5CIUA

Structural basis of the recognition of h3k36me3 by dnmt3b pwwp domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
127
Chain Sequence
EYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFDQLKPMLEWAHGGFKPTGIEGLKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA (cytosine-5)-methyltransferase 3B
publication title Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 127
sequence length 136
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 5ciuA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ciuA01
2IG0A 2B8AA 2RHYA 2FHDA 4A4GA 4C5HA 4C5GA 4IUVA 2M0OA 3QIIA 3NTHA 2MWPA 3PFSA 4HCZA 3CEYA 3MEUA 2QQRA 3OMGA 3MEVA 2VYTA 2WACA 3MEAA 3OYCA 2RHXA 2BIVA 3LX7A 3QBYA 3F70A 4Q5WA 3LLRA 3OS1A 2JTFA 1WJQA 3NTKA 4QVZA 2E5QA 2EQMA 3SD4A 5KCOA 4BE2A 3NTIA 2K3YA 4N4HA 2XK0A 4B9XA 2F5KA 2QQSA 1OI1A 2R58A 2G3RA 2RI5A 3UT1A 3L2UA 4IUTA 4II1A 2LDMA 3S3OA 4C5IA 3M9QA 4UC4A 3DLMA 4B9WA 2R57A 2P0KA 5CIUA 3OB9A 4EDUA 5FRNA 3OYGA 5IAYA 4IKFA 2LRQA 2MWOA 5D6XA 3FDRA 3Q1JA 5KE2A 4E7IA 1WGSA 2RI3A 3E9GA 4E7JA 2EQKA 3MP1A 3FLGA 2XDPA 2X4YA 4OVAA 5KH6A 4NS5A 1OZ2A 4PLIA 2JZ2A 1WJSA 4A4EA 4ZTFA 3L2QA 4QQGA 3MEWA 3PMTA 3H8ZA 2DIQA 2LCCA 3OYAA 4BE1A 3DB3A 3ZEHA 4ZTJA 2K3XA 3OY9A 4A4HA 2M16A 3OYLA 3OYNA 3LH0A 3S6WA 5IN1A 3ME9A 4RG2A 2R5MA 4QQ6A 3MP6A 2RI2A 4LD6A 2E6NA 3OMCA 5D6WA 4FU6A 3KUFA 2GFUA 4N4IA 4C5EA 5FRMA 4L59A 3FC3A 2X4WA 3H6ZA 3P8DA 2RJCA 2RHZA 5M9OA 5C0MA 4BACA 4X34A 2O4XA 3FEOA 3OS2A 2NLUA 3L2VA 3ASKA 3DB4A 5C6SA 3PNWC 2L3RA 2YRVA 3MP8A 4GY5A 4IUQA 2X4XA 4BDZA 2PQWA 2LVMA 2RHUA 3OQ5A 1MHNA 2DAQA 2LTOA 4E7HA 1OYXA 3L42A 2M1HA 2HQEA 2CKKA 2RJDA 3O8VA 3PMIA 4IUUA 3LGLA 5D6YA 3UWNA 4A4FA 2D9TA 3QJ6A 3META 4Z02A 4N4GA 5FROA 4E7LA 2R5AA 4FL6A 3BDLA 4CRIA 3LYIA 3S3NA 1N27A 4IUPA 1XNIA 3OYHA 3EAEA 3OYMA 1G5VA 1KHCA 2RHIA 3GOXA 4QW2A 3S3MA 4QQDA 4IURA 3OYDA 4E7KA 1SSFA 2EKOA 1H3ZA 3OS0A 3MO8A 2BUDA 2DIGA 3L2WA 3OYKA 2GF7A 3OYIA 5KCHA 4BD3A 3OYJA 1OZ3A 2BKDN 4BDYA 4PLLA 5J26A 3C4SA 4PL6A 2EQUA 4BE0A 2EQJA 3P8HA 1RI0A 1WJRA 2HQXA 3OYFA 2L8DA 2GFAA 2RJEA 3LGFA 2RJFA 2X35A 3OYBA 2O4XB 3OYEA 3L2RA 2EFIA 5KE3A 2RO0A 5J39A 2L89A 3E9FA 3QKJA 3OA6A
chains in the Genus database with same CATH superfamily
2B8AA 4A4GA 4JDSA 3L2ZA 3HRTA 2PUKB 1E6GA 2K79A 1H641 3QO3A 1O75A 3MEVA 1YCYA 2V26A 3HTRA 5CQXA 3PTAA 2J6FA 4OB0B 1RLPC 5IXFA 2FL7A 3NTKA 5GMKl 3PT9A 1JBMA 1H9FA 5HK3A 4JJBA 3CMET 2KY9A 1A63A 3UT1A 3RMSA 1OULA 2COZA 3OB9A 4FYXB 5D6XA 2BTTA 4E7JA 4M75D 4J9GA 1VQMT 2DVJA 3WVDB 1YIJA 3E2UA 1LOJA 1YITA 1JJRA 1AD5A 1AWJA 2QQBA 2QK0A 4UZWA 2QA4A 3MJXA 1JEQA 1Q82R 4LD6A 3EFOB 2GFUA 4E2FB 2MYSA 2AKKA 4M78E 2LNHB 1D0YA 4OB1B 1WXUA 2X3XD 4HCBA 5DY9A 2LJ1A 3QDRB 4TVRA 1RAAB 3G6ET 3DLLA 2CP5A 4M77D 2PQWA 5I21A 3G71T 4XU1A 3A98A 3QYHB 2HDAA 1KD1R 5FW9A 2CKKA 3LGLA 2O31A 3JB9H 4AG1C 4CRIA 3LYIA 2DXTA 5D7UA 3UPUA 5EG2A 2DILA 3MHXA 2K7AA 2O88A 5GAOl 5KYXB 4C8QC 2AT1B 4ZGJB 1X2KA 2P4RA 3LWHA 2DTHA 1QVFS 4PL6A 4F7UB 2F69A 2HQXA 3OYFA 1VQPA 2RJFA 4FIBA 3G4SQ 5CO7A 2DXUA 3HPWA 2HQHA 5GAMg 1UTIA 2IG0A 3EG1A 3V7SA 2FO0A 1YJ9A 4WCIA 4IIOA 2I2LA 1WZOA 2AZSA 2JJ9A 3EG9A 3KFVA 2KEAA 3PGGA 3TQ7P 3QHSA 1EIFA 1YBYA 3CQTA 1BI2A 3LW5E 1IZ6A 2COWA 3JCMQ 3R6OA 5CIUA 4EDUA 2MAMA 1K8AC 2HBPA 5IAYA 3GIBA 3QWYA 2KMTA 2LT1A 1YIJT 1YITT 3M4GA 3CCSA 2KFVA 5GAN3 2QI2A 3FJ5A 5IHNA 4BE1A 2BE9B 2QA4T 2FPEA 1M4ZA 4KH0B 1M1KU 3HKSA 2QGFB 1QWEA 1D1AA 3BFMA 5CKFA 5FWCA 2GTOA 4M7AA 4M7AF 1Y96B 1K0XA 2XU8A 3FJPA 1K76A 4L59A 2C0OA 3BY7A 2RN8A 1YNZA 4C92C 5KYWA 4E6RA 3OS2A 3CD6A 2K4YA 2L5QA 1K9MR 3VS0A 4PJOC 1MMDA 2EYXA 1QKWA 2RK2A 4OMFB 4MDWA 1T0HA 2DNUA 2MIOA 2RMOA 3UWNA 5GAOn 3LWIA 1W2BS 4KBMB 3I5RA 2XI9A 4XQ3A 2I0NA 3EGUA 3OW2S 3C0CA 4M78D 4MZPA 2QEXQ 1H3ZA 2RD1A 3D7SB 1BI1A 4BDYA 1SRMA 1U5SA 2RJEA 2FVUA 4QVCA 4ZNXA 3CCQQ 5FLXE 1ZLMA 1YJ9T 1I81A 1TUDA 2BE7D 2K2VA 4BY6B 2KRMA 3PFSA 1BYMA 2J7IA 5GMKe 3G1JA 2VUBA 2CH4A 4C0FA 1VQ4Q 4A63B 2VXFA 2O9VA 2EQMA 1GBQA 2DVEA 3X28B 2G3RA 2RI5A 5GAMe 4IUTA 2LDMA 2DL8A 3M9QA 3CCST 1N5ZA 4M78A 4M78F 2HBWA 1QQJA 1Y07A 3JCMf 5GJVB 2L3PA 4FSXA 1VQ5Q 1H1JS 1VQ9A 2DBKA 1KQ2A 2VASA 1R77A 1H9EA 1VQOA 1QCOA 3A1PA 1E6HA 2AKLA 1MMAA 2KYBA 1PWTA 2YUNA 2QG9B 2EYYA 1NBEB 1QWFA 2ED0A 2RI2A 4FYYB 3RNJA 3CPWA 4M7AG 1GJJA 2CP7A 4C92E 1MGQA 5M9OA 1NPPA 3URGA 1U06A 1W1FA 1OPKA 3RESA 4GBQA 3I55A 1CKBA 3HSBA 2DXBA 5GAN7 1X6OA 4A4FA 4IUUA 4ORZA 3SEMA 1MNDA 4FL6A 1UB4A 1MNEA 3NMZC 1GXIE 1TTHB 4XU0A 5ECAA 2JM9A 1MMGA 2BZ8A 3OYKA 1M8VA 4RCCA 2FEIA 1OU8A 2QXFA 4ELZC 4MDXA 1G3TA 5LJ3g 5FU6B 4HCKA 4MMKA 1YN8A 2EGAA 1D3BA 2EYZA 2ZZDA 1M2VA 1AOJA 3VUZA 4C8QD 2A36A 2MPHA 1KHIA 1QVFA 3CCRQ 1PHTA 1PRMC 2K3YA 2M51A 3PE0A 4N4HA 3GP8A 2MMPA 1IGQA 1I5LA 2YRCA 2A8VA 1EFNA 3S3OA 1UECA 3DLMA 1VQ9T 2R57A 1Q86C 1ZUUA 2EPDA 1PG5B 2JM8A 2LRQA 1VQOT 3CXCA 5KE2A 4E7IA 1PSFA 3CC4A 4MZTA 2XDPA 2X4YA 1OX8A 2J6OA 4M75C 3QPHA 1Y71A 1ZSZC 2HKQB 3RIRA 4A4HA 2FZKB 1TS9A 1M1KR 2NUPB 2B86A 2A0FB 4C8QA 4C8QF 1KQSP 4LDWA 1S72Q 4YTLA 5FRMA 3UF4A 3NHNA 2V8KA 3P8DA 2RHZA 3GPLA 3I55T 4JZ4A 1BU1A 2EKHA 1Y02A 1R8OB 2ZAEA 2FZCB 3P8BB 4J9DA 3JCMW 1TXQA 4DBHA 3TREA 2L3RA 4LN2A 1BI3A 3SWNB 1S1NA 3HFNA 2NWMA 4OGCA 2RJDA 2QNFA 2CS7A 2EQIA 4M77C 4N4GA 2ZPHB 1N27A 4FCYA 3PVQA 4X9CA 4C92D 3VRZA 2KAFA 1I8FA 1SG5A 4QW2A 2KQWA 4PJOD 4D8KA 4M7AB 4BD3A 1M1GA 2D6FA 2KE9A 2MPXC 3P8HA 3BW1A 2LMJA 5KE3A 2L89A 2KNBB 1BKBA 3QKJA 2DK3A 3RKXA 2G6FX 4C0ZA 3ZFJA 3KXTA 2DO3A 3CCJQ 1UGQB 3QBYA 4ZGDB 3OS1A 4OMLA 5LJ5f 4M4ZA 2C06A 3OW2P 2JS2A 5IXBA 2RF0A 1FMVA 5LJ3e 2R58A 4KGVB 3V8LA 1I5OB 3GNFB 1GFDA 1ZBJA 3L1AA 3SB2A 4C92A 3J7AF 1WHKA 3CC4T 2FB7A 4PJOA 4PJOF 3NFCA 1YI2A 3Q1JA 2KRSA 4A4EA 2YUOA 2OI3A 4B6MA 5GANf 4DEYA 1YHQQ 2O9SA 1HXDA 1P92A 3M0RA 1RAIB 2DFUA 3ME9A 2ROLA 3U23A 2J06A 1X43A 4EMKC 1JXMA 1PRLC 2CZ0B 1Q86U 2GQVA 3H6ZA 3ER0A 1HK9A 4XAXB 3CCVQ 3E19A 1UJYA 4R56A 2XD0A 3V8KA 2KT1A 3MP8A 3OQ5A 1UG1A 3JSCA 2A3LA 3L42A 2VXEA 3JCMg 1E7OA 1XNIA 4PJNA 5GAOr 1M8MA 1YJNA 2IIMA 3DKMA 3EHQA 1BK2A 1NYFA 2ECZA 2OTJQ 1NYGA 2VVKA 1PKSA 4C0DC 1JXOA 3X25B 1HJDA 1OZ3A 2QEXA 4FYVB 4BE0A 3OYYA 2EQUA 2JW4A 3M59A 2RQVA 5CQYA 2XDBA 2X35A 2RO0A 4FW2A 5I2MA 3JV3A 3MCAB 3JCMV 5HCKA 3CEYA 3MEUA 3CCQA 2M0YA 3I56A 2CREA 2P84A 3QSUA 4JRKA 2EVRA 3HFOA 2QQ9A 4AMCA 2XK0A 2O2OA 4RTTA 3REAB 1VQ4A 1YI2T 5CAIA 1UDLA 4M7DE 2P0KA 3JB9D 2KI7A 5AYFA 4E7ZA 2KR3A 1YP5A 4PLIA 1OX9A 2DIQA 3DB3A 1M2VB 6AT1B 4J6XA 4JJDA 3INZA 3QWXX 1QVPA 4FYWB 2L0AA 2DYBA 1W4SA 2ZGWA 4WF2A 2Y4XA 3H0HA 1NJIU 1N9RA 4D8DA 4J83A 2DZCA 2RJCA 3A8HB 4Y28E 4V2SA 4ANJA 4X34A 2DZ9A 3CPWS 1E7LA 2DMOA 2K3BA 3CCLT 1MV3A 4PFZA 2G80A 1D1BA 2FPDA 2GGRA 4EMHA 2JT4A 4E7HA 4DOWA 3JB9F 1YJNT 2HQEA 1ZA2B 4RUGA 4X9DA 1JB0E 3H0IA 5CR2A 2KW9A 1VQLA 2R5AA 1PSEA 1M30A 1WLPB 1UHCA 4IUPA 2Y90A 1AZEA 1TUCA 3J80E 2QYZA 5LJ3f 1KHCA 2WQGA 1Q81C 1U1SA 2QEXT 2ODGC 4Z8AA 2P0QA 3OS0A 3MO8A 2DIGA 4XTVA 3CMAQ 2C0TA 2O01E 1VQ6A 1M2OA 1UGRB 3JCMe 3M0SA 2L8DA 3LGFA 3CCQT 3I56T 2J05A 1IGUA 4M75A 4M75F 1VYTA 1ZSZA 4JLGA 3OMGA 4LXCA 1FXXA 3FIFA 5GAN5 3I5SA 2BIVA 4PK4A 1UE9A 3LX7A 1VQ4T 5CKDA 3M0UA 3THKA 3SD4A 3FRNA 2LP5A 4LUDA 1LJOA 1V1CA 1BCOA 2EJGA 2DRKA 1UHFA 3L2UA 1B34B 3PIOA 1UUEA 2KRNA 2LQNA 2OAWA 1B07A 3VKIA 5GAMj 1VQ8Q 1VYUA 1SPKA 2QQAA 3EG2A 4BI4A 4FW1A 3LH5A 4AT1B 4M77A 4M77F 3CXCS 3H8ZA 3AHUA 4FT4A 3VRYA 4NOYA 1VQKQ 5GAMh 3JCMc 3CC2A 2R5MA 4QT7A 4RCBA 4M7DD 1Q86R 2DM1A 3RMQA 4HA8A 1RAHB 5LJ5g 2RA2A 5A0LA 4XTWA 2JMAA 1VQLT 3GBQA 3SHWA 2X4XA 1JRIA 3OS5A 2VV5A 1TSFA 3M0TA 3O8VA 5DLOA 7AT1B 4E7LA 1VYVA 4JJCA 1MV0B 4HVUA 1BB9A 1WQ7A 4PJLA 1LVKA 2HEQA 2QASA 1G8XA 2DL4A 5GANg 2HNIA 1EZZB 4IURA 1X2QA 1VQ6T 1X27A 4HT8A 2XKOC 3CC7Q 2XDDA 1VQNA 3QYGB 1J3TA 1GL5A 1JEGA 3CMEQ 4O6JA 1ACMB 2HSEB 3HRUA 5I22A 4ATOA 2DEUA 1A62A 1VUBA 1M3BA 1YJWQ 1KIKA 2M0OA 3X26B 2MWPA 1Q7YC 1NG2A 1Q81U 2F2XA 5I2SA 3UDCA 1XQHA 3VS2A 3OYCA 2RHXA 3WXMB 1VQMQ 1VQPT 4QVZA 3EGDA 4EMKA 2AIRB 1H8KA 2DF6A 2CZ6B 5A2QE 2VGMA 4HKEA 1TOVA 2EYQA 1EX4A 4J9FA 4OP0A 5FRNA 1FYNA 5FU7B 2VWFA 2QDLA 4HCCA 5GAN4 4ZGEB 1WI7A 1RAEB 2OTLA 3MP1A 3GNGA 2ZPIB 3SFMA 2XIDA 3EHRA 4J7FA 4QQGA 1QVGS 1X6GA 3G6EQ 2W51A 4M77G 3CC2T 1PC0A 4KRTA 4LUEA 3OY9A 2KDSA 3G71Q 2MCNA 1K1ZA 1ARKA 4RG2A 1KG1A 2NUTB 1NZ9A 1YHQA 2E4HA 1TH7A 3MP6A 4XU2A 1NJIR 4FU6A 4C5EA 1Y57A 2JS0A 4P5NA 4KGZB 4RTZA 1FX7A 4O5VA 4F16A 4F7UE 3MPUB 1ZUKA 3HRSA 3TSWA 2V8JA 3CCEA 2LX7A 2KVEA 1ZBHA 3MKDA 4Y92A 2DLPA 1M1FA 4OF1A 4Z02A 3VS7A 4LD9K 5LJ5e 1G5VA 3CD6T 4AFSC 1K8AU 4HT9A 3IQLA 1VQNT 3S3MA 1KK7A 2HAXA 3CCMA 4JZ3A 3OYIA 1W70A 1ZUYA 2ZPFB 3CPWP 2EQJA 2OTJA 4KUDK 4OMQA 2KVUA 2IPOB 3OYEA 2BZYA 3M5AA 2LX9A 2K9GA 2EIFA 3OA6A 1ZBXA 2SEMA 2FHDA 4J9IA 4MZMA 5GANe 5HKCA 1JJ2A 4L5GA 2EAYA 1YIJQ 2VB6A 1YITQ 1SHFA 3CBPA 2X3WD 1W6XA 3WVEB 8ATCB 1VQ7Q 1WJQA 2ABLA 2D8HA 5KCOA 2ESWA 4B9XA 1T3SA 4LDXA 5L23A 2VC8A 2DD4A 2OTLT 4OB2B 5KYUA 2DE0X 5LJ3j 3OYGA 3BDUA 1Q7YU 3FDRA 1WGSA 1X69A 2L2PA 4OVAA 5KH6A 4DBFA 2JZ2A 3T9NA 1YHQT 4BI8B 2KT8A 5LJ3h 3EFRA 4M75B 1ZSZB 2OX7A 3EH2A 2PTKA 3LH0A 2JVWA 2E6NA 1SF9A 1QVFP 2CYZB 4J9EA 4GLKA 3HP9A 2GBQA 4M78G 4OMNA 5CVIA 5HY6A 2OAUA 4OMOA 3CCET 3L2VA 5GAMd 3ASKA 1QP3A 1X01A 2F2VA 3DB4A 4ZN3A 5C6SA 2A7YA 4BDZA 1N9SA 4XTZA 5FU6C 1KC8C 2DA9A 4HXJA 1YJ9Q 4M77B 3EG9B 2XG8D 3CCMT 2H8HA 2Y4YA 3QZ5B 2RHIA 1WXBA 2XICA 3CCUQ 2DTOA 5IT9E 3X20B 1FMWA 2MOXA 4PNOA 3M4YA 3TEEA 3NPFA 1D09B 3OYBA 2ROTA 3CCSQ 1RUWA 1U3OA 2D8JA 2EJ9A 3E9FA 4IIMA 2RHYA 3PVLA 2E3IA 2COYA 2VGNA 1Q81R 5KYNA 2QQRA 2YWWA 1R0BG 4DBRA 1MMNA 4EMGA 4Q5WA 3LLRA 3JCMJ 2GQIA 2D0NA 1IRXA 4F14A 1IHVA 1OI1A 2QQSA 1RAGB 4R0KA 3EGXA 1JQQA 5KYXA 1ZHIA 2OJ2A 2HZYA 3RKWA 1A0NB 5KYWB 4B9WA 2YDLA 5IH2A 1YFNA 2DJQA 5DM7R 1WHJA 3UA7A 4IKFA 1MUZA 3G4SA 2DRMA 1W2BP 4JPBW 3TSZA 1H92A 2FRWA 5J3BA 1WIEA 1UFFA 4XU3A 3SWNC 2K3XA 1BIBA 4QKUA 1FWZA 4ESRA 3OYNA 4OGEA 1K9AA 2MI6A 1YWPA 2RPNA 2CSQA 4C92F 1VQKA 2KGTA 3EGDB 4EMKB 2E65A 2AK5A 3SDZA 1WYXA 5CK9A 1QVGA 1JU5C 3NGPA 4VUBA 4M7DC 1UJ0A 2K6DA 3C94A 4XTXA 4A4KA 2M1HA 3PMIA 1AVZC 3OSSC 2QAZA 1JO8A 3EAEA 4C8QG 1K8AR 3VV0A 2JTMA 4L6V5 4QQDA 1SSFA 2HSPA 2LQKA 2MK5A 1Y96A 2DD5A 1QCNA 4HVWA 4M78B 2PVDB 4PLLA 2LQ8A 3C4SA 1JEIA 1GFCA 2RB6A 1U8RA 1WJRA 3CC7A 2GFAA 2KYMA 1KC8U 3ZBDA 1ZS9A 1CSKA 3ZL7C 5EC7A 1YNSA 1RADB 2FYKA 3QIIA 1VQOQ 2JUFA 1I07A 3QUIA 2YUQA 1G83A 1YJWA 3UATA 1T0JA 2VKNA 2V1RA 4BE2A 3NTIA 5AT1B 3JCMh 5LL6S 2LQWA 1NM7A 3PIPA 1D0XA 4JLIA 3G4ST 2CT4A 1WXTA 2XHCA 4AG2C 1Q7YR 2YLCA 3CBMA 2LNVA 3VU3C 3I55Q 3VS6A 2EQKA 3G7ZA 2K5IA 4D6WA 3L2QA 1SKUB 1ABOA 3ULRB 1VQKT 1QKXA 3G6EA 1U1TA 4QVDA 5IHIA 1QP2A 2J6KA 3C12A 4KGXB 3JB9J 2JNGA 1WPYA 3OMCA 4C92G 2E10A 1GBRA 2EYWA 4F17A 4M7AE 1I0CA 1N6AA 5LJ3d 1I4K1 4PJOG 2O4XA 2RNAA 2JVVA 3FEOA 5HK0A 1R0CB 2KK4A 1VQ5A 2YRVA 1D3BB 2RQWA 1MHNA 4J9HA 1WQWA 2K5LA 4JS4A 2D9TA 3QJ6A 3BDLA 3V8JA 2ZPGB 1WHHA 1OPLA 4Z88A 2E3HA 2FG0A 3J81E 3OYDA 3CBOA 4CC2A 3CC7T 3M54A 2GF7A 1Z9QA 4NL2A 2CSIA 2ATCB 1M1KC 1ZSGA 1B3QA 1T3LA 2Z0WA 1NLPC 3V7RA 4JS5A 3KBGA 1LCKA 2EFIA 3CC4Q 1YJWT 4KH1B 1N8RC 1KQ1A 4C5HA 5DLQE 4RTYA 2WACA 1OOTA 1JJ2S 2E64A 1KFZA 2PNIA 4C8QB 2F2WA 2ENMA 2YT6A 2HD0A 3M56A 1VQ7A 2EGCA 4DQ2A 2QTVA 1XOVA 4C5IA 2QTXA 2ZPEB 1GL9B 2DL3A 4DOVA 1M27C 1TUGB 3M0QA 5GAN2 1V29B 4DEXA 2V8IA 4OMMA 1GKUB 1BIAA 2RI3A 2CDTA 4ZTFA 1M90C 4KUIA 4E7SA 4ZTJA 2DL7A 2DBMA 5GMKj 3CCRA 2YSQA 1E7DA 1K4US 2V1QA 1C1AA 3QDFA 1VQ5T 1PKTA 5GMKh 3UA6A 3EGXB 3RDVA 5CKHA 4R55A 4LDUA 1RLQC 1OYXA 1M3CA 3OYAA 2RQRA 2WSCE 5D6YA 2JOYA 1WNLA 5I11A 3I35A 2PU9B 2YXYA 1UGVA 2NUPA 4JJNK 4M7AD 4A53A 2W10A 2NYSA 4EIKA 2EKOA 1S72A 4X1VA 2BUDA 2D1XA 3L2WA 3JB9I 5LJ5j 4C92B 1KQSS 3CCUA 1UGSB 4Z89A 2CZ7B 1KC8R 1X75C 4NL3A 4PJOB 4ZN1A 2X4JA 5CKBA 1WFWA 1ABQA 3V7CA 4BB7A 1PM3A 1YI2Q 3JB9G 2HCKA 4N0AC 5LJ5h 4FM4B 2EW3A 2QNCA 3SWNA 2X51A 3VJPA 4PFPA 1G2BA 2E1HA 1LNXA 3VUBA 4RTXA 1VQ7T 5GANj 1I1JA 2CH4W 4Y91A 2KROA 4LE9A 3TCJA 1PNJA 3JCMb 2ODCI 4M7DA 4RG8A 4M7DF 3TVTA 2DEQA 3QZ9B 1HSQA 4GLMA 5KYYA 1K73C 2FPFA 1B7TA 5GANh 2CP0A 1N8RU 4FSSA 2X9HA 4M75G 3JCMd 2RQTA 3VS3A 1PD0A 1AT1B 2LCCA 3CCLQ 3CCRT 3CCJA 4XTYA 2CUDA 3OYLA 2L3QA 3S6WA 1YJNQ 5FWBA 2ZCFB 1V76A 4EPCA 1RACB 2DPPB 3JAME 4C8QE 2QGGA 5GMKm 2DJZA 5C0MA 2KXDA 2H3JA 2NLUA 3JCMX 1D0ZA 3PNWC 4PJMA 3M57A 2DKGA 1M90U 2JTEA 3CPFA 2LTOA 5GAOp 3I56Q 2KSSA 1QW1A 5FROA 1RABB 2HL5C 1S72T 1Y7XA 5GMKi 2RNNA 2KVQG 2GNCA 3CCUT 4ME7A 3X24B 2DX1A 4PJJA 1IO6A 1YWOA 5KCHA 2NUZA 4A54A 4FT2A 4J7IA 2M9UA 4XTUA 2KBTA 4LNPA 3CCVA 4ELYC 2DTIA 5A0GA 2DYIA 2W0ZA 2DERA 3RR6A 2O4XB 4J9CA 2LT4A 5FU7C 4CC7A 4JRPA 1O9SA 4BY6C 2CUBA 3NTHA 4AFQC 1BI0A 4MMLA 1TWBA 1IHWA 1QCFA 4J9BA 2F5KA 3VS5A 4J8OA 1WX6A 2PZ1A 2YUPA 1GCQC 4CC4B 4DA4A 4M7DG 2LZ6B 2DK4A 2EGEA 2E12A 4OMPA 1Q82C 2A28A 2YRDA 1OV3A 3A8MB 2FRYA 5GAOm 1AHJB 2CP2A 2KXCA 2DXCA 3JRZA 2MWOA 3CCJT 1NEGA 1F1BB 4LDVA 4PJOE 1DJ7B 3H9NA 1UEBA 1OZ2A 4NS5A 1GRIA 5GAOq 4RTUA 2E41A 3PMTA 3ZEHA 2QA4Q 1VQLQ 2YHTA 1BCMA 3HL8A 2M16A 1M5Q1 2JN0A 1JJ2P 5IN1A 1KD1C 3VYGA 3QJYA 1PD1A 2PVGB 4JRQA 2HKNA 1K73U 4CC3A 3M0PA 1AWWA 2EBPA 2X4WA 1IREB 4BACA 1VQ6Q 5A0DA 1RL2A 2HMAA 2SRCA 4RTVA 4AFUC 1WA7A 1SEMA 2PUOB 2LC3A 2WSEE 5CCAA 5CKEA 3N5BB 2LCLA 4RTWA 2CZ1B 2EJFA 1XTDA 2HJQA 1RI9A 2JXBA 2RM4A 2P0PA 3GOXA 2AHJB 1OU9A 1SRLA 3CCVT 4J6YA 1VQPQ 4BI3A 1VIEA 9ATCB 1VIFA 2BKDN 1IB8A 5J26A 1V66A 2LJ0A 2DL5A 2FZGB 1WDXA 2LD7A 3CXCP 2E5KA 3QG1A 2BZXA 1WHGA 5J39A 4IUVA 1BBZA 1G3WA 1Y0MA 3EG3A 3I9QA 1KQSA 3MEAA 3QXEB 2E70A 2OTJT 2JTFA 2WSFE 5GAN8 3EFOA 3CC2Q 1AEYA 2EWNA 1PCXA 3EFSA 2IVWA 3M58A 5LJ5d 2YLBA 1NEBA 5L8RE 4J5YA 5GJWB 1AWXA 3CMAA 2L3SA 2XMFA 1N8RR 1VOMA 2CP3A 2AZVA 2M02A 3E9GA 4J6WA 3RKYA 1IXDA 3FLGA 3GLXA 4CI0C 2A08A 4OB3B 3MEWA 4DBQA 3REBB 1K9MC 1SSHA 5GANd 5IHKA 1TG0A 4QQ6A 5D6WA 1ZX6A 2ZPBB 1Q82U 3CD6Q 4F7UA 4F7UF 3HHTB 5GAMf 1VQNQ 1TU0B 4M7DB 1B34A 3H41A 2HL3A 4AFZC 5KYYB 2LCSA 4RMOA 4N0AA 1M90R 1VQ8A 2F5TX 4HVVA 1W2BA 1C0MA 4GY5A 1M3AA 4IUQA 2RHUA 2LVMA 3A8LB 4F04B 1NE8A 2LC4A 1HYOA 2GTJA 1KD1U 3OW2A 2RNOA 3A5ZB 2GCXA 3S3NA 1SHGA 3E1SA 4JUVA 4KT0E 2LJ3A 2PVOB 3C95A 2RH2A 1KJWA 2F1LA 1OEBA 1ZQ1A 3FB9A 4M7AC 2JMCA 3GF5A 3EH1A 3A8OB 1K0SA 4K11A 1GCPA 4RKUE 1RAFB 3BE3A 3H0FA 3L2RA 1QVGP 2A37A 4PKCC 1A8VA 1NJIC 1VA7A 3JCMP 2OTLQ 4C5GA 2CGHA 1NPRA 2C0IA 3OSVA 2KVDA 4HCZA 4JRIA 1LPLA 1C6VX 2VYTA 4M75E 3F70A 1D1CA 2K2MA 2E5QA 1NLOC 3CMAT 4XK8E 4C0DB 1KSWA 4LDYA 3RERA 1QMCA 4KULA 2ED1A 4II1A 1G3YA 4UC4A 3VS1A 2MF2A 4BUGA 1VQ9Q 1X6BA 3R6NA 3CMEA 3TU4K 1ZA1B 1CKAA 3VYHB 3CCEQ 1QLYA 2RQUA 1WJSA 1WHMA 3M55A 4BITA 4C0GA 3RUXA 3A8GB 4M77E 1VQMA 3CCLA 2RK1A 1XJWB 3VS4A 1K73R 1FMKA 2E6ZA 3KUFA 4N4IA 3CCMQ 3O5ZA 3FC3A 1YCSB 1VQ8T 4E47A 3RBBB 4F7UG 1Z9ZA 8AT1B 3OBYA 3OBWA 4M78C 1EN7A 3M53A 1K9MU 2P4TA 2DAQA 3AT1B 2H3EB 2K5FA 2D0QB 3L0OA 3META 1H3HA 1UGPB 2DETA 2CT3A 3G71A 3OYHA 3OYMA 1AZGB 2QDYB 2NUTA 1HD3A 4E7KA 1GCQA 1Q95G 1M9SA 3OYJA 1AWOA 1OQKA 5KYUB 4WTOB 2CP6A 1RI0A 4PFOA 1WHLA 2K57A 5GAN6 1G3SA 3EG0A
chains in the Genus database with same CATH topology
4N0AC 5LJ5h 1ZBXA 2B8AA 2FHDA 4MZMA 4JDSA 3L2ZA 4FM4B 3SWNA 4A4GA 4L5GA 4C0ZA 3ZFJA 2EAYA 3KXTA 1JJ2A 3HRTA 2PUKB 3VJPA 2DO3A 1H641 3QO3A 1O75A 3CBPA 3MEVA 2E1HA 1YCYA 1LNXA 3VUBA 5CQXA 1UGQB 3PTAA 4OB0B 3QBYA 4ZGDB 3WVEB 3OS1A 1VQ7T 5GANj 1WJQA 2FL7A 3NTKA 5GMKl 5LJ5f 4Y91A 2C06A 3PT9A 5KCOA 1JBMA 3TCJA 4B9XA 5HK3A 5LJ3e 2R58A 3JCMb 3V8LA 3CMET 4LDXA 2KY9A 4RG8A 3UT1A 4M7DA 3GNFB 4M7DF 3L1AA 2DEQA 3QZ9B 3RMSA 3SB2A 4C92A 2VC8A 1K73C 3J7AF 2DD4A 2OTLT 3CC4T 5GANh 3OB9A 4OB2B 5LJ3j 3OYGA 1N8RU 2FB7A 4PJOA 4PJOF 3BDUA 3NFCA 1YI2A 1Q7YU 5D6XA 3FDRA 3Q1JA 4M75G 1WGSA 4E7JA 4M75D 3JCMd 4OVAA 5KH6A 2JZ2A 3T9NA 4A4EA 5GANf 1VQMT 3WVDB 1YHQT 2LCCA 3CCRT 4BI8B 1LOJA 1YIJA 1YITA 1HXDA 3CCJA 4XTYA 5LJ3h 3EFRA 4M75B 1P92A 3OYLA 2QQBA 3LH0A 3S6WA 3ME9A 2QA4A 2ZCFB 4LD6A 4EMKC 2E6NA 2GFUA 4EPCA 2CZ0B 2CYZB 1Q86U 4GLKA 2DPPB 3HP9A 2GQVA 4M78G 4C8QE 3H6ZA 3ER0A 5GMKm 1HK9A 3JAME 5CVIA 2DJZA 5HY6A 2OAUA 4M78E 5C0MA 4XAXB 3CCET 4OB1B 2H3JA 4HCBA 2NLUA 5GAMd 3ASKA 1QP3A 1X01A 3E19A 3DB4A 5DY9A 3JCMX 4R56A 2XD0A 3QDRB 4ZN3A 4TVRA 3V8KA 3G6ET 5C6SA 3PNWC 2A7YA 3M57A 2DKGA 1N9SA 3MP8A 4M77D 4XTZA 2PQWA 5FU6C 3DLLA 3CPFA 3JSCA 3OQ5A 2LTOA 4XU1A 5I21A 3G71T 1KC8C 3QYHB 2A3LA 3L42A 2VXEA 3JCMg 5GAOp 2CKKA 2KSSA 3LGLA 1QW1A 5FROA 3JB9H 4CRIA 4M77B 3LYIA 2XG8D 2DXTA 1S72T 1XNIA 3CCMT 3QZ5B 2Y4YA 5GAOr 1Y7XA 5GMKi 3UPUA 1YJNA 2KVQG 2RHIA 3DKMA 5EG2A 3MHXA 3CCUT 4ME7A 3X24B 2XICA 2DTOA 5IT9E 3X20B 5GAOl 4C8QC 4PNOA 4C0DC 5KCHA 3M4YA 3X25B 4A54A 4ZGJB 4FT2A 4J7IA 1OZ3A 3TEEA 2QEXA 2M9UA 3LWHA 4XTUA 2DTHA 1QVFS 4BE0A 3OYYA 2EQUA 4PL6A 4ELYC 2DTIA 2F69A 2HQXA 4F7UB 5A0GA 3OYFA 3M59A 5CQYA 1VQPA 2XDBA 2RJFA 2X35A 4FIBA 2O4XB 5CO7A 3OYBA 2DXUA 3HPWA 2RO0A 5I2MA 5GAMg 2LT4A 5FU7C 3E9FA 2EJ9A 2IG0A 3MCAB 4JRPA 1O9SA 2RHYA 4BY6C 3JCMV 3V7SA 3NTHA 3CEYA 2VGNA 3MEUA 3CCQA 1BI0A 2QQRA 4MMLA 3I56A 1YJ9A 2I2LA 3QSUA 4JRKA 4EMGA 4Q5WA 3LLRA 3JCMJ 3PGGA 3HFOA 2QQ9A 2XK0A 3QHSA 2F5KA 1EIFA 1OI1A 1YBYA 2QQSA 1M90U 4J8OA 1BI2A 3LW5E 1VQ4A 1IZ6A 1YI2T 1ZHIA 4DA4A 4M7DG 2E12A 5CAIA 3RKWA 1Q82C 3JCMQ 4B9WA 4M7DE 2P0KA 3R6OA 5CIUA 3JB9D 4EDUA 2MAMA 5DM7R 3A8MB 5GAOm 2HBPA 5IAYA 1K8AC 1AHJB 3GIBA 4IKFA 2KMTA 2LT1A 2DXCA 3JRZA 5AYFA 3G4SA 2MWOA 1YIJT 1YITT 3CCJT 3M4GA 4LDVA 3CCSA 4PJOE 1DJ7B 5GAN3 1UEBA 1OZ2A 2QI2A 4NS5A 4PLIA 5J3BA 5GAOq 2E41A 3PMTA 2DIQA 4XU3A 3SWNC 3DB3A 2QA4T 4BE1A 3ZEHA 2K3XA 1BIBA 2YHTA 1FWZA 2M16A 3HL8A 4J6XA 3OYNA 1M4ZA 1M5Q1 2JN0A 4OGEA 5IN1A 1M1KU 3HKSA 1KD1C 3INZA 3VYGA 1QVPA 2MI6A 3BFMA 3QJYA 5CKFA 1W4SA 2PVGB 2ZGWA 4C92F 4JRQA 4WF2A 1VQKA 2Y4XA 1K73U 4M7AA 4M7AF 1Y96B 4EMKB 2XU8A 3FJPA 2E65A 4L59A 1NJIU 1N9RA 2X4WA 4J83A 3SDZA 2DZCA 3BY7A 5CK9A 2RJCA 1QVGA 3A8HB 4VUBA 4Y28E 4M7DC 1IREB 4V2SA 4BACA 4X34A 5A0DA 2DZ9A 1RL2A 3CPWS 4C92C 3RKXA 3OS2A 3CD6A 2K4YA 2L5QA 3C94A 3CCLT 2PUOB 4XTXA 2WSEE 5CCAA 4PJOC 2RK2A 4OMFB 4A4KA 4EMHA 4MDWA 4E7HA 4DOWA 3JB9F 5CKEA 3N5BB 1YJNT 2M1HA 2HQEA 3PMIA 4X9DA 2LCLA 1JB0E 3UWNA 5CR2A 5GAOn 3LWIA 1W2BS 1VQLA 2R5AA 2CZ1B 3OSSC 2EJFA 1XTDA 1PSEA 2Y90A 4IUPA 4KBMB 2XI9A 3EAEA 4XQ3A 3J80E 5LJ3f 4C8QG 1KHCA 1Q81C 2RM4A 2P0PA 3GOXA 3VV0A 3OW2S 1U1SA 2AHJB 4M78D 2QEXT 2JTMA 4L6V5 4MZPA 4QQDA 2P0QA 1H3ZA 1SSFA 3CCVT 2LQKA 2RD1A 3OS0A 3MO8A 1Y96A 2DIGA 4J6YA 4XTVA 2DD5A 4BI3A 1VIEA 1VIFA 1BI1A 2BKDN 2O01E 4M78B 2PVDB 4PLLA 5J26A 2LQ8A 4BDYA 3C4SA 1U8RA 2RB6A 1UGRB 3JCMe 1VQ6A 1WJRA 3CC7A 2L8DA 2GFAA 2FVUA 2RJEA 3LGFA 1KC8U 3ZBDA 4QVCA 3CCQT 3I56T 5FLXE 1YJ9T 3QG1A 1I81A 5J39A 3CCVA 2K2VA 2FYKA 3QIIA 4IUVA 4M75F 3PFSA 4M75A 4BY6B 1G3WA 2JUFA 4JLGA 3QUIA 3OMGA 1BYMA 1FXXA 5GMKe 1YJWA 3FIFA 1KQSA 2VUBA 3MEAA 3QXEB 5GAN5 2E70A 2BIVA 3LX7A 1VQ4T 4C0FA 5CKDA 2OTJT 2JTFA 2WSFE 5GAN8 2VXFA 2EQMA 3SD4A 4BE2A 3FRNA 3NTIA 2EWNA 3EFSA 3JCMh 1LJOA 2IVWA 3M58A 5LJ5d 5LL6S 2YLBA 2DVEA 5L8RE 3X28B 2EJGA 2G3RA 2RI5A 4J5YA 5GAMe 3PIPA 4JLIA 4IUTA 3L2UA 3G4ST 2LDMA 3CMAA 3M9QA 1B34B 3PIOA 3CCST 4M78A 4M78F 2XHCA 1Y07A 3L2VA 3JCMf 3VKIA 2YLCA 4FSXA 3CBMA 5GAMj 2LNVA 3VU3C 2QQAA 3E9GA 4J6WA 2EQKA 3RKYA 5HKCA 3FLGA 3G7ZA 3GLXA 1VQ9A 4BI4A 4CI0C 1KQ2A 2K5IA 4M77A 4M77F 4OB3B 4D6WA 3MEWA 3L2QA 3H8ZA 3CXCS 1VQOA 3AHUA 1K9MC 4FT4A 1VQKT 4NOYA 5GANd 2K57A 5GAMh 3G6EA 1U1TA 4QVDA 3JCMc 3CC2A 1QP2A 2R5MA 3C12A 4QQ6A 4RCBA 2RI2A 5D6WA 3JB9J 2JNGA 1WPYA 3OMCA 4M7DD 3CPWA 2ZPBB 4C92G 1Q82U 3RMQA 4HA8A 4M7AG 2E10A 4C92E 4F7UA 1MGQA 4F7UF 5LJ5g 3HHTB 4M7AE 2RA2A 5GAMf 1N6AA 5A0LA 1NPPA 5LJ3d 1I4K1 5M9OA 4PJOG 3URGA 2O4XA 4M7DB 1B34A 4XTWA 1BKBA 2JVVA 3FEOA 5HK0A 3RESA 4RMOA 4N0AA 1VQ8A 2F5TX 2KK4A 1VQ5A 2YRVA 3I55A 4GY5A 4IUQA 1W2BA 1D3BB 1JRIA 2RHUA 2LVMA 2X4XA 3OS5A 2VV5A 1MHNA 3A8LB 1NE8A 2DXBA 5GAN7 3HSBA 2LC4A 1X6OA 1WQWA 3O8VA 4A4FA 2K5LA 5DLOA 4IUUA 4JS4A 1KD1U 3OW2A 2D9TA 2GCXA 3A5ZB 3QJ6A 4E7LA 4FL6A 1UB4A 3BDLA 3S3NA 1WQ7A 1GXIE 3E1SA 4JUVA 2ZPGB 3V8JA 4KT0E 5GANg 4XU0A 2HNIA 2PVOB 4IURA 3OYDA 3C95A 2RH2A 3J81E 1VQ6T 3CBOA 4HT8A 2XKOC 3CC7T 1ZQ1A 3FB9A 3M54A 4M7AC 3OYKA 2GF7A 4NL2A 1M8VA 4RCCA 2XDDA 3GF5A 1VQNA 1M1KC 2QXFA 3A8OB 3QYGB 4ELZC 4MDXA 1G3TA 4O6JA 4RKUE 3HRUA 4ATOA 5LJ3g 5FU6B 4MMKA 3V7RA 4JS5A 1VUBA 3KBGA 3L2RA 2EFIA 4PKCC 1NJIC 3JCMP 1YJWT 1N8RC 4C5GA 1KQ1A 2CGHA 1D3BA 4C5HA 1NPRA 2M0OA 2ZZDA 3OSVA 2MWPA 4HCZA 4JRIA 5DLQE 3X26B 1Q7YC 3VUZA 4C8QD 1Q81U 2VYTA 4M75E 5I2SA 3UDCA 1XQHA 1KHIA 2WACA 3OYCA 2RHXA 1QVFA 1JJ2S 2E64A 3F70A 3WXMB 1VQPT 4QVZA 4EMKA 2E5QA 4C8QB 3CMAT 4XK8E 2K3YA 4C0DB 4N4HA 2HD0A 3GP8A 5A2QE 2CZ6B 2MMPA 2VGMA 3M56A 1I5LA 4LDYA 1VQ7A 3RERA 4KULA 4DQ2A 4HKEA 2EYQA 4II1A 1G3YA 3S3OA 1XOVA 4C5IA 2QTXA 4UC4A 3DLMA 2MF2A 4OP0A 2R57A 2ZPEB 4BUGA 4DOVA 1VQ9T 1Q86C 5FRNA 5FU7B 3CMEA 3TU4K 5GAN2 1V29B 4HCCA 2LRQA 2V8IA 3CXCA 1VQOT 5GAN4 4ZGEB 1BIAA 3VYHB 5KE2A 4E7IA 2RI3A 5GANe 1PSFA 3MP1A 2OTLA 3CC4A 3GNGA 4MZTA 2XDPA 2X4YA 2ZPIB 3SFMA 2XIDA 1WJSA 3M55A 4ZTFA 4J7FA 4QQGA 1QVGS 4C0GA 1M90C 3RUXA 4M77G 3CC2T 4M75C 3A8GB 4KUIA 4ZTJA 3OY9A 3QPHA 1Y71A 2KDSA 4M77E 3RIRA 4A4HA 5GMKj 4RG2A 1KG1A 1VQMA 3CCLA 1NZ9A 2RK1A 3CCRA 1YHQA 1VQLT 4C8QA 1TH7A 3MP6A 4XU2A 4LDWA 4C8QF 2E6ZA 4FU6A 3KUFA 4YTLA 4N4IA 4C5EA 5FRMA 3FC3A 4BDZA 2V8KA 3P8DA 1VQ8T 2RHZA 4E47A 4P5NA 3GPLA 1VQ5T 4F7UG 5GMKh 3I55T 1FX7A 4O5VA 4F7UE 1R8OB 3OBYA 3P8BB 5CKHA 4R55A 3OBWA 3JCMW 4LDUA 4M78C 3HRSA 2V8JA 3M53A 3TREA 2L3RA 3CCEA 1K9MU 1BI3A 3SWNB 2P4TA 2DAQA 2K5FA 3HFNA 4OGCA 1OYXA 3OYAA 2RJDA 2WSCE 5D6YA 2JOYA 2D0QB 2CS7A 1M1FA 3META 1UGPB 4M77C 4N4GA 1WNLA 4OF1A 4Z02A 4LD9K 3G71A 2ZPHB 1N27A 5LJ5e 3OYHA 2PU9B 4X9CA 3OYMA 1G5VA 4C92D 3CD6T 2QDYB 4JJNK 4M7AD 2KAFA 4A53A 1I8FA 4QW2A 1K8AU 4HT9A 1VQNT 3S3MA 2KQWA 2HAXA 4E7KA 2EKOA 1S72A 4PJOD 3CCMA 2BUDA 3L2WA 1M9SA 3JB9I 5LJ5j 3OYIA 4C92B 4M7AB 4BD3A 3OYJA 1M1GA 2D6FA 1KQSS 3CCUA 1UGSB 2CZ7B 2ZPFB 1X75C 2EQJA 3P8HA 1RI0A 4NL3A 4ZN1A 4KUDK 3BW1A 4PJOB 2OTJA 2X4JA 5CKBA 3V7CA 4BB7A 3OYEA 3JB9G 5KE3A 3M5AA 2LX9A 2L89A 5GAN6 1G3SA 2EIFA 3QKJA 2DK3A 3OA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IG0 A;  2B8A A;  2RHY A;  2FHD A;  4A4G A;  4C5H A;  4C5G A;  4IUV A;  2M0O A;  3QII A;  3NTH A;  2MWP A;  3PFS A;  4HCZ A;  3CEY A;  3MEU A;  2QQR A;  3OMG A;  3MEV A;  2VYT A;  2WAC A;  3MEA A;  3OYC A;  2RHX A;  2BIV A;  3LX7 A;  3QBY A;  3F70 A;  4Q5W A;  3LLR A;  3OS1 A;  2JTF A;  1WJQ A;  3NTK A;  4QVZ A;  2E5Q A;  2EQM A;  3SD4 A;  5KCO A;  4BE2 A;  3NTI A;  2K3Y A;  4N4H A;  2XK0 A;  4B9X A;  2F5K A;  2QQS A;  1OI1 A;  2R58 A;  2G3R A;  2RI5 A;  3UT1 A;  3L2U A;  4IUT A;  4II1 A;  2LDM A;  3S3O A;  4C5I A;  3M9Q A;  4UC4 A;  3DLM A;  4B9W A;  2R57 A;  2P0K A;  5CIU A;  3OB9 A;  4EDU A;  5FRN A;  3OYG A;  5IAY A;  4IKF A;  2LRQ A;  2MWO A;  5D6X A;  3FDR A;  3Q1J A;  5KE2 A;  4E7I A;  1WGS A;  2RI3 A;  3E9G A;  4E7J A;  2EQK A;  3MP1 A;  3FLG A;  2XDP A;  2X4Y A;  4OVA A;  5KH6 A;  4NS5 A;  1OZ2 A;  4PLI A;  2JZ2 A;  1WJS A;  4A4E A;  4ZTF A;  3L2Q A;  4QQG A;  3MEW A;  3PMT A;  3H8Z A;  2DIQ A;  2LCC A;  3OYA A;  4BE1 A;  3DB3 A;  3ZEH A;  4ZTJ A;  2K3X A;  3OY9 A;  4A4H A;  2M16 A;  3OYL A;  3OYN A;  3LH0 A;  3S6W A;  5IN1 A;  3ME9 A;  4RG2 A;  2R5M A;  4QQ6 A;  3MP6 A;  2RI2 A;  4LD6 A;  2E6N A;  3OMC A;  5D6W A;  4FU6 A;  3KUF A;  2GFU A;  4N4I A;  4C5E A;  5FRM A;  4L59 A;  3FC3 A;  2X4W A;  3H6Z A;  3P8D A;  2RJC A;  2RHZ A;  5M9O A;  5C0M A;  4BAC A;  4X34 A;  2O4X A;  3FEO A;  3OS2 A;  2NLU A;  3L2V A;  3ASK A;  3DB4 A;  5C6S A;  3PNW C;  2L3R A;  2YRV A;  3MP8 A;  4GY5 A;  4IUQ A;  2X4X A;  4BDZ A;  2PQW A;  2LVM A;  2RHU A;  3OQ5 A;  1MHN A;  2DAQ A;  2LTO A;  4E7H A;  1OYX A;  3L42 A;  2M1H A;  2HQE A;  2CKK A;  2RJD A;  3O8V A;  3PMI A;  4IUU A;  3LGL A;  5D6Y A;  3UWN A;  4A4F A;  2D9T A;  3QJ6 A;  3MET A;  4Z02 A;  4N4G A;  5FRO A;  4E7L A;  2R5A A;  4FL6 A;  3BDL A;  4CRI A;  3LYI A;  3S3N A;  1N27 A;  4IUP A;  1XNI A;  3OYH A;  3EAE A;  3OYM A;  1G5V A;  1KHC A;  2RHI A;  3GOX A;  4QW2 A;  3S3M A;  4QQD A;  4IUR A;  3OYD A;  4E7K A;  1SSF A;  2EKO A;  1H3Z A;  3OS0 A;  3MO8 A;  2BUD A;  2DIG A;  3L2W A;  3OYK A;  2GF7 A;  3OYI A;  5KCH A;  4BD3 A;  3OYJ A;  1OZ3 A;  2BKD N;  4BDY A;  4PLL A;  5J26 A;  3C4S A;  4PL6 A;  2EQU A;  4BE0 A;  2EQJ A;  3P8H A;  1RI0 A;  1WJR A;  2HQX A;  3OYF A;  2L8D A;  2GFA A;  2RJE A;  3LGF A;  2RJF A;  2X35 A;  3OYB A;  2O4X B;  3OYE A;  3L2R A;  2EFI A;  5KE3 A;  2RO0 A;  5J39 A;  2L89 A;  3E9F A;  3QKJ A;  3OA6 A; 
#chains in the Genus database with same CATH topology
 2B8A A;  4A4G A;  4JDS A;  3L2Z A;  3HRT A;  2PUK B;  1E6G A;  2K79 A;  1H64 1;  3QO3 A;  1O75 A;  3MEV A;  1YCY A;  2V26 A;  3HTR A;  5CQX A;  3PTA A;  2J6F A;  4OB0 B;  1RLP C;  5IXF A;  2FL7 A;  3NTK A;  5GMK l;  3PT9 A;  1JBM A;  1H9F A;  5HK3 A;  4JJB A;  3CME T;  2KY9 A;  1A63 A;  3UT1 A;  3RMS A;  1OUL A;  2COZ A;  3OB9 A;  4FYX B;  5D6X A;  2BTT A;  4E7J A;  4M75 D;  4J9G A;  1VQM T;  2DVJ A;  3WVD B;  1YIJ A;  3E2U A;  1LOJ A;  1YIT A;  1JJR A;  1AD5 A;  1AWJ A;  2QQB A;  2QK0 A;  4UZW A;  2QA4 A;  3MJX A;  1JEQ A;  1Q82 R;  4LD6 A;  3EFO B;  2GFU A;  4E2F B;  2MYS A;  2AKK A;  4M78 E;  2LNH B;  1D0Y A;  4OB1 B;  1WXU A;  2X3X D;  4HCB A;  5DY9 A;  2LJ1 A;  3QDR B;  4TVR A;  1RAA B;  3G6E T;  3DLL A;  2CP5 A;  4M77 D;  2PQW A;  5I21 A;  3G71 T;  4XU1 A;  3A98 A;  3QYH B;  2HDA A;  1KD1 R;  5FW9 A;  2CKK A;  3LGL A;  2O31 A;  3JB9 H;  4AG1 C;  4CRI A;  3LYI A;  2DXT A;  5D7U A;  3UPU A;  5EG2 A;  2DIL A;  3MHX A;  2K7A A;  2O88 A;  5GAO l;  5KYX B;  4C8Q C;  2AT1 B;  4ZGJ B;  1X2K A;  2P4R A;  3LWH A;  2DTH A;  1QVF S;  4PL6 A;  4F7U B;  2F69 A;  2HQX A;  3OYF A;  1VQP A;  2RJF A;  4FIB A;  3G4S Q;  5CO7 A;  2DXU A;  3HPW A;  2HQH A;  5GAM g;  1UTI A;  2IG0 A;  3EG1 A;  3V7S A;  2FO0 A;  1YJ9 A;  4WCI A;  4IIO A;  2I2L A;  1WZO A;  2AZS A;  2JJ9 A;  3EG9 A;  3KFV A;  2KEA A;  3PGG A;  3TQ7 P;  3QHS A;  1EIF A;  1YBY A;  3CQT A;  1BI2 A;  3LW5 E;  1IZ6 A;  2COW A;  3JCM Q;  3R6O A;  5CIU A;  4EDU A;  2MAM A;  1K8A C;  2HBP A;  5IAY A;  3GIB A;  3QWY A;  2KMT A;  2LT1 A;  1YIJ T;  1YIT T;  3M4G A;  3CCS A;  2KFV A;  5GAN 3;  2QI2 A;  3FJ5 A;  5IHN A;  4BE1 A;  2BE9 B;  2QA4 T;  2FPE A;  1M4Z A;  4KH0 B;  1M1K U;  3HKS A;  2QGF B;  1QWE A;  1D1A A;  3BFM A;  5CKF A;  5FWC A;  2GTO A;  4M7A A;  4M7A F;  1Y96 B;  1K0X A;  2XU8 A;  3FJP A;  1K76 A;  4L59 A;  2C0O A;  3BY7 A;  2RN8 A;  1YNZ A;  4C92 C;  5KYW A;  4E6R A;  3OS2 A;  3CD6 A;  2K4Y A;  2L5Q A;  1K9M R;  3VS0 A;  4PJO C;  1MMD A;  2EYX A;  1QKW A;  2RK2 A;  4OMF B;  4MDW A;  1T0H A;  2DNU A;  2MIO A;  2RMO A;  3UWN A;  5GAO n;  3LWI A;  1W2B S;  4KBM B;  3I5R A;  2XI9 A;  4XQ3 A;  2I0N A;  3EGU A;  3OW2 S;  3C0C A;  4M78 D;  4MZP A;  2QEX Q;  1H3Z A;  2RD1 A;  3D7S B;  1BI1 A;  4BDY A;  1SRM A;  1U5S A;  2RJE A;  2FVU A;  4QVC A;  4ZNX A;  3CCQ Q;  5FLX E;  1ZLM A;  1YJ9 T;  1I81 A;  1TUD A;  2BE7 D;  2K2V A;  4BY6 B;  2KRM A;  3PFS A;  1BYM A;  2J7I A;  5GMK e;  3G1J A;  2VUB A;  2CH4 A;  4C0F A;  1VQ4 Q;  4A63 B;  2VXF A;  2O9V A;  2EQM A;  1GBQ A;  2DVE A;  3X28 B;  2G3R A;  2RI5 A;  5GAM e;  4IUT A;  2LDM A;  2DL8 A;  3M9Q A;  3CCS T;  1N5Z A;  4M78 A;  4M78 F;  2HBW A;  1QQJ A;  1Y07 A;  3JCM f;  5GJV B;  2L3P A;  4FSX A;  1VQ5 Q;  1H1J S;  1VQ9 A;  2DBK A;  1KQ2 A;  2VAS A;  1R77 A;  1H9E A;  1VQO A;  1QCO A;  3A1P A;  1E6H A;  2AKL A;  1MMA A;  2KYB A;  1PWT A;  2YUN A;  2QG9 B;  2EYY A;  1NBE B;  1QWF A;  2ED0 A;  2RI2 A;  4FYY B;  3RNJ A;  3CPW A;  4M7A G;  1GJJ A;  2CP7 A;  4C92 E;  1MGQ A;  5M9O A;  1NPP A;  3URG A;  1U06 A;  1W1F A;  1OPK A;  3RES A;  4GBQ A;  3I55 A;  1CKB A;  3HSB A;  2DXB A;  5GAN 7;  1X6O A;  4A4F A;  4IUU A;  4ORZ A;  3SEM A;  1MND A;  4FL6 A;  1UB4 A;  1MNE A;  3NMZ C;  1GXI E;  1TTH B;  4XU0 A;  5ECA A;  2JM9 A;  1MMG A;  2BZ8 A;  3OYK A;  1M8V A;  4RCC A;  2FEI A;  1OU8 A;  2QXF A;  4ELZ C;  4MDX A;  1G3T A;  5LJ3 g;  5FU6 B;  4HCK A;  4MMK A;  1YN8 A;  2EGA A;  1D3B A;  2EYZ A;  2ZZD A;  1M2V A;  1AOJ A;  3VUZ A;  4C8Q D;  2A36 A;  2MPH A;  1KHI A;  1QVF A;  3CCR Q;  1PHT A;  1PRM C;  2K3Y A;  2M51 A;  3PE0 A;  4N4H A;  3GP8 A;  2MMP A;  1IGQ A;  1I5L A;  2YRC A;  2A8V A;  1EFN A;  3S3O A;  1UEC A;  3DLM A;  1VQ9 T;  2R57 A;  1Q86 C;  1ZUU A;  2EPD A;  1PG5 B;  2JM8 A;  2LRQ A;  1VQO T;  3CXC A;  5KE2 A;  4E7I A;  1PSF A;  3CC4 A;  4MZT A;  2XDP A;  2X4Y A;  1OX8 A;  2J6O A;  4M75 C;  3QPH A;  1Y71 A;  1ZSZ C;  2HKQ B;  3RIR A;  4A4H A;  2FZK B;  1TS9 A;  1M1K R;  2NUP B;  2B86 A;  2A0F B;  4C8Q A;  4C8Q F;  1KQS P;  4LDW A;  1S72 Q;  4YTL A;  5FRM A;  3UF4 A;  3NHN A;  2V8K A;  3P8D A;  2RHZ A;  3GPL A;  3I55 T;  4JZ4 A;  1BU1 A;  2EKH A;  1Y02 A;  1R8O B;  2ZAE A;  2FZC B;  3P8B B;  4J9D A;  3JCM W;  1TXQ A;  4DBH A;  3TRE A;  2L3R A;  4LN2 A;  1BI3 A;  3SWN B;  1S1N A;  3HFN A;  2NWM A;  4OGC A;  2RJD A;  2QNF A;  2CS7 A;  2EQI A;  4M77 C;  4N4G A;  2ZPH B;  1N27 A;  4FCY A;  3PVQ A;  4X9C A;  4C92 D;  3VRZ A;  2KAF A;  1I8F A;  1SG5 A;  4QW2 A;  2KQW A;  4PJO D;  4D8K A;  4M7A B;  4BD3 A;  1M1G A;  2D6F A;  2KE9 A;  2MPX C;  3P8H A;  3BW1 A;  2LMJ A;  5KE3 A;  2L89 A;  2KNB B;  1BKB A;  3QKJ A;  2DK3 A;  3RKX A;  2G6F X;  4C0Z A;  3ZFJ A;  3KXT A;  2DO3 A;  3CCJ Q;  1UGQ B;  3QBY A;  4ZGD B;  3OS1 A;  4OML A;  5LJ5 f;  4M4Z A;  2C06 A;  3OW2 P;  2JS2 A;  5IXB A;  2RF0 A;  1FMV A;  5LJ3 e;  2R58 A;  4KGV B;  3V8L A;  1I5O B;  3GNF B;  1GFD A;  1ZBJ A;  3L1A A;  3SB2 A;  4C92 A;  3J7A F;  1WHK A;  3CC4 T;  2FB7 A;  4PJO A;  4PJO F;  3NFC A;  1YI2 A;  3Q1J A;  2KRS A;  4A4E A;  2YUO A;  2OI3 A;  4B6M A;  5GAN f;  4DEY A;  1YHQ Q;  2O9S A;  1HXD A;  1P92 A;  3M0R A;  1RAI B;  2DFU A;  3ME9 A;  2ROL A;  3U23 A;  2J06 A;  1X43 A;  4EMK C;  1JXM A;  1PRL C;  2CZ0 B;  1Q86 U;  2GQV A;  3H6Z A;  3ER0 A;  1HK9 A;  4XAX B;  3CCV Q;  3E19 A;  1UJY A;  4R56 A;  2XD0 A;  3V8K A;  2KT1 A;  3MP8 A;  3OQ5 A;  1UG1 A;  3JSC A;  2A3L A;  3L42 A;  2VXE A;  3JCM g;  1E7O A;  1XNI A;  4PJN A;  5GAO r;  1M8M A;  1YJN A;  2IIM A;  3DKM A;  3EHQ A;  1BK2 A;  1NYF A;  2ECZ A;  2OTJ Q;  1NYG A;  2VVK A;  1PKS A;  4C0D C;  1JXO A;  3X25 B;  1HJD A;  1OZ3 A;  2QEX A;  4FYV B;  4BE0 A;  3OYY A;  2EQU A;  2JW4 A;  3M59 A;  2RQV A;  5CQY A;  2XDB A;  2X35 A;  2RO0 A;  4FW2 A;  5I2M A;  3JV3 A;  3MCA B;  3JCM V;  5HCK A;  3CEY A;  3MEU A;  3CCQ A;  2M0Y A;  3I56 A;  2CRE A;  2P84 A;  3QSU A;  4JRK A;  2EVR A;  3HFO A;  2QQ9 A;  4AMC A;  2XK0 A;  2O2O A;  4RTT A;  3REA B;  1VQ4 A;  1YI2 T;  5CAI A;  1UDL A;  4M7D E;  2P0K A;  3JB9 D;  2KI7 A;  5AYF A;  4E7Z A;  2KR3 A;  1YP5 A;  4PLI A;  1OX9 A;  2DIQ A;  3DB3 A;  1M2V B;  6AT1 B;  4J6X A;  4JJD A;  3INZ A;  3QWX X;  1QVP A;  4FYW B;  2L0A A;  2DYB A;  1W4S A;  2ZGW A;  4WF2 A;  2Y4X A;  3H0H A;  1NJI U;  1N9R A;  4D8D A;  4J83 A;  2DZC A;  2RJC A;  3A8H B;  4Y28 E;  4V2S A;  4ANJ A;  4X34 A;  2DZ9 A;  3CPW S;  1E7L A;  2DMO A;  2K3B A;  3CCL T;  1MV3 A;  4PFZ A;  2G80 A;  1D1B A;  2FPD A;  2GGR A;  4EMH A;  2JT4 A;  4E7H A;  4DOW A;  3JB9 F;  1YJN T;  2HQE A;  1ZA2 B;  4RUG A;  4X9D A;  1JB0 E;  3H0I A;  5CR2 A;  2KW9 A;  1VQL A;  2R5A A;  1PSE A;  1M30 A;  1WLP B;  1UHC A;  4IUP A;  2Y90 A;  1AZE A;  1TUC A;  3J80 E;  2QYZ A;  5LJ3 f;  1KHC A;  2WQG A;  1Q81 C;  1U1S A;  2QEX T;  2ODG C;  4Z8A A;  2P0Q A;  3OS0 A;  3MO8 A;  2DIG A;  4XTV A;  3CMA Q;  2C0T A;  2O01 E;  1VQ6 A;  1M2O A;  1UGR B;  3JCM e;  3M0S A;  2L8D A;  3LGF A;  3CCQ T;  3I56 T;  2J05 A;  1IGU A;  4M75 A;  4M75 F;  1VYT A;  1ZSZ A;  4JLG A;  3OMG A;  4LXC A;  1FXX A;  3FIF A;  5GAN 5;  3I5S A;  2BIV A;  4PK4 A;  1UE9 A;  3LX7 A;  1VQ4 T;  5CKD A;  3M0U A;  3THK A;  3SD4 A;  3FRN A;  2LP5 A;  4LUD A;  1LJO A;  1V1C A;  1BCO A;  2EJG A;  2DRK A;  1UHF A;  3L2U A;  1B34 B;  3PIO A;  1UUE A;  2KRN A;  2LQN A;  2OAW A;  1B07 A;  3VKI A;  5GAM j;  1VQ8 Q;  1VYU A;  1SPK A;  2QQA A;  3EG2 A;  4BI4 A;  4FW1 A;  3LH5 A;  4AT1 B;  4M77 A;  4M77 F;  3CXC S;  3H8Z A;  3AHU A;  4FT4 A;  3VRY A;  4NOY A;  1VQK Q;  5GAM h;  3JCM c;  3CC2 A;  2R5M A;  4QT7 A;  4RCB A;  4M7D D;  1Q86 R;  2DM1 A;  3RMQ A;  4HA8 A;  1RAH B;  5LJ5 g;  2RA2 A;  5A0L A;  4XTW A;  2JMA A;  1VQL T;  3GBQ A;  3SHW A;  2X4X A;  1JRI A;  3OS5 A;  2VV5 A;  1TSF A;  3M0T A;  3O8V A;  5DLO A;  7AT1 B;  4E7L A;  1VYV A;  4JJC A;  1MV0 B;  4HVU A;  1BB9 A;  1WQ7 A;  4PJL A;  1LVK A;  2HEQ A;  2QAS A;  1G8X A;  2DL4 A;  5GAN g;  2HNI A;  1EZZ B;  4IUR A;  1X2Q A;  1VQ6 T;  1X27 A;  4HT8 A;  2XKO C;  3CC7 Q;  2XDD A;  1VQN A;  3QYG B;  1J3T A;  1GL5 A;  1JEG A;  3CME Q;  4O6J A;  1ACM B;  2HSE B;  3HRU A;  5I22 A;  4ATO A;  2DEU A;  1A62 A;  1VUB A;  1M3B A;  1YJW Q;  1KIK A;  2M0O A;  3X26 B;  2MWP A;  1Q7Y C;  1NG2 A;  1Q81 U;  2F2X A;  5I2S A;  3UDC A;  1XQH A;  3VS2 A;  3OYC A;  2RHX A;  3WXM B;  1VQM Q;  1VQP T;  4QVZ A;  3EGD A;  4EMK A;  2AIR B;  1H8K A;  2DF6 A;  2CZ6 B;  5A2Q E;  2VGM A;  4HKE A;  1TOV A;  2EYQ A;  1EX4 A;  4J9F A;  4OP0 A;  5FRN A;  1FYN A;  5FU7 B;  2VWF A;  2QDL A;  4HCC A;  5GAN 4;  4ZGE B;  1WI7 A;  1RAE B;  2OTL A;  3MP1 A;  3GNG A;  2ZPI B;  3SFM A;  2XID A;  3EHR A;  4J7F A;  4QQG A;  1QVG S;  1X6G A;  3G6E Q;  2W51 A;  4M77 G;  3CC2 T;  1PC0 A;  4KRT A;  4LUE A;  3OY9 A;  2KDS A;  3G71 Q;  2MCN A;  1K1Z A;  1ARK A;  4RG2 A;  1KG1 A;  2NUT B;  1NZ9 A;  1YHQ A;  2E4H A;  1TH7 A;  3MP6 A;  4XU2 A;  1NJI R;  4FU6 A;  4C5E A;  1Y57 A;  2JS0 A;  4P5N A;  4KGZ B;  4RTZ A;  1FX7 A;  4O5V A;  4F16 A;  4F7U E;  3MPU B;  1ZUK A;  3HRS A;  3TSW A;  2V8J A;  3CCE A;  2LX7 A;  2KVE A;  1ZBH A;  3MKD A;  4Y92 A;  2DLP A;  1M1F A;  4OF1 A;  4Z02 A;  3VS7 A;  4LD9 K;  5LJ5 e;  1G5V A;  3CD6 T;  4AFS C;  1K8A U;  4HT9 A;  3IQL A;  1VQN T;  3S3M A;  1KK7 A;  2HAX A;  3CCM A;  4JZ3 A;  3OYI A;  1W70 A;  1ZUY A;  2ZPF B;  3CPW P;  2EQJ A;  2OTJ A;  4KUD K;  4OMQ A;  2KVU A;  2IPO B;  3OYE A;  2BZY A;  3M5A A;  2LX9 A;  2K9G A;  2EIF A;  3OA6 A;  1ZBX A;  2SEM A;  2FHD A;  4J9I A;  4MZM A;  5GAN e;  5HKC A;  1JJ2 A;  4L5G A;  2EAY A;  1YIJ Q;  2VB6 A;  1YIT Q;  1SHF A;  3CBP A;  2X3W D;  1W6X A;  3WVE B;  8ATC B;  1VQ7 Q;  1WJQ A;  2ABL A;  2D8H A;  5KCO A;  2ESW A;  4B9X A;  1T3S A;  4LDX A;  5L23 A;  2VC8 A;  2DD4 A;  2OTL T;  4OB2 B;  5KYU A;  2DE0 X;  5LJ3 j;  3OYG A;  3BDU A;  1Q7Y U;  3FDR A;  1WGS A;  1X69 A;  2L2P A;  4OVA A;  5KH6 A;  4DBF A;  2JZ2 A;  3T9N A;  1YHQ T;  4BI8 B;  2KT8 A;  5LJ3 h;  3EFR A;  4M75 B;  1ZSZ B;  2OX7 A;  3EH2 A;  2PTK A;  3LH0 A;  2JVW A;  2E6N A;  1SF9 A;  1QVF P;  2CYZ B;  4J9E A;  4GLK A;  3HP9 A;  2GBQ A;  4M78 G;  4OMN A;  5CVI A;  5HY6 A;  2OAU A;  4OMO A;  3CCE T;  3L2V A;  5GAM d;  3ASK A;  1QP3 A;  1X01 A;  2F2V A;  3DB4 A;  4ZN3 A;  5C6S A;  2A7Y A;  4BDZ A;  1N9S A;  4XTZ A;  5FU6 C;  1KC8 C;  2DA9 A;  4HXJ A;  1YJ9 Q;  4M77 B;  3EG9 B;  2XG8 D;  3CCM T;  2H8H A;  2Y4Y A;  3QZ5 B;  2RHI A;  1WXB A;  2XIC A;  3CCU Q;  2DTO A;  5IT9 E;  3X20 B;  1FMW A;  2MOX A;  4PNO A;  3M4Y A;  3TEE A;  3NPF A;  1D09 B;  3OYB A;  2ROT A;  3CCS Q;  1RUW A;  1U3O A;  2D8J A;  2EJ9 A;  3E9F A;  4IIM A;  2RHY A;  3PVL A;  2E3I A;  2COY A;  2VGN A;  1Q81 R;  5KYN A;  2QQR A;  2YWW A;  1R0B G;  4DBR A;  1MMN A;  4EMG A;  4Q5W A;  3LLR A;  3JCM J;  2GQI A;  2D0N A;  1IRX A;  4F14 A;  1IHV A;  1OI1 A;  2QQS A;  1RAG B;  4R0K A;  3EGX A;  1JQQ A;  5KYX A;  1ZHI A;  2OJ2 A;  2HZY A;  3RKW A;  1A0N B;  5KYW B;  4B9W A;  2YDL A;  5IH2 A;  1YFN A;  2DJQ A;  5DM7 R;  1WHJ A;  3UA7 A;  4IKF A;  1MUZ A;  3G4S A;  2DRM A;  1W2B P;  4JPB W;  3TSZ A;  1H92 A;  2FRW A;  5J3B A;  1WIE A;  1UFF A;  4XU3 A;  3SWN C;  2K3X A;  1BIB A;  4QKU A;  1FWZ A;  4ESR A;  3OYN A;  4OGE A;  1K9A A;  2MI6 A;  1YWP A;  2RPN A;  2CSQ A;  4C92 F;  1VQK A;  2KGT A;  3EGD B;  4EMK B;  2E65 A;  2AK5 A;  3SDZ A;  1WYX A;  5CK9 A;  1QVG A;  1JU5 C;  3NGP A;  4VUB A;  4M7D C;  1UJ0 A;  2K6D A;  3C94 A;  4XTX A;  4A4K A;  2M1H A;  3PMI A;  1AVZ C;  3OSS C;  2QAZ A;  1JO8 A;  3EAE A;  4C8Q G;  1K8A R;  3VV0 A;  2JTM A;  4L6V 5;  4QQD A;  1SSF A;  2HSP A;  2LQK A;  2MK5 A;  1Y96 A;  2DD5 A;  1QCN A;  4HVW A;  4M78 B;  2PVD B;  4PLL A;  2LQ8 A;  3C4S A;  1JEI A;  1GFC A;  2RB6 A;  1U8R A;  1WJR A;  3CC7 A;  2GFA A;  2KYM A;  1KC8 U;  3ZBD A;  1ZS9 A;  1CSK A;  3ZL7 C;  5EC7 A;  1YNS A;  1RAD B;  2FYK A;  3QII A;  1VQO Q;  2JUF A;  1I07 A;  3QUI A;  2YUQ A;  1G83 A;  1YJW A;  3UAT A;  1T0J A;  2VKN A;  2V1R A;  4BE2 A;  3NTI A;  5AT1 B;  3JCM h;  5LL6 S;  2LQW A;  1NM7 A;  3PIP A;  1D0X A;  4JLI A;  3G4S T;  2CT4 A;  1WXT A;  2XHC A;  4AG2 C;  1Q7Y R;  2YLC A;  3CBM A;  2LNV A;  3VU3 C;  3I55 Q;  3VS6 A;  2EQK A;  3G7Z A;  2K5I A;  4D6W A;  3L2Q A;  1SKU B;  1ABO A;  3ULR B;  1VQK T;  1QKX A;  3G6E A;  1U1T A;  4QVD A;  5IHI A;  1QP2 A;  2J6K A;  3C12 A;  4KGX B;  3JB9 J;  2JNG A;  1WPY A;  3OMC A;  4C92 G;  2E10 A;  1GBR A;  2EYW A;  4F17 A;  4M7A E;  1I0C A;  1N6A A;  5LJ3 d;  1I4K 1;  4PJO G;  2O4X A;  2RNA A;  2JVV A;  3FEO A;  5HK0 A;  1R0C B;  2KK4 A;  1VQ5 A;  2YRV A;  1D3B B;  2RQW A;  1MHN A;  4J9H A;  1WQW A;  2K5L A;  4JS4 A;  2D9T A;  3QJ6 A;  3BDL A;  3V8J A;  2ZPG B;  1WHH A;  1OPL A;  4Z88 A;  2E3H A;  2FG0 A;  3J81 E;  3OYD A;  3CBO A;  4CC2 A;  3CC7 T;  3M54 A;  2GF7 A;  1Z9Q A;  4NL2 A;  2CSI A;  2ATC B;  1M1K C;  1ZSG A;  1B3Q A;  1T3L A;  2Z0W A;  1NLP C;  3V7R A;  4JS5 A;  3KBG A;  1LCK A;  2EFI A;  3CC4 Q;  1YJW T;  4KH1 B;  1N8R C;  1KQ1 A;  4C5H A;  5DLQ E;  4RTY A;  2WAC A;  1OOT A;  1JJ2 S;  2E64 A;  1KFZ A;  2PNI A;  4C8Q B;  2F2W A;  2ENM A;  2YT6 A;  2HD0 A;  3M56 A;  1VQ7 A;  2EGC A;  4DQ2 A;  2QTV A;  1XOV A;  4C5I A;  2QTX A;  2ZPE B;  1GL9 B;  2DL3 A;  4DOV A;  1M27 C;  1TUG B;  3M0Q A;  5GAN 2;  1V29 B;  4DEX A;  2V8I A;  4OMM A;  1GKU B;  1BIA A;  2RI3 A;  2CDT A;  4ZTF A;  1M90 C;  4KUI A;  4E7S A;  4ZTJ A;  2DL7 A;  2DBM A;  5GMK j;  3CCR A;  2YSQ A;  1E7D A;  1K4U S;  2V1Q A;  1C1A A;  3QDF A;  1VQ5 T;  1PKT A;  5GMK h;  3UA6 A;  3EGX B;  3RDV A;  5CKH A;  4R55 A;  4LDU A;  1RLQ C;  1OYX A;  1M3C A;  3OYA A;  2RQR A;  2WSC E;  5D6Y A;  2JOY A;  1WNL A;  5I11 A;  3I35 A;  2PU9 B;  2YXY A;  1UGV A;  2NUP A;  4JJN K;  4M7A D;  4A53 A;  2W10 A;  2NYS A;  4EIK A;  2EKO A;  1S72 A;  4X1V A;  2BUD A;  2D1X A;  3L2W A;  3JB9 I;  5LJ5 j;  4C92 B;  1KQS S;  3CCU A;  1UGS B;  4Z89 A;  2CZ7 B;  1KC8 R;  1X75 C;  4NL3 A;  4PJO B;  4ZN1 A;  2X4J A;  5CKB A;  1WFW A;  1ABQ A;  3V7C A;  4BB7 A;  1PM3 A;  1YI2 Q;  3JB9 G;  2HCK A;  4N0A C;  5LJ5 h;  4FM4 B;  2EW3 A;  2QNC A;  3SWN A;  2X51 A;  3VJP A;  4PFP A;  1G2B A;  2E1H A;  1LNX A;  3VUB A;  4RTX A;  1VQ7 T;  5GAN j;  1I1J A;  2CH4 W;  4Y91 A;  2KRO A;  4LE9 A;  3TCJ A;  1PNJ A;  3JCM b;  2ODC I;  4M7D A;  4RG8 A;  4M7D F;  3TVT A;  2DEQ A;  3QZ9 B;  1HSQ A;  4GLM A;  5KYY A;  1K73 C;  2FPF A;  1B7T A;  5GAN h;  2CP0 A;  1N8R U;  4FSS A;  2X9H A;  4M75 G;  3JCM d;  2RQT A;  3VS3 A;  1PD0 A;  1AT1 B;  2LCC A;  3CCL Q;  3CCR T;  3CCJ A;  4XTY A;  2CUD A;  3OYL A;  2L3Q A;  3S6W A;  1YJN Q;  5FWB A;  2ZCF B;  1V76 A;  4EPC A;  1RAC B;  2DPP B;  3JAM E;  4C8Q E;  2QGG A;  5GMK m;  2DJZ A;  5C0M A;  2KXD A;  2H3J A;  2NLU A;  3JCM X;  1D0Z A;  3PNW C;  4PJM A;  3M57 A;  2DKG A;  1M90 U;  2JTE A;  3CPF A;  2LTO A;  5GAO p;  3I56 Q;  2KSS A;  1QW1 A;  5FRO A;  1RAB B;  2HL5 C;  1S72 T;  1Y7X A;  5GMK i;  2RNN A;  2KVQ G;  2GNC A;  3CCU T;  4ME7 A;  3X24 B;  2DX1 A;  4PJJ A;  1IO6 A;  1YWO A;  5KCH A;  2NUZ A;  4A54 A;  4FT2 A;  4J7I A;  2M9U A;  4XTU A;  2KBT A;  4LNP A;  3CCV A;  4ELY C;  2DTI A;  5A0G A;  2DYI A;  2W0Z A;  2DER A;  3RR6 A;  2O4X B;  4J9C A;  2LT4 A;  5FU7 C;  4CC7 A;  4JRP A;  1O9S A;  4BY6 C;  2CUB A;  3NTH A;  4AFQ C;  1BI0 A;  4MML A;  1TWB A;  1IHW A;  1QCF A;  4J9B A;  2F5K A;  3VS5 A;  4J8O A;  1WX6 A;  2PZ1 A;  2YUP A;  1GCQ C;  4CC4 B;  4DA4 A;  4M7D G;  2LZ6 B;  2DK4 A;  2EGE A;  2E12 A;  4OMP A;  1Q82 C;  2A28 A;  2YRD A;  1OV3 A;  3A8M B;  2FRY A;  5GAO m;  1AHJ B;  2CP2 A;  2KXC A;  2DXC A;  3JRZ A;  2MWO A;  3CCJ T;  1NEG A;  1F1B B;  4LDV A;  4PJO E;  1DJ7 B;  3H9N A;  1UEB A;  1OZ2 A;  4NS5 A;  1GRI A;  5GAO q;  4RTU A;  2E41 A;  3PMT A;  3ZEH A;  2QA4 Q;  1VQL Q;  2YHT A;  1BCM A;  3HL8 A;  2M16 A;  1M5Q 1;  2JN0 A;  1JJ2 P;  5IN1 A;  1KD1 C;  3VYG A;  3QJY A;  1PD1 A;  2PVG B;  4JRQ A;  2HKN A;  1K73 U;  4CC3 A;  3M0P A;  1AWW A;  2EBP A;  2X4W A;  1IRE B;  4BAC A;  1VQ6 Q;  5A0D A;  1RL2 A;  2HMA A;  2SRC A;  4RTV A;  4AFU C;  1WA7 A;  1SEM A;  2PUO B;  2LC3 A;  2WSE E;  5CCA A;  5CKE A;  3N5B B;  2LCL A;  4RTW A;  2CZ1 B;  2EJF A;  1XTD A;  2HJQ A;  1RI9 A;  2JXB A;  2RM4 A;  2P0P A;  3GOX A;  2AHJ B;  1OU9 A;  1SRL A;  3CCV T;  4J6Y A;  1VQP Q;  4BI3 A;  1VIE A;  9ATC B;  1VIF A;  2BKD N;  1IB8 A;  5J26 A;  1V66 A;  2LJ0 A;  2DL5 A;  2FZG B;  1WDX A;  2LD7 A;  3CXC P;  2E5K A;  3QG1 A;  2BZX A;  1WHG A;  5J39 A;  4IUV A;  1BBZ A;  1G3W A;  1Y0M A;  3EG3 A;  3I9Q A;  1KQS A;  3MEA A;  3QXE B;  2E70 A;  2OTJ T;  2JTF A;  2WSF E;  5GAN 8;  3EFO A;  3CC2 Q;  1AEY A;  2EWN A;  1PCX A;  3EFS A;  2IVW A;  3M58 A;  5LJ5 d;  2YLB A;  1NEB A;  5L8R E;  4J5Y A;  5GJW B;  1AWX A;  3CMA A;  2L3S A;  2XMF A;  1N8R R;  1VOM A;  2CP3 A;  2AZV A;  2M02 A;  3E9G A;  4J6W A;  3RKY A;  1IXD A;  3FLG A;  3GLX A;  4CI0 C;  2A08 A;  4OB3 B;  3MEW A;  4DBQ A;  3REB B;  1K9M C;  1SSH A;  5GAN d;  5IHK A;  1TG0 A;  4QQ6 A;  5D6W A;  1ZX6 A;  2ZPB B;  1Q82 U;  3CD6 Q;  4F7U A;  4F7U F;  3HHT B;  5GAM f;  1VQN Q;  1TU0 B;  4M7D B;  1B34 A;  3H41 A;  2HL3 A;  4AFZ C;  5KYY B;  2LCS A;  4RMO A;  4N0A A;  1M90 R;  1VQ8 A;  2F5T X;  4HVV A;  1W2B A;  1C0M A;  4GY5 A;  1M3A A;  4IUQ A;  2RHU A;  2LVM A;  3A8L B;  4F04 B;  1NE8 A;  2LC4 A;  1HYO A;  2GTJ A;  1KD1 U;  3OW2 A;  2RNO A;  3A5Z B;  2GCX A;  3S3N A;  1SHG A;  3E1S A;  4JUV A;  4KT0 E;  2LJ3 A;  2PVO B;  3C95 A;  2RH2 A;  1KJW A;  2F1L A;  1OEB A;  1ZQ1 A;  3FB9 A;  4M7A C;  2JMC A;  3GF5 A;  3EH1 A;  3A8O B;  1K0S A;  4K11 A;  1GCP A;  4RKU E;  1RAF B;  3BE3 A;  3H0F A;  3L2R A;  1QVG P;  2A37 A;  4PKC C;  1A8V A;  1NJI C;  1VA7 A;  3JCM P;  2OTL Q;  4C5G A;  2CGH A;  1NPR A;  2C0I A;  3OSV A;  2KVD A;  4HCZ A;  4JRI A;  1LPL A;  1C6V X;  2VYT A;  4M75 E;  3F70 A;  1D1C A;  2K2M A;  2E5Q A;  1NLO C;  3CMA T;  4XK8 E;  4C0D B;  1KSW A;  4LDY A;  3RER A;  1QMC A;  4KUL A;  2ED1 A;  4II1 A;  1G3Y A;  4UC4 A;  3VS1 A;  2MF2 A;  4BUG A;  1VQ9 Q;  1X6B A;  3R6N A;  3CME A;  3TU4 K;  1ZA1 B;  1CKA A;  3VYH B;  3CCE Q;  1QLY A;  2RQU A;  1WJS A;  1WHM A;  3M55 A;  4BIT A;  4C0G A;  3RUX A;  3A8G B;  4M77 E;  1VQM A;  3CCL A;  2RK1 A;  1XJW B;  3VS4 A;  1K73 R;  1FMK A;  2E6Z A;  3KUF A;  4N4I A;  3CCM Q;  3O5Z A;  3FC3 A;  1YCS B;  1VQ8 T;  4E47 A;  3RBB B;  4F7U G;  1Z9Z A;  8AT1 B;  3OBY A;  3OBW A;  4M78 C;  1EN7 A;  3M53 A;  1K9M U;  2P4T A;  2DAQ A;  3AT1 B;  2H3E B;  2K5F A;  2D0Q B;  3L0O A;  3MET A;  1H3H A;  1UGP B;  2DET A;  2CT3 A;  3G71 A;  3OYH A;  3OYM A;  1AZG B;  2QDY B;  2NUT A;  1HD3 A;  4E7K A;  1GCQ A;  1Q95 G;  1M9S A;  3OYJ A;  1AWO A;  1OQK A;  5KYU B;  4WTO B;  2CP6 A;  1RI0 A;  4PFO A;  1WHL A;  2K57 A;  5GAN 6;  1G3S A;  3EG0 A; 
#chains in the Genus database with same CATH homology
 4N0A C;  5LJ5 h;  1ZBX A;  2B8A A;  2FHD A;  4MZM A;  4JDS A;  3L2Z A;  4FM4 B;  3SWN A;  4A4G A;  4L5G A;  4C0Z A;  3ZFJ A;  2EAY A;  3KXT A;  1JJ2 A;  3HRT A;  2PUK B;  3VJP A;  2DO3 A;  1H64 1;  3QO3 A;  1O75 A;  3CBP A;  3MEV A;  2E1H A;  1YCY A;  1LNX A;  3VUB A;  5CQX A;  1UGQ B;  3PTA A;  4OB0 B;  3QBY A;  4ZGD B;  3WVE B;  3OS1 A;  1VQ7 T;  5GAN j;  1WJQ A;  2FL7 A;  3NTK A;  5GMK l;  5LJ5 f;  4Y91 A;  2C06 A;  3PT9 A;  5KCO A;  1JBM A;  3TCJ A;  4B9X A;  5HK3 A;  5LJ3 e;  2R58 A;  3JCM b;  3V8L A;  3CME T;  4LDX A;  2KY9 A;  4RG8 A;  3UT1 A;  4M7D A;  3GNF B;  4M7D F;  3L1A A;  2DEQ A;  3QZ9 B;  3RMS A;  3SB2 A;  4C92 A;  2VC8 A;  1K73 C;  3J7A F;  2DD4 A;  2OTL T;  3CC4 T;  5GAN h;  3OB9 A;  4OB2 B;  5LJ3 j;  3OYG A;  1N8R U;  2FB7 A;  4PJO A;  4PJO F;  3BDU A;  3NFC A;  1YI2 A;  1Q7Y U;  5D6X A;  3FDR A;  3Q1J A;  4M75 G;  1WGS A;  4E7J A;  4M75 D;  3JCM d;  4OVA A;  5KH6 A;  2JZ2 A;  3T9N A;  4A4E A;  5GAN f;  1VQM T;  3WVD B;  1YHQ T;  2LCC A;  3CCR T;  4BI8 B;  1LOJ A;  1YIJ A;  1YIT A;  1HXD A;  3CCJ A;  4XTY A;  5LJ3 h;  3EFR A;  4M75 B;  1P92 A;  3OYL A;  2QQB A;  3LH0 A;  3S6W A;  3ME9 A;  2QA4 A;  2ZCF B;  4LD6 A;  4EMK C;  2E6N A;  2GFU A;  4EPC A;  2CZ0 B;  2CYZ B;  1Q86 U;  4GLK A;  2DPP B;  3HP9 A;  2GQV A;  4M78 G;  4C8Q E;  3H6Z A;  3ER0 A;  5GMK m;  1HK9 A;  3JAM E;  5CVI A;  2DJZ A;  5HY6 A;  2OAU A;  4M78 E;  5C0M A;  4XAX B;  3CCE T;  4OB1 B;  2H3J A;  4HCB A;  2NLU A;  5GAM d;  3ASK A;  1QP3 A;  1X01 A;  3E19 A;  3DB4 A;  5DY9 A;  3JCM X;  4R56 A;  2XD0 A;  3QDR B;  4ZN3 A;  4TVR A;  3V8K A;  3G6E T;  5C6S A;  3PNW C;  2A7Y A;  3M57 A;  2DKG A;  1N9S A;  3MP8 A;  4M77 D;  4XTZ A;  2PQW A;  5FU6 C;  3DLL A;  3CPF A;  3JSC A;  3OQ5 A;  2LTO A;  4XU1 A;  5I21 A;  3G71 T;  1KC8 C;  3QYH B;  2A3L A;  3L42 A;  2VXE A;  3JCM g;  5GAO p;  2CKK A;  2KSS A;  3LGL A;  1QW1 A;  5FRO A;  3JB9 H;  4CRI A;  4M77 B;  3LYI A;  2XG8 D;  2DXT A;  1S72 T;  1XNI A;  3CCM T;  3QZ5 B;  2Y4Y A;  5GAO r;  1Y7X A;  5GMK i;  3UPU A;  1YJN A;  2KVQ G;  2RHI A;  3DKM A;  5EG2 A;  3MHX A;  3CCU T;  4ME7 A;  3X24 B;  2XIC A;  2DTO A;  5IT9 E;  3X20 B;  5GAO l;  4C8Q C;  4PNO A;  4C0D C;  5KCH A;  3M4Y A;  3X25 B;  4A54 A;  4ZGJ B;  4FT2 A;  4J7I A;  1OZ3 A;  3TEE A;  2QEX A;  2M9U A;  3LWH A;  4XTU A;  2DTH A;  1QVF S;  4BE0 A;  3OYY A;  2EQU A;  4PL6 A;  4ELY C;  2DTI A;  2F69 A;  2HQX A;  4F7U B;  5A0G A;  3OYF A;  3M59 A;  5CQY A;  1VQP A;  2XDB A;  2RJF A;  2X35 A;  4FIB A;  2O4X B;  5CO7 A;  3OYB A;  2DXU A;  3HPW A;  2RO0 A;  5I2M A;  5GAM g;  2LT4 A;  5FU7 C;  3E9F A;  2EJ9 A;  2IG0 A;  3MCA B;  4JRP A;  1O9S A;  2RHY A;  4BY6 C;  3JCM V;  3V7S A;  3NTH A;  3CEY A;  2VGN A;  3MEU A;  3CCQ A;  1BI0 A;  2QQR A;  4MML A;  3I56 A;  1YJ9 A;  2I2L A;  3QSU A;  4JRK A;  4EMG A;  4Q5W A;  3LLR A;  3JCM J;  3PGG A;  3HFO A;  2QQ9 A;  2XK0 A;  3QHS A;  2F5K A;  1EIF A;  1OI1 A;  1YBY A;  2QQS A;  1M90 U;  4J8O A;  1BI2 A;  3LW5 E;  1VQ4 A;  1IZ6 A;  1YI2 T;  1ZHI A;  4DA4 A;  4M7D G;  2E12 A;  5CAI A;  3RKW A;  1Q82 C;  3JCM Q;  4B9W A;  4M7D E;  2P0K A;  3R6O A;  5CIU A;  3JB9 D;  4EDU A;  2MAM A;  5DM7 R;  3A8M B;  5GAO m;  2HBP A;  5IAY A;  1K8A C;  1AHJ B;  3GIB A;  4IKF A;  2KMT A;  2LT1 A;  2DXC A;  3JRZ A;  5AYF A;  3G4S A;  2MWO A;  1YIJ T;  1YIT T;  3CCJ T;  3M4G A;  4LDV A;  3CCS A;  4PJO E;  1DJ7 B;  5GAN 3;  1UEB A;  1OZ2 A;  2QI2 A;  4NS5 A;  4PLI A;  5J3B A;  5GAO q;  2E41 A;  3PMT A;  2DIQ A;  4XU3 A;  3SWN C;  3DB3 A;  2QA4 T;  4BE1 A;  3ZEH A;  2K3X A;  1BIB A;  2YHT A;  1FWZ A;  2M16 A;  3HL8 A;  4J6X A;  3OYN A;  1M4Z A;  1M5Q 1;  2JN0 A;  4OGE A;  5IN1 A;  1M1K U;  3HKS A;  1KD1 C;  3INZ A;  3VYG A;  1QVP A;  2MI6 A;  3BFM A;  3QJY A;  5CKF A;  1W4S A;  2PVG B;  2ZGW A;  4C92 F;  4JRQ A;  4WF2 A;  1VQK A;  2Y4X A;  1K73 U;  4M7A A;  4M7A F;  1Y96 B;  4EMK B;  2XU8 A;  3FJP A;  2E65 A;  4L59 A;  1NJI U;  1N9R A;  2X4W A;  4J83 A;  3SDZ A;  2DZC A;  3BY7 A;  5CK9 A;  2RJC A;  1QVG A;  3A8H B;  4VUB A;  4Y28 E;  4M7D C;  1IRE B;  4V2S A;  4BAC A;  4X34 A;  5A0D A;  2DZ9 A;  1RL2 A;  3CPW S;  4C92 C;  3RKX A;  3OS2 A;  3CD6 A;  2K4Y A;  2L5Q A;  3C94 A;  3CCL T;  2PUO B;  4XTX A;  2WSE E;  5CCA A;  4PJO C;  2RK2 A;  4OMF B;  4A4K A;  4EMH A;  4MDW A;  4E7H A;  4DOW A;  3JB9 F;  5CKE A;  3N5B B;  1YJN T;  2M1H A;  2HQE A;  3PMI A;  4X9D A;  2LCL A;  1JB0 E;  3UWN A;  5CR2 A;  5GAO n;  3LWI A;  1W2B S;  1VQL A;  2R5A A;  2CZ1 B;  3OSS C;  2EJF A;  1XTD A;  1PSE A;  2Y90 A;  4IUP A;  4KBM B;  2XI9 A;  3EAE A;  4XQ3 A;  3J80 E;  5LJ3 f;  4C8Q G;  1KHC A;  1Q81 C;  2RM4 A;  2P0P A;  3GOX A;  3VV0 A;  3OW2 S;  1U1S A;  2AHJ B;  4M78 D;  2QEX T;  2JTM A;  4L6V 5;  4MZP A;  4QQD A;  2P0Q A;  1H3Z A;  1SSF A;  3CCV T;  2LQK A;  2RD1 A;  3OS0 A;  3MO8 A;  1Y96 A;  2DIG A;  4J6Y A;  4XTV A;  2DD5 A;  4BI3 A;  1VIE A;  1VIF A;  1BI1 A;  2BKD N;  2O01 E;  4M78 B;  2PVD B;  4PLL A;  5J26 A;  2LQ8 A;  4BDY A;  3C4S A;  1U8R A;  2RB6 A;  1UGR B;  3JCM e;  1VQ6 A;  1WJR A;  3CC7 A;  2L8D A;  2GFA A;  2FVU A;  2RJE A;  3LGF A;  1KC8 U;  3ZBD A;  4QVC A;  3CCQ T;  3I56 T;  5FLX E;  1YJ9 T;  3QG1 A;  1I81 A;  5J39 A;  3CCV A;  2K2V A;  2FYK A;  3QII A;  4IUV A;  4M75 F;  3PFS A;  4M75 A;  4BY6 B;  1G3W A;  2JUF A;  4JLG A;  3QUI A;  3OMG A;  1BYM A;  1FXX A;  5GMK e;  1YJW A;  3FIF A;  1KQS A;  2VUB A;  3MEA A;  3QXE B;  5GAN 5;  2E70 A;  2BIV A;  3LX7 A;  1VQ4 T;  4C0F A;  5CKD A;  2OTJ T;  2JTF A;  2WSF E;  5GAN 8;  2VXF A;  2EQM A;  3SD4 A;  4BE2 A;  3FRN A;  3NTI A;  2EWN A;  3EFS A;  3JCM h;  1LJO A;  2IVW A;  3M58 A;  5LJ5 d;  5LL6 S;  2YLB A;  2DVE A;  5L8R E;  3X28 B;  2EJG A;  2G3R A;  2RI5 A;  4J5Y A;  5GAM e;  3PIP A;  4JLI A;  4IUT A;  3L2U A;  3G4S T;  2LDM A;  3CMA A;  3M9Q A;  1B34 B;  3PIO A;  3CCS T;  4M78 A;  4M78 F;  2XHC A;  1Y07 A;  3L2V A;  3JCM f;  3VKI A;  2YLC A;  4FSX A;  3CBM A;  5GAM j;  2LNV A;  3VU3 C;  2QQA A;  3E9G A;  4J6W A;  2EQK A;  3RKY A;  5HKC A;  3FLG A;  3G7Z A;  3GLX A;  1VQ9 A;  4BI4 A;  4CI0 C;  1KQ2 A;  2K5I A;  4M77 A;  4M77 F;  4OB3 B;  4D6W A;  3MEW A;  3L2Q A;  3H8Z A;  3CXC S;  1VQO A;  3AHU A;  1K9M C;  4FT4 A;  1VQK T;  4NOY A;  5GAN d;  2K57 A;  5GAM h;  3G6E A;  1U1T A;  4QVD A;  3JCM c;  3CC2 A;  1QP2 A;  2R5M A;  3C12 A;  4QQ6 A;  4RCB A;  2RI2 A;  5D6W A;  3JB9 J;  2JNG A;  1WPY A;  3OMC A;  4M7D D;  3CPW A;  2ZPB B;  4C92 G;  1Q82 U;  3RMQ A;  4HA8 A;  4M7A G;  2E10 A;  4C92 E;  4F7U A;  1MGQ A;  4F7U F;  5LJ5 g;  3HHT B;  4M7A E;  2RA2 A;  5GAM f;  1N6A A;  5A0L A;  1NPP A;  5LJ3 d;  1I4K 1;  5M9O A;  4PJO G;  3URG A;  2O4X A;  4M7D B;  1B34 A;  4XTW A;  1BKB A;  2JVV A;  3FEO A;  5HK0 A;  3RES A;  4RMO A;  4N0A A;  1VQ8 A;  2F5T X;  2KK4 A;  1VQ5 A;  2YRV A;  3I55 A;  4GY5 A;  4IUQ A;  1W2B A;  1D3B B;  1JRI A;  2RHU A;  2LVM A;  2X4X A;  3OS5 A;  2VV5 A;  1MHN A;  3A8L B;  1NE8 A;  2DXB A;  5GAN 7;  3HSB A;  2LC4 A;  1X6O A;  1WQW A;  3O8V A;  4A4F A;  2K5L A;  5DLO A;  4IUU A;  4JS4 A;  1KD1 U;  3OW2 A;  2D9T A;  2GCX A;  3A5Z B;  3QJ6 A;  4E7L A;  4FL6 A;  1UB4 A;  3BDL A;  3S3N A;  1WQ7 A;  1GXI E;  3E1S A;  4JUV A;  2ZPG B;  3V8J A;  4KT0 E;  5GAN g;  4XU0 A;  2HNI A;  2PVO B;  4IUR A;  3OYD A;  3C95 A;  2RH2 A;  3J81 E;  1VQ6 T;  3CBO A;  4HT8 A;  2XKO C;  3CC7 T;  1ZQ1 A;  3FB9 A;  3M54 A;  4M7A C;  3OYK A;  2GF7 A;  4NL2 A;  1M8V A;  4RCC A;  2XDD A;  3GF5 A;  1VQN A;  1M1K C;  2QXF A;  3A8O B;  3QYG B;  4ELZ C;  4MDX A;  1G3T A;  4O6J A;  4RKU E;  3HRU A;  4ATO A;  5LJ3 g;  5FU6 B;  4MMK A;  3V7R A;  4JS5 A;  1VUB A;  3KBG A;  3L2R A;  2EFI A;  4PKC C;  1NJI C;  3JCM P;  1YJW T;  1N8R C;  4C5G A;  1KQ1 A;  2CGH A;  1D3B A;  4C5H A;  1NPR A;  2M0O A;  2ZZD A;  3OSV A;  2MWP A;  4HCZ A;  4JRI A;  5DLQ E;  3X26 B;  1Q7Y C;  3VUZ A;  4C8Q D;  1Q81 U;  2VYT A;  4M75 E;  5I2S A;  3UDC A;  1XQH A;  1KHI A;  2WAC A;  3OYC A;  2RHX A;  1QVF A;  1JJ2 S;  2E64 A;  3F70 A;  3WXM B;  1VQP T;  4QVZ A;  4EMK A;  2E5Q A;  4C8Q B;  3CMA T;  4XK8 E;  2K3Y A;  4C0D B;  4N4H A;  2HD0 A;  3GP8 A;  5A2Q E;  2CZ6 B;  2MMP A;  2VGM A;  3M56 A;  1I5L A;  4LDY A;  1VQ7 A;  3RER A;  4KUL A;  4DQ2 A;  4HKE A;  2EYQ A;  4II1 A;  1G3Y A;  3S3O A;  1XOV A;  4C5I A;  2QTX A;  4UC4 A;  3DLM A;  2MF2 A;  4OP0 A;  2R57 A;  2ZPE B;  4BUG A;  4DOV A;  1VQ9 T;  1Q86 C;  5FRN A;  5FU7 B;  3CME A;  3TU4 K;  5GAN 2;  1V29 B;  4HCC A;  2LRQ A;  2V8I A;  3CXC A;  1VQO T;  5GAN 4;  4ZGE B;  1BIA A;  3VYH B;  5KE2 A;  4E7I A;  2RI3 A;  5GAN e;  1PSF A;  3MP1 A;  2OTL A;  3CC4 A;  3GNG A;  4MZT A;  2XDP A;  2X4Y A;  2ZPI B;  3SFM A;  2XID A;  1WJS A;  3M55 A;  4ZTF A;  4J7F A;  4QQG A;  1QVG S;  4C0G A;  1M90 C;  3RUX A;  4M77 G;  3CC2 T;  4M75 C;  3A8G B;  4KUI A;  4ZTJ A;  3OY9 A;  3QPH A;  1Y71 A;  2KDS A;  4M77 E;  3RIR A;  4A4H A;  5GMK j;  4RG2 A;  1KG1 A;  1VQM A;  3CCL A;  1NZ9 A;  2RK1 A;  3CCR A;  1YHQ A;  1VQL T;  4C8Q A;  1TH7 A;  3MP6 A;  4XU2 A;  4LDW A;  4C8Q F;  2E6Z A;  4FU6 A;  3KUF A;  4YTL A;  4N4I A;  4C5E A;  5FRM A;  3FC3 A;  4BDZ A;  2V8K A;  3P8D A;  1VQ8 T;  2RHZ A;  4E47 A;  4P5N A;  3GPL A;  1VQ5 T;  4F7U G;  5GMK h;  3I55 T;  1FX7 A;  4O5V A;  4F7U E;  1R8O B;  3OBY A;  3P8B B;  5CKH A;  4R55 A;  3OBW A;  3JCM W;  4LDU A;  4M78 C;  3HRS A;  2V8J A;  3M53 A;  3TRE A;  2L3R A;  3CCE A;  1K9M U;  1BI3 A;  3SWN B;  2P4T A;  2DAQ A;  2K5F A;  3HFN A;  4OGC A;  1OYX A;  3OYA A;  2RJD A;  2WSC E;  5D6Y A;  2JOY A;  2D0Q B;  2CS7 A;  1M1F A;  3MET A;  1UGP B;  4M77 C;  4N4G A;  1WNL A;  4OF1 A;  4Z02 A;  4LD9 K;  3G71 A;  2ZPH B;  1N27 A;  5LJ5 e;  3OYH A;  2PU9 B;  4X9C A;  3OYM A;  1G5V A;  4C92 D;  3CD6 T;  2QDY B;  4JJN K;  4M7A D;  2KAF A;  4A53 A;  1I8F A;  4QW2 A;  1K8A U;  4HT9 A;  1VQN T;  3S3M A;  2KQW A;  2HAX A;  4E7K A;  2EKO A;  1S72 A;  4PJO D;  3CCM A;  2BUD A;  3L2W A;  1M9S A;  3JB9 I;  5LJ5 j;  3OYI A;  4C92 B;  4M7A B;  4BD3 A;  3OYJ A;  1M1G A;  2D6F A;  1KQS S;  3CCU A;  1UGS B;  2CZ7 B;  2ZPF B;  1X75 C;  2EQJ A;  3P8H A;  1RI0 A;  4NL3 A;  4ZN1 A;  4KUD K;  3BW1 A;  4PJO B;  2OTJ A;  2X4J A;  5CKB A;  3V7C A;  4BB7 A;  3OYE A;  3JB9 G;  5KE3 A;  3M5A A;  2LX9 A;  2L89 A;  5GAN 6;  1G3S A;  2EIF A;  3QKJ A;  2DK3 A;  3OA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...