A;  3CXC A;  1M1G A;  4C92 C;  3ZBD A;  4NOY A;  2RK1 A;  3CCM A;  1YI2 A;  5GAN 2;  4IUQ A;  2VXE A;  4BDY A;  1YI2 T;  3CCJ T;  4J7F A;  2BIV A;  2MWP A;  4LDU A;  4C92 B;  5DY9 A;  4BI8 B;  3CME T;  3JCM c;  3CC4 A;  4M78 D;  4MDW A;  2E65 A;  2DD4 A;  3FJP A;  3HFN A;  2MI6 A;  3L42 A;  3S3N A;  2Y90 A;  1LJO A;  2FVU A;  2M9U A;  1VQK T;  1X75 C;  3G4S T;  4C0Z A;  2K2V A;  2DK3 A;  2DKG A;  3GNF B;  4II1 A;  3FLG A;  4FT4 A;  1XOV A;  4Y28 E;  2DD5 A;  4LD9 K;  5CIU A;  2A3L A;  2E12 A;  3EFS A;  3VJP A;  1JJ2 A;  3C12 A;  4XTW A;  4M78 G;  2B8A A;  2RHZ A;  4L59 A;  4ME7 A;  2ZCF B;  2ZZD A;  4F7U E;  2LVM A;  4DOW A;  1W2B A;  2QEX T;  2YRV A;  4R56 A;  3LWH A;  2HNI A;  1WNL A;  5J3B A;  4XK8 E;  3QBY A;  4D6W A;  3CC7 A;  4BDZ A;  1KC8 U;  5L8R E;  2RM4 A;  4JUV A;  2X4Y A;  2PVD B;  3NTH A;  4JRI A;  2FHD A;  2LNV A;  3BDU A;  1M5Q 1;  2EAY A;  5CKF A;  2RH2 A;  3ME9 A;  2HAX A;  1OYX A;  3HRT A;  5CK9 A;  2VYT A;  2VXF A;  5FLX E;  2E10 A;  4B9X A;  4C5G A;  3J80 E;  1NJI U;  4MML A;  3SWN A;  3CCS A;  2DO3 A;  2KK4 A;  2P4T A;  1GXI E;  2KVQ G;  4XU1 A;  2KDS A;  4A4K A;  3QJ6 A;  2K5I A;  4RKU E;  3RIR A;  4MMK A;  4BAC A;  1FXX A;  1ZQ1 A;  4ZGJ B;  2EQK A;  1K9M U;  2XIC A;  3P8H A;  3BFM A;  1DJ7 B;  3I55 T;  1XTD A;  2K5F A;  3PIP A;  1M9S A;  2V8J A;  2O4X B;  4M77 F;  3OYE A;  3A8H B;  3NTK A;  1BIB A;  3PNW C;  3PIO A;  2XDP A;  4C8Q E;  3M55 A;  4ZTJ A;  1WJQ A;  5DLQ E;  1B34 B;  5FU7 B;  1QW1 A;  3M4Y A;  2LTO A;  3WVE B;  4O6J A;  5A0D A;  2DIG A;  4M77 E;  5FRM A;  1SSF A;  4N0A A;  1I4K 1;  4P5N A;  2JZ2 A;  4C8Q F;  1BKB A;  3PTA A;  3UT1 A;  4A4F A;  5GAO m;  1U8R A;  3CCS T;  5LJ3 g;  3MP8 A;  3JCM W;  1P92 A;  3X25 B;  5GMK h;  3GLX A;  2K5L A;  3QYH B;  4J8O A;  5GAM h;  5GAN 4;  1G3Y A;  2ZGW A;  3FDR A;  1YJW T;  4RCB A;  4DA4 A;  4LDX A;  5LJ3 d;  3KXT A;  3FIF A;  4QVZ A;  3I56 T;  2GFU A;  2DEQ A;  1VQN T;  3PT9 A;  1VQL T;  1TH7 A;  2XG8 D;  3CCR T;  4BD3 A;  1Q82 U;  4PJO A;  3QYG B;  2KY9 A;  1Y96 B;  1JRI A;  4M7D B;  2FB7 A;  1VQ4 T;  2DXU A;  4ELY C;  5I2M A;  2X4X A;  1VQ5 A;  2RI3 A;  3RUX A;  1K8A C;  4J5Y A;  3VV0 A;  2JUF A;  1BI1 A;  4X9C A;  1VQ4 A;  3OS5 A;  4C0D B;  2DTH A;  5EG2 A;  3E19 A;  4Z02 A;  4EMK A;  1V29 B;  3C94 A;  4OB1 B;  4OMF B;  4PKC C;  3GP8 A;  1QVG S;  4JRP A;  2X4W A;  5J39 A;  3QDR B;  5CCA A;  4X34 A;  3QUI A;  3MEU A;  3CPF A;  2O4X A;  3HRS A;  4CI0 C;  5GAN d;  1KQ1 A;  3OYD A;  2FYK A;  3M5A A;  4CRI A;  1VQM A;  4ZGD B;  3OYG A;  3LLR A;  3F70 A;  4PJO C;  4C92 F;  3M56 A;  1HXD A;  3JCM X;  3L2R A;  5GAN g;  2V8K A;  2KQW A;  1KHC A;  2KSS A;  2R57 A;  3OB9 A;  5DLO A;  5GAM f;  3INZ A;  2XKO C;  3MO8 A;  2DXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...