5CIUA

Structural basis of the recognition of h3k36me3 by dnmt3b pwwp domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
127
Chain Sequence
b'EYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFDQLKPMLEWAHGGFKPTGIEGLKPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (cytosine-5)-methyltransferase 3B
publication title Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 127
sequence length 136
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 5ciuA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ciuA01
1OYXA 3LX7A 1WJRA 2RI3A 2X35A 2O4XB 4E7JA 3NTKA 2M0OA 2M16A 1G5VA 3KUFA 4C5EA 3L2RA 3OYEA 2X4XA 2RI2A 4E7LA 2LCCA 4BE1A 5D6YA 4QQDA 3ASKA 3OS2A 5IAYA 3META 3OYGA 1H3ZA 3OMGA 2EQKA 3OYAA 3MEWA 5FROA 2R5AA 3L2VA 2MWOA 4IUUA 2HQEA 3S3NA 2K3YA 2L8DA 3QKJA 2QQRA 4N4IA 2RHZA 4N4HA 3GOXA 2E5QA 2FHDA 5D6XA 4E7HA 3S3OA 3E9FA 5FRNA 3DB3A 4E7KA 3OYJA 2O4XA 3BDLA 1OI1A 3PMIA 4IUTA 3OYHA 4OVAA 5KE3A 3L2UA 3S3MA 4GY5A 1OZ2A 3OYCA 2CKKA 3UT1A 2LTOA 4BE0A 3E9GA 4BACA 2L89A 2QQSA 2RJDA 4N4GA 4IUQA 2LDMA 2F5KA 5CIUA 2XK0A 4B9WA 3P8HA 3H8ZA 3OB9A 2XDPA 3FDRA 4QW2A 5J26A 4E7IA 3OS1A 3OYDA 4QQ6A 2YRVA 2BIVA 2RHXA 3Q1JA 2RHUA 4IUPA 4B9XA 2E6NA 4IUVA 4FL6A 4HCZA 4ZTFA 2JZ2A 3FLGA 2JTFA 3L42A 3L2WA 4BD3A 2K3XA 2WACA 2BUDA 2DIGA 3P8DA 5J39A 2RHYA 2D9TA 3CEYA 3OY9A 3OYMA 1KHCA 2PQWA 5D6WA 4NS5A 5KCOA 2RO0A 3C4SA 3MP1A 4EDUA 3QIIA 2GFUA 5M9OA 3SD4A 2DIQA 4BDYA 3L2QA 3OYIA 3OS0A 3QJ6A 3MP8A 3UWNA 3PNWC 3LGLA 3LYIA 3M9QA 4UC4A 3DLMA 4X34A 1N27A 2EQUA 2L3RA 2RJFA 3LH0A 2B8AA 4RG2A 4BE2A 1MHNA 3MEUA 1RI0A 2EKOA 2RJCA 3O8VA 4IURA 2R58A 2EQJA 4Q5WA 3FC3A 4IKFA 2R57A 4C5HA 4PLLA 4A4GA 2EQMA 4A4FA 5KE2A 4C5GA 3OYFA 4QQGA 5KCHA 2RI5A 3LLRA 3DB4A 2GF7A 3NTHA 5KH6A 1XNIA 2M1HA 2P0KA 3OMCA 4PLIA 2G3RA 3OYKA 3LGFA 4PL6A 2DAQA 3FEOA 2VYTA 1WJQA 3F70A 3ME9A 3ZEHA 3PFSA 1WJSA 4C5IA 1SSFA 2RJEA 3MP6A 4A4HA 2EFIA 2LVMA 4BDZA 1WGSA 3MEVA 1OZ3A 4ZTJA 2RHIA 2MWPA 5IN1A 5C6SA 3OYBA 4L59A 4II1A 2HQXA 4CRIA 4Z02A 3PMTA 3S6WA 2BKDN 2LRQA 3EAEA 3MO8A 3H6ZA 4FU6A 5FRMA 2X4YA 3OA6A 4LD6A 4QVZA 2X4WA 4A4EA 5C0MA 3OYNA 2GFAA 3NTIA 3OQ5A 3OYLA 2R5MA 3QBYA 2IG0A 3MEAA 2NLUA
chains in the Genus database with same CATH superfamily
5LJ5g 1W4SA 3CCJT 1X69A 3G71T 3CCUT 2M16A 5LJ3e 3FJ5A 1Q81C 3KUFA 3ZL7C 1T0HA 4FYXB 3G1JA 4NOYA 2ATCB 2LZ6B 4L6V5 1AZGB 4GLMA 4M77C 4F7UA 3CC2T 2YUOA 2F5TX 3RKYA 4M78A 2VXEA 2DL7A 4E7SA 2V8KA 1LVKA 2BE9B 3PIPA 5GMKi 2HDAA 2CGHA 2DBMA 3CCVT 3CMEA 3CCMT 2M02A 3M0UA 2DXUA 3JRZA 2RQWA 4HVUA 3A8MB 4FSXA 3JB9F 4HA8A 1B34B 4M75D 3JCMQ 1ZSZA 2P4TA 2QASA 2P84A 3Q1JA 1N9RA 3LH5A 3JSCA 1RABB 1VQ4A 2QA4A 2YLCA 4RMOA 2DYBA 2RHYA 4M75E 2QI2A 3M59A 4GBQA 4AFSC 2GFUA 2A8VA 1T3LA 3CMEQ 2LQWA 1TWBA 5A0GA 2EYWA 4X34A 2RK1A 1BU1A 3INZA 4RG2A 4XTZA 2KRSA 2O9VA 3TEEA 2EQJA 2KT1A 2R57A 2E12A 2HKQB 4OB3B 4C92G 1VQ4Q 1BYMA 3GF5A 3VS4A 4WTOB 2KSSA 2QA4Q 1XNIA 2K2VA 2O31A 4RTUA 4OMMA 1N9SA 3PTAA 4VUBA 3DKMA 4HVWA 3RUXA 2LVMA 2HNIA 3TREA 3EAEA 4M7AC 2HSEB 4A4EA 1T0JA 4TVRA 5IHKA 2DMOA 3NTKA 1WI7A 4AG1C 2Y4YA 2AK5A 4XTUA 2EQIA 3OYAA 5FROA 1PSFA 2MCNA 3S3NA 1YJNA 5GMKh 2ZPGB 1ZUYA 2RHZA 4O5VA 2DYIA 2SEMA 2RA2A 5KYYA 1MGQA 4BE0A 2DNUA 2CZ6B 2F5KA 2LNVA 4KH0B 3TU4K 1WIEA 3QG1A 4R55A 3QWXX 1VA7A 3OYYA 2KFVA 2PUOB 4QQ6A 2YRVA 3CPWP 2KVUA 2BIVA 1MNEA 2PVOB 3E2UA 1YJNQ 2EW3A 1C6VX 2OAUA 3CMET 2D9TA 2I2LA 1XOVA 2JS2A 2K4YA 1NE8A 3CPFA 2E70A 5FU7C 1BCMA 1TS9A 1K4US 2FPEA 3M54A 1P92A 2M9UA 5GAMe 2GNCA 2DL8A 2EQUA 2LQ8A 2QAZA 2CZ7B 2EGEA 5KE2A 3HKSA 1WXBA 3J80E 5CQXA 3VKIA 3OMCA 3X25B 3OYKA 2KBTA 3JB9H 1YN8A 4C92B 3LGFA 2DF6A 4HKEA 3PFSA 1WJSA 1BKBA 2XHCA 4C5IA 2H8HA 4NL2A 2WSCE 4LD9K 2E6ZA 2HQXA 1TTHB 1C1AA 3I5RA 3QDFA 2DL3A 2XICA 1D0YA 2V1QA 2RH2A 4CI0C 2WSEE 1HXDA 5CKHA 4ZTJA 1KSWA 5GAOp 3DLLA 1VQ6T 5A2QE 2IVWA 1M1GA 2EVRA 1WPYA 5LJ5e 2COZA 3JCMg 1SRMA 4M4ZA 2CSIA 1K8AR 5EC7A 4BITA 1PD1A 2RQUA 4PJOD 1G3WA 3QYGB 3V8JA 1ZX6A 1OX8A 2KVEA 3O5ZA 2OAWA 4LUEA 3EH2A 3CBOA 1WYXA 2O4XA 1YCSB 1OZ2A 2DRMA 1I07A 2LMJA 2KI7A 1V29B 1OU8A 5FWCA 4DBRA 1MMAA 4PJOE 3P8HA 1YIJT 4PJMA 4D8DA 4RG8A 1X6OA 1YJNT 3MHXA 4AMCA 2VKNA 5IXBA 4JJCA 2OTLA 1ZHIA 2PTKA 3JCMd 2OTJA 3J7AF 3BE3A 4OF1A 2L2PA 3HFOA 4D6WA 3C4SA 4J9GA 2LC4A 3M4GA 2LJ3A 1R77A 3CPWS 3WXMB 4C8QG 3PNWC 2VV5A 4DQ2A 1K1ZA 1ZUKA 2G80A 2O9SA 2RJCA 2VB6A 4Q5WA 3FC3A 2QTVA 2OTLQ 3OYFA 2E10A 1SKUB 2AZSA 2OTJQ 1D0ZA 1IZ6A 1X43A 1JU5C 1B34A 2H3JA 3GLXA 4PL6A 1AWOA 1MMGA 4XU2A 4PJOF 3R6OA 5CR2A 4CRIA 1RAGB 3RMSA 1EFNA 2NYSA 3H6ZA 2HBWA 5HCKA 2AZVA 3OA6A 4A53A 5C0MA 3OYLA 3NTIA 2EKHA 2CYZB 1XTDA 2NLUA 3MEAA 1WJRA 4HXJA 2X35A 1R0BG 2AHJB 1TSFA 1E7LA 2K6DA 2LCCA 4JLIA 4Z88A 3OYGA 1GXIE 5GAOr 3L2VA 2VVKA 3V7CA 2L8DA 1IGUA 3GOXA 1RAAB 2YT6A 2JNGA 2KYMA 3ZFJA 1UGSB 1Q7YR 2VWFA 3E9GA 1BCOA 1QLYA 2NUZA 1U06A 4HVVA 2YWWA 3BY7A 1F1BB 4ZGEB 1X75C 4M78D 4ME7A 3OYDA 3QPHA 1I5LA 1HSQA 2VGNA 3E1SA 1NPPA 1UHCA 3CEYA 4X9DA 5GAN3 4OMNA 1KHCA 4NS5A 5KCOA 1ZA2B 2O01E 3HTRA 3QIIA 5DLOA 5KYUA 3L2QA 3QHSA 1TUGB 2JW4A 1VQKT 3OS0A 3CCSA 3THKA 3RKXA 2L3RA 2QEXA 4C8QB 3O8VA 4IURA 1K8AU 1UECA 2EQMA 2DFUA 4C5GA 1QVGP 2A0FB 5GAOm 5GAN6 3C0CA 3DB4A 4B6MA 1UGRB 1EX4A 2P0KA 2G3RA 1NJIU 1WJQA 5FLXE 1QMCA 3CCSQ 3OYBA 3I56T 4II1A 1OULA 4Y91A 3CXCP 2HQHA 1YBYA 2ABLA 3JCMV 2R5MA 2GBQA 1WFWA 1QWEA 4DEXA 4F7UF 2F1LA 4FCYA 2JM9A 4MDXA 4M78F 5I21A 3HRTA 5CKFA 3M4YA 5LJ3h 3CCUA 2LCSA 1M1KR 5IXFA 4J7FA 1VQ8T 1RUWA 4OMOA 5GANf 2P0PA 3CC2A 1B3QA 3LWIA 1E6HA 4DBQA 1VQNA 5LJ3f 1SHFA 1UDLA 2DZ9A 1OI1A 1UHFA 1JRIA 5GAOn 2MPHA 4PNOA 4C92A 3CCVA 3CCMA 2QQ9A 3URGA 3VJPA 1N5ZA 4QW2A 3CCUQ 2GTJA 1Q86R 2EIFA 1ARKA 2RHXA 4M77G 2RHUA 1YI2A 1WHHA 3CC2Q 5KYNA 1QVFP 3FLGA 1AHJB 2OX7A 3CQTA 3L42A 1KQSS 2VXFA 4ANJA 2FZGB 3IQLA 1VQNQ 2KRNA 4OMLA 2FYKA 3QDRB 2CZ1B 2YUQA 1TU0B 2MOXA 3CCVQ 2RNNA 2DTIA 3CCMQ 1AEYA 3TSWA 3LGLA 3R6NA 2KY9A 3EG2A 4FIBA 1N27A 3LH0A 2ZPBB 4C0ZA 5HK0A 4BE2A 3MEUA 3REBB 2AIRB 4C0FA 2IPOB 2NUTB 1YI2Q 4FYYB 2LX9A 2QK0A 2M1HA 2AKKA 2RQRA 1RAIB 4J9HA 1YP5A 3HPWA 2DKGA 1A63A 1Q7YU 2EFIA 2JMCA 3KXTA 3JB9D 1K8AC 1SG5A 4Z02A 3M0TA 3UA6A 1QVGS 1JJ2S 2XDDA 4R56A 2D1XA 2DLPA 2DPPB 3CBMA 2NWMA 3OQ5A 3RBBB 2EYYA 3RMQA 2DE0X 3X28B 2GGRA 2FVUA 1PC0A 3CC7T 2O4XB 1WQ7A 4BUGA 1K9AA 2IIMA 3OYEA 3L2RA 3CXCS 2VGMA 3CC4Q 2E4HA 4FM4B 5CKDA 2KEAA 4JZ3A 2KE9A 4RCCA 3META 3MEWA 3QXEB 2MWOA 1W2BA 2CUBA 2XI9A 2DM1A 4PJJA 3M0QA 3A8OB 2DO3A 3CMAT 1NEGA 3EG9B 3PMIA 4M7AG 3CBPA 4M75C 5GAN5 2BZYA 1I8FA 4YTLA 1VIEA 2QQSA 4F04B 2LDMA 4J9CA 3FB9A 5GMKm 4B9WA 1UFFA 1BI1A 3FDRA 1C0MA 2L3SA 2C06A 4LDXA 5FWBA 1LCKA 1RAEB 4C0DB 2X51A 1VQNT 1ZLMA 2E1HA 4FL6A 4MZTA 1PD0A 2K3XA 5J39A 4N0AC 4M77B 4J7IA 3I9QA 2CT3A 2C0TA 4HT9A 2DIQA 2RQTA 5CKEA 2EBPA 2P0QA 2KXCA 1QVFS 1YI2T 5GAMh 2ODGC 3L0OA 3VYHB 1V66A 1U5SA 1M1KU 1KD1R 2A37A 4M7DA 2H3EB 1HD3A 2ZCFB 1YNZA 5KCHA 1A0NB 1QWFA 2DTHA 4QKUA 1GCPA 4X9CA 5GAMf 2VYTA 1NZ9A 2MIOA 3ME9A 5GAN8 3V8KA 5IN1A 2MWPA 3GNFB 1Y96B 3JCMP 2DA9A 4MZMA 4C0GA 4LD6A 3X20B 3A1PA 3QO3A 1Q86U 2W0ZA 3MJXA 4J9EA 3CC4T 1Q7YC 2KYBA 2M0OA 1FMVA 1OEBA 2A3LA 2DL5A 1B7TA 3REAB 1VQ6A 1W1FA 2DXBA 4Y92A 4D8KA 4JS4A 2CP0A 4BE1A 1D1BA 2DZCA 4E47A 5LJ5h 1QKWA 3VS2A 3WVDB 1Y7XA 4C8QA 3SWNC 2F69A 2CP2A 1I1JA 4MDWA 3U23A 5L23A 1NG2A 1TG0A 2AKLA 4FYVB 4KGVB 2CP3A 2I0NA 2EYQA 5FRNA 3GBQA 3EH1A 2XG8D 2YRDA 5LJ5f 2KROA 3CPWA 4GY5A 3CCQT 3UA7A 2JTEA 3OYCA 5KYXB 4M7AB 5GJVB 4PFZA 5KYUB 1VQ6Q 2XDPA 2MYSA 2HZYA 1A8VA 2EJ9A 1YIJA 2LCLA 1M5Q1 2EJGA 4IUPA 1OPLA 2Y4XA 5FU6B 1E7OA 1IHWA 2V8IA 1NYGA 4F14A 1YHQA 4JJDA 4A54A 2PU9B 4EMKC 4RKUE 5I22A 4M77F 1H8KA 2JVWA 2CH4W 3DLMA 2PUKB 2HL5C 2J05A 1KQ2A 4BI8B 1JXMA 1YIJQ 1PNJA 2J6KA 2L5QA 2ZAEA 2C0IA 2ZPHB 3A8HB 2F2XA 4V2SA 1KK7A 8ATCB 1YHQQ 1J3TA 1EZZB 3UDCA 3ZEHA 3VRYA 1WGSA 4RTWA 1OZ3A 1M1KC 2MF2A 1W6XA 2VC8A 4ZNXA 3NMZC 4JPBW 2K2MA 1Z9QA 1VQMT 1QQJA 1M3CA 4HT8A 2FPFA 2RI3A 3HRSA 1E6GA 4ELYC 3EG1A 4C5EA 1UTIA 2KNBB 1Q82R 4PJOC 1VQPT 4RTVA 2J7IA 3OMGA 4BI3A 1AVZC 4F17A 3CCLT 1YJ9T 1Q86C 3QKJA 2NUTA 2K7AA 4GLKA 4RTXA 2W51A 2FZKB 2E5QA 3E9FA 2FZCB 1K9MR 3CCEA 1HYOA 3S3MA 1M8VA 3H0HA 2ZPEB 1Y02A 1U3OA 1PM3A 2V26A 4JDSA 2RJDA 2JUFA 4MZPA 4N4GA 4EMGA 3JCMb 4LN2A 4RTYA 3J81E 4E7IA 4RTTA 2DETA 4ZN1A 1S1NA 2MI6A 5DLQE 1YWPA 3G4SA 1U1SA 2KW9A 4KUDK 4M7AF 4M7DG 4BB7A 4F16A 5AT1B 4XK8E 2BUDA 5LL6S 2EGCA 3CCEQ 4C92D 2QYZA 3EG0A 3PIOA 2DTOA 1KC8R 1T3SA 3MP8A 3HL8A 4HCBA 1VQKA 9ATCB 2JMAA 1VUBA 1MHNA 1I5OB 1RI0A 3A8LB 4C92E 3G4SQ 2PNIA 3EG9A 3QYHB 3FJPA 1YHQT 3EHQA 2DERA 2JOYA 1RAHB 3QUIA 1PCXA 2DD5A 2RI5A 5IHIA 2E3IA 1GCQA 1YFNA 2ECZA 2BZ8A 2HD0A 4AG2C 3JCMW 4XTWA 4EPCA 4J8OA 1VQKQ 4BI4A 3I56A 2RD1A 1WHKA 4FU6A 4M77A 4KBMB 2X4WA 5CQYA 1VQOT 3JCMX 4HCKA 1VQ9T 1OV3A 3I5SA 3P8BB 4DOVA 5HY6A 2HSPA 3FIFA 3M56A 2K57A 2C0OA 3G7ZA 3GP8A 3TQ7P 3KFVA 4IUUA 2HQEA 1VQ8A 5IHNA 3VS3A 1BIAA 3GPLA 4C92F 5IT9E 2QNFA 3I56Q 1X6GA 1MUZA 3BDLA 3L2UA 2J6OA 1FXXA 3RKWA 1H3HA 2P4RA 3VUZA 1BBZA 2LTOA 1SPKA 4M78C 1G8XA 2A36A 2M51A 5HK3A 2RNOA 1FX7A 4IUQA 2NUPA 1OOTA 1K0SA 2V8JA 2XU8A 1Y96A 2E6NA 2KGTA 2J6FA 2KMTA 2RF0A 3CCET 2L3PA 1VQ8Q 1KD1C 2DIGA 2GTOA 3PE0A 1N8RR 3JCMc 2DL4A 4KGZB 5D6WA 4E7ZA 1QCOA 5CVIA 4M7DB 1ZSZC 2O2OA 4DBFA 2A7YA 4LUDA 1KQSP 2YHTA 4PJLA 1X2KA 2E5KA 2GQIA 3SDZA 1U8RA 1UJYA 3UWNA 2W10A 2MAMA 3UPUA 3G4ST 1Q82U 4XTXA 5GMKj 1KIKA 2YUPA 4BY6C 3H0IA 4FT2A 3M58A 4XU0A 5LJ3g 4RTZA 3VYGA 2ED1A 5EG2A 5AYFA 3ULRB 5KYXA 4OB1B 4F7UE 4M7AA 1KG1A 1K9MU 4M78E 4QT7A 1TXQA 1R8OB 4P5NA 1GFDA 1I81A 4JS5A 1B07A 2LT4A 3OSSC 1O75A 2WQGA 2LRQA 2YLBA 3RDVA 3EFOB 3RR6A 3V7SA 3OW2P 4ZN3A 2KDSA 3PVQA 3JAME 5D7UA 2IG0A 4LXCA 1JJ2P 1U1TA 3M5AA 4CC7A 1MMNA 2XIDA 4L5GA 3VS6A 2YDLA 1SF9A 3CC7A 5LJ3d 1YCYA 1PRLC 1JBMA 1BB9A 2BTTA 1ZQ1A 2DVJA 1LNXA 2MK5A 2EQKA 6AT1B 1M3AA 3VS7A 2X3XD 2RPNA 1KC8U 2QXFA 2K5LA 4N4HA 2FL7A 2FHDA 4E7HA 1GBRA 3CMAA 2ENMA 5GANh 1X27A 8AT1B 4LE9A 4AFZC 2V1RA 5KYWB 2BZXA 1NEBA 3CC7Q 1YITQ 1ZUUA 3NHNA 4C8QD 3JCMJ 4PFPA 1VQ5T 3T9NA 2CREA 3JCMe 2EWNA 4BD3A 2JVVA 1KJWA 2DK4A 3CMAQ 2DVEA 4M75G 2JT4A 1NLPC 5DM7R 2VASA 1M90R 2CH4A 3RERA 1JEGA 4M7DF 2FPDA 2RJFA 2XD0A 2B86A 1GJJA 2LC3A 2XKOC 2D8JA 1UGQB 1X01A 1OU9A 1M1FA 3EGDB 3M53A 2QGFB 3HFNA 1AOJA 4PLIA 2KXDA 4PK4A 1Q82C 3EG3A 4LDYA 1SSFA 3CD6A 2CDTA 1HJDA 5C6SA 2HKNA 2RQVA 1H92A 4PKCC 3MO8A 1JO8A 2HEQA 3VS0A 1KFZA 3SFMA 1D0XA 2X4JA 3VUBA 3C12A 3MPUB 1K9MC 1D1CA 1OYXA 4OGEA 1M3BA 4JRKA 1NPRA 4C8QF 3CC4A 2DX1A 4XAXB 1N8RU 1BI0A 4J5YA 2GQVA 5GJWB 3SHWA 3I55T 4UZWA 4FSSA 3OW2S 3CD6Q 1RACB 1GKUB 1S72A 1VQLT 5D6XA 5J3BA 3CCRT 4JRIA 4LDWA 2KQWA 2CT4A 4OMQA 5GAMg 1OQKA 1YITT 1Z9ZA 1X2QA 2DD4A 3CCQA 1VQ7T 1KC8C 1PRMC 4O6JA 2M0YA 1LOJA 3VS5A 3LWHA 4IUVA 3VU3C 2FEIA 2JXBA 5I11A 1IREB 1S72Q 4LNPA 2YXYA 1CKAA 3SEMA 1D09B 3C95A 2Y90A 5CAIA 4DA4A 1M4ZA 2RO0A 3MP1A 5M9OA 1AT1B 3QJ6A 2A28A 3CCQQ 1WLPB 3M9QA 1NLOC 4UC4A 4M75B 4CC2A 5GAMd 2JN0A 3NPFA 2QTXA 2EKOA 1M8MA 2D0QB 2DRKA 4IKFA 2F2WA 1ZBXA 1M2VB 2EYZA 2O88A 1GFCA 4EMHA 4C0DC 1VYVA 2PVGB 3FEOA 4J6YA 2LQKA 2HCKA 4OMFB 2RHIA 3BFMA 2DXTA 1SHGA 2PVDB 4QVDA 1BI2A 2E3HA 4E2FB 5FRMA 4XTYA 1EN7A 3OYNA 3JB9J 2GFAA 1H9FA 2KT8A 1VQMA 3LX7A 1W2BP 1G5VA 2JTMA 1VIFA 3CD6T 4E7LA 5LJ5d 1H3ZA 2NUPB 2R5AA 1VQPA 2G6FX 5DY9A 4J9BA 2LJ1A 3L1AA 1M90U 4KRTA 2MMPA 1A62A 4M77D 2K79A 1H9EA 3EFRA 3CCLA 2DBKA 1YJ9A 4J6WA 4E7KA 4CC3A 2K5FA 1G83A 1N8RC 3BW1A 1VQMQ 2L89A 1SSHA 3H0FA 2DILA 1PKTA 3H8ZA 3OB9A 5GAN2 4M77E 3H9NA 2WSFE 4PJOG 1S72T 4PJNA 1JXOA 3EFOA 4KT0E 1LJOA 5CK9A 2CP7A 1VQPQ 1WNLA 3L2WA 1YWOA 2WACA 4NL3A 2EYXA 3EFSA 5GANj 1QCFA 3CCLQ 1YJ9Q 4WF2A 4XU1A 2LX7A 3SWNB 1IRXA 4ZGJB 3SD4A 5LJ3j 1Y0MA 1UJ0A 3RNJA 1M27C 1WDXA 2X9HA 1QP3A 1PWTA 2COYA 3G6EA 5CKBA 1K73R 1WZOA 4M75F 3NTHA 1OPKA 3LLRA 2GF7A 1VYUA 5KYWA 3GNGA 1ZBJA 5A0LA 1PG5B 5L8RE 2DAQA 5FU6C 2RJEA 2SRCA 1M30A 2EPDA 2EAYA 3S6WA 1ACMB 3M57A 3G6EQ 4EMKB 3HP9A 3NGPA 2D6FA 4OB0B 4ZGDB 1GRIA 1M9SA 1HK9A 4M7AD 3X26B 4E7JA 3H41A 1VQOA 1G3SA 2L0AA 4Z8AA 2L3QA 3FRNA 2X4XA 1VQ9A 1G2BA 3HRUA 5FU7B 1RADB 2K3YA 3M55A 1UUEA 2CS7A 4M7AE 3EGDA 3S3OA 1W2BS 5I2SA 1WHJA 2J06A 2KK4A 1MMDA 4LDVA 1QW1A 1DJ7B 1ZSGA 1E7DA 4JLGA 5CO7A 2ZPFB 1RI9A 4DBHA 5CIUA 1JEQA 2XK0A 1VQOQ 2CP5A 3PVLA 1M90C 1VQ9Q 1XQHA 1VQ4T 2QA4T 4C92C 3ER0A 3SB2A 4PJOB 4RUGA 1D3BB 1ZBHA 2OJ2A 4CC4B 3MCAB 4R0KA 1GBQA 1MV0B 2K5IA 4EDUA 1KD1U 2EJFA 1UGPB 4LDUA 2DJZA 3C94A 4F7UG 1IB8A 4RCBA 1UB4A 4M78G 1QCNA 1GL5A 5CCAA 1ZS9A 2CZ0B 3V8LA 4DEYA 4JRQA 2VUBA 2ZZDA 2XDBA 2QQAA 2YUNA 4AT1B 5KH6A 1NBEB 1CSKA 3ZBDA 1UE9A 1FYNA 4Y28E 3F70A 1AD5A 2YSQA 4A4HA 3G6ET 1TOVA 3MEVA 1G3YA 1YJWA 3PMTA 4FW1A 1JQQA 2LT1A 2X4YA 1NJIR 4ORZA 1YNSA 2HBPA 2D8HA 3OBYA 3TVTA 2FG0A 1WX6A 4J9DA 3KBGA 5D6YA 4M75A 5IAYA 1KQ1A 5GMKe 5GAMj 2E41A 1JB0E 2RN8A 1YJWQ 1IXDA 1QP2A 4J83A 1UGVA 4ATOA 1M2VA 5FW9A 4OMPA 3PGGA 4FW2A 4OVAA 5KE3A 4AFUC 1RL2A 1SRLA 2CKKA 3UT1A 1Q81R 1K73U 3QWYA 4N0AA 3EGXB 1KQSA 1H641 1R0CB 1VQ5A 1W70A 2JTFA 3JCMh 3D7SB 1XJWB 5I2MA 3OY9A 2PQWA 2Z0WA 1FMWA 1AWWA 3X24B 3OYIA 4E6RA 3QZ9B 4FT4A 4Z89A 2QGGA 3JCMf 5LJ5j 4MMKA 4F7UB 1SEMA 2XMFA 1Y57A 5GAN4 4M78B 2CP6A 3VV0A 1TUCA 3EHRA 2R58A 1O9SA 4A4FA 1JJRA 4QQGA 1VQ5Q 2HL3A 3MKDA 2KRMA 3TCJA 1WHLA 1FWZA 4DOWA 1ZA1B 1AZEA 1PSEA 3OW2A 4KULA 1N6AA 3JV3A 2GCXA 4BDZA 1JJ2A 1QVGA 4A4KA 4M7DC 1RLQC 4AFQC 1ZSZB 5GANg 3AT1B 1Q95G 2FRYA 2ROTA 2RNAA 3UF4A 4QVZA 1WA7A 1BI3A 4JJNK 3SWNA 4XTVA 3CXCA 1D1AA 5GAN7 1QVPA 2ED0A 5GAOl 1AWXA 2BE7D 1VYTA 4BY6B 5HKCA 4KUIA 3M0RA 4QQDA 3ASKA 1YJWT 3JB9G 1G3TA 2A08A 1UEBA 4ELZC 1AWJA 4OGCA 4HCCA 3I55A 1WHMA 3PT9A 3HSBA 2YRCA 4N4IA 2ZPIB 2LD7A 3M0PA 3M0SA 3VRZA 5A0DA 3DB3A 4M7DD 1VQLA 1PKSA 3OBWA 3OYHA 4IUTA 4XU3A 2D0NA 5GANd 3CCRA 2DJQA 2QDYB 1IO6A 3QZ5B 5IH2A 4C8QC 2ODCI 4BACA 1MV3A 2JJ9A 3L2ZA 4J9FA 1YITA 1BIBA 2K9GA 4OP0A 1VQ7A 1RAFB 3OS1A 2E65A 2OTLT 3VS1A 1ABOA 4M7DE 2QNCA 1TH7A 3RESA 4EMKA 3AHUA 2OTJT 1V76A 4HCZA 4ZTFA 2JZ2A 3I55Q 3A8GB 1K73C 1WXUA 2FB7A 3P8DA 1GL9B 4XQ3A 3OYMA 3RIRA 2LQNA 1TUDA 1VQLQ 3HHTB 3QSUA 1FMKA 1RLPC 1IGQA 3CCRQ 2KVDA 2LP5A 1QVFA 4J6XA 4OB2B 2OI3A 2HJQA 3LW5E 4EIKA 1VQ7Q 1NM7A 2X3WD 2QEXQ 1CKBA 1PHTA 4WCIA 1WXTA 4PFOA 4C5HA 4A4GA 1JEIA 2DEUA 3EGUA 2HMAA 2JM8A 3V7RA 5GAOq 4A63B 5KYYB 3CCJA 2EGAA 4C8QE 1X6BA 3QJYA 3G71A 1K76A 4QVCA 1UG1A 1Q81U 4JJBA 3WVEB 1WQWA 3A5ZB 3BDUA 1H1JS 1OX9A 2LNHB 3TSZA 4PJOA 2BKDN 5ECAA 2QDLA 1D3BA 3UATA 3A98A 3OSVA 2JS0A 2DK3A 2RMOA 2F2VA 2RI2A 4K11A 3GIBA 3CCJQ 2E64A 3G71Q 2MPXC 3OS2A 4MMLA 2QQRA 4ESRA 2RM4A 7AT1B 2ESWA 2QG9B 1Y71A 3N5BB 1I4K1 3OYJA 1K0XA 2RK2A 1V1CA 4JUVA 4JRPA 2ROLA 2CSQA 1NYFA 2AT1B 5J26A 2QQBA 4KGXB 1IHVA 3I35A 2HAXA 2COWA 4B9XA 3E19A 1I0CA 4J9IA 3CCST 4JZ4A 4BDYA 4X1VA 3JB9I 3OS5A 1WHGA 4FYWB 2QEXT 3LYIA 1M2OA 5GMKl 2KR3A 2KAFA 2B8AA 1LPLA 2CUDA 1QKXA 4IIMA 2RB6A 1ABQA 2PZ1A 1Y07A 2KVQG 4PLLA 1MNDA 1NJIC 1KHIA 1EIFA 2ZGWA 1VOMA 2FO0A 3EGXA 3MP6A 2DEQA 4L59A 4KH1B 1GCQC 4IIOA 2K3BA 2FRWA 2DXCA 3NFCA 5GANe 3QBYA 1BK2A 2LJ0A
chains in the Genus database with same CATH topology
4ZGDB 5LJ5g 1M9SA 1W4SA 4F7UF 1HK9A 3JCMX 3X26B 3CCJT 4M7AD 4E7JA 1VQ9T 3G71T 1VQOA 3CCUT 1G3SA 2M16A 5LJ3e 4MDXA 3P8BB 4M78F 3KUFA 4DOVA 5HY6A 3HRTA 5I21A 1Q81C 3FIFA 3FRNA 3M4YA 5CKFA 2X4XA 4NOYA 3M56A 4L6V5 5LJ3h 3CCUA 1VQ9A 2K57A 4M77C 4F7UA 3CC2T 3G7ZA 4J7FA 2F5TX 3GP8A 1VQ8T 3RKYA 4M78A 3HRUA 2VXEA 5GANf 2P0PA 3CC2A 2V8KA 4IUUA 2HQEA 5FU7B 2K3YA 3LWIA 1VQ8A 3M55A 3PIPA 2CS7A 1BIAA 5GMKi 3GPLA 4C92F 3S3OA 1W2BS 5I2SA 5IT9E 1VQNA 4M7AE 5LJ3f 2CGHA 2DZ9A 3BDLA 1OI1A 3CCVT 3L2UA 1FXXA 3RKWA 2KK4A 3CMEA 1JRIA 3CCMT 3VUZA 4LDVA 2DXUA 3JRZA 1QW1A 2LTOA 1DJ7B 4M78C 4PNOA 4C92A 5GAOn 3CCVA 3A8MB 4FSXA 4JLGA 5CO7A 2ZPFB 1FX7A 4IUQA 2QQ9A 5HK3A 4HA8A 3CCMA 5CIUA 2XK0A 3URGA 3VJPA 1B34B 4M75D 4QW2A 3JCMQ 1M90C 2V8JA 2XU8A 2P4TA 1Y96A 2EIFA 1XQHA 2RHXA 3Q1JA 1VQ4T 4M77G 1N9RA 2RHUA 2QA4T 1YI2A 2E6NA 4C92C 3ER0A 2KMTA 3SB2A 3JSCA 3CCET 4PJOB 3FLGA 1VQ4A 1AHJB 3L42A 2QA4A 2YLCA 4RMOA 2VXFA 2DIGA 1KD1C 1D3BB 1KQSS 2RHYA 3MCAB 3JCMc 4M7DB 5D6WA 5CVIA 2FYKA 4M75E 2K5IA 3QDRB 2A7YA 2QI2A 3M59A 4EDUA 2CZ1B 1KD1U 2EJFA 2GFUA 2YHTA 1UGPB 4LDUA 2DJZA 3C94A 4F7UG 3SDZA 5A0GA 4RCBA 1U8RA 1UB4A 2DTIA 3UWNA 4M78G 2MAMA 3UPUA 3LGLA 2KY9A 4X34A 2RK1A 4FIBA 3G4ST 1N27A 3LH0A 2ZPBB 4C0ZA 5HK0A 3INZA 4RG2A 4XTZA 5CCAA 4BE2A 4XTXA 2CZ0B 3MEUA 5GMKj 3V8LA 1Q82U 3TEEA 4BY6C 2EQJA 2VUBA 4C0FA 4JRQA 2ZZDA 4FT2A 3M58A 4XU0A 2R57A 5LJ3g 3VYGA 2XDBA 2E12A 2QQAA 4OB3B 5EG2A 4C92G 2LX9A 1BYMA 3GF5A 5KH6A 2KSSA 5AYFA 1XNIA 2M1HA 4OB1B 2K2VA 3ZBDA 4F7UE 4M7AA 1KG1A 1K9MU 4M78E 1N9SA 3HPWA 4Y28E 3PTAA 4VUBA 2DKGA 3DKMA 3F70A 1Q7YU 3RUXA 4A4HA 2EFIA 2LVMA 3G6ET 1R8OB 3MEVA 3KXTA 4P5NA 5GAN8 1G3YA 1YJWA 3JB9D 1K8AC 2HNIA 3TREA 4Z02A 3PMTA 1I81A 4JS5A 2LT4A 1QVGS 3OSSC 2XDDA 1O75A 2LRQA 3EAEA 4R56A 1JJ2S 4M7AC 2LT1A 2YLBA 2DPPB 3V7SA 2X4YA 3CBMA 4A4EA 4ZN3A 2KDSA 3OQ5A 3JAME 2IG0A 2HBPA 3OBYA 3RMQA 1U1TA 3M5AA 4TVRA 2XIDA 3X28B 2FVUA 4L5GA 3CC7T 2O4XB 1WQ7A 4BUGA 3NTKA 2Y4YA 3L2RA 3OYEA 3CC7A 3CXCS 2VGMA 5LJ3d 1YCYA 1JBMA 4FM4B 5CKDA 3KBGA 5D6YA 4M75A 4XTUA 1ZQ1A 4RCCA 5IAYA 3META 1LNXA 2EQKA 3OYAA 1KQ1A 3MEWA 3QXEB 5FROA 5GMKe 5GAMj 2MWOA 2E41A 1JB0E 1W2BA 1PSFA 1KC8U 1YJNA 2QXFA 3S3NA 2XI9A 5GMKh 2K5LA 2ZPGB 3A8OB 4N4HA 2FL7A 2RHZA 1QP2A 2DO3A 3CMAT 2FHDA 4E7HA 4J83A 4ATOA 4O5VA 3PGGA 3CMAA 3PMIA 4M7AG 3CBPA 4M75C 4OVAA 5KE3A 1RL2A 5GAN5 5GANh 2RA2A 2CKKA 3UT1A 1MGQA 1I8FA 4BE0A 4YTLA 1VIEA 1K73U 2QQSA 2LDMA 2CZ6B 2F5KA 2LNVA 4N0AA 3FB9A 5GMKm 3TU4K 4B9WA 3QG1A 4R55A 1BI1A 3FDRA 3OYYA 2C06A 2PUOB 4LDXA 4C8QD 3JCMJ 4QQ6A 2YRVA 2BIVA 4C0DB 1KQSA 1VQ5T 3T9NA 1VQNT 1H641 2E1HA 4FL6A 3JCMe 2PVOB 4MZTA 1VQ5A 2EWNA 2JTFA 3JCMh 4BD3A 2K3XA 5J39A 2OAUA 4N0AC 2JVVA 4M77B 3CMET 2D9TA 2I2LA 5I2MA 3OY9A 1Q82C 1XOVA 2PQWA 2K4YA 4J7IA 1NE8A 4C8QE 3CPFA 2E70A 5FU7C 4HT9A 3X24B 2DIQA 2DVEA 4M75G 3OYIA 3QZ9B 5DM7R 4FT4A 3M54A 3JCMf 1P92A 5LJ5j 3RERA 2M9UA 5CKEA 5GAMe 2P0QA 4MMKA 4F7UB 1QVFS 4M7DF 2EQUA 2RJFA 1YI2T 2XD0A 5GAMh 5GAN4 4M78B 3VYHB 2XKOC 3VV0A 2LQ8A 1M1KU 2R58A 1O9SA 1UGQB 2CZ7B 4M7DA 1X01A 1M1FA 2ZCFB 3M53A 4A4FA 5KE2A 3HKSA 4QQGA 5KCHA 3J80E 5CQXA 3HFNA 3TCJA 3VKIA 2DTHA 1FWZA 3OMCA 4X9CA 5GAMf 4PLIA 3X25B 3OYKA 4DOWA 3JB9H 1PSEA 4C92B 3LGFA 3OW2A 4KULA 2VYTA 1NZ9A 3ME9A 1N6AA 3PFSA 4HKEA 1WJSA 1BKBA 1SSFA 2GCXA 2XHCA 4LDYA 3V8KA 4C5IA 4NL2A 4A4KA 4BDZA 1QVGA 1JJ2A 3CD6A 4M7DC 2WSCE 5IN1A 2MWPA 3GNFB 2E6ZA 5C6SA 4LD9K 2HQXA 5GANg 1Y96B 4PKCC 3MO8A 2XICA 2RH2A 4CI0C 2WSEE 3JCMP 4MZMA 1HXDA 3SFMA 4C0GA 4LD6A 4QVZA 1BI3A 2X4JA 5CKHA 3X20B 4JJNK 4ZTJA 3QO3A 3VUBA 5GAOp 1Q86U 3DLLA 3C12A 1K9MC 3SWNA 4XTVA 3CC4T 1OYXA 5A2QE 1VQ6T 3CXCA 5GAN7 1QVPA 1Q7YC 2IVWA 2M0OA 2A3LA 1M1GA 1NPRA 4JRKA 4OGEA 4C8QF 5GAOl 3CC4A 1VQ6A 2DXBA 1WPYA 4BY6B 4XAXB 4JS4A 1N8RU 1BI0A 4J5YA 5HKCA 4KUIA 5LJ5e 3JCMg 4BE1A 2GQVA 4QQDA 2DZCA 3ASKA 4E47A 1YJWT 5LJ5h 3JB9G 3I55T 1G3TA 3WVDB 1UEBA 1Y7XA 4C8QA 3OW2S 4ELZC 3SWNC 4OGCA 2F69A 4HCCA 4PJOD 3I55A 1G3WA 1S72A 3PT9A 3QYGB 3V8JA 3HSBA 4MDWA 1VQLT 4N4IA 5D6XA 2ZPIB 2EYQA 5A0DA 5J3BA 3DB3A 3CCRT 5FRNA 1VQLA 4M7DD 3CBOA 2XG8D 3OBWA 2O4XA 4JRIA 4LDWA 3OYHA 2KQWA 4IUTA 4XU3A 5LJ5f 5GANd 4GY5A 3CPWA 1OZ2A 3CCQT 3CCRA 2QDYB 3OYCA 3QZ5B 5GAMg 4C8QC 1YITT 4BACA 2DD4A 4M7AB 3CCQA 1V29B 1VQ7T 3L2ZA 1YITA 4PJOE 1BIBA 1KC8C 3P8HA 1YIJT 2XDPA 4OP0A 1VQ7A 4RG8A 1X6OA 3OS1A 2E65A 4O6JA 1LOJA 2EJ9A 3MHXA 1YJNT 2OTLT 1TH7A 3RESA 1YIJA 2LCLA 4M7DE 3LWHA 4EMKA 3AHUA 1M5Q1 2EJGA 2OTJT 4IUPA 4IUVA 3VU3C 2OTLA 4HCZA 1ZHIA 4ZTFA 2JZ2A 1IREB 3JCMd 2OTJA 3A8GB 2Y4XA 1K73C 2FB7A 3P8DA 4OF1A 3J7AF 5FU6B 4XQ3A 3C95A 3RIRA 3OYMA 3HFOA 2Y90A 2V8IA 5CAIA 1YHQA 4D6WA 1M4ZA 2RO0A 4A54A 4DA4A 3HHTB 3C4SA 3MP1A 3QSUA 5M9OA 2LC4A 2PU9B 3M4GA 4EMKC 4RKUE 3CPWS 4J6XA 1QVFA 4OB2B 3QJ6A 3WXMB 4C8QG 3PNWC 4M77F 3M9QA 4UC4A 2VV5A 3DLMA 2PUKB 4M75B 4DQ2A 3LW5E 5GAMd 1KQ2A 2JN0A 2QTXA 2EKOA 4BI8B 2RJCA 2D0QB 4Q5WA 3FC3A 4IKFA 4C5HA 4A4GA 2L5QA 3OYFA 2E10A 1ZBXA 2ZPHB 3A8HB 4EMHA 4V2SA 4C0DC 1IZ6A 3V7RA 5GAOq 3CCJA 1B34A 2H3JA 2PVGB 3FEOA 3GLXA 3QJYA 2LQKA 4J6YA 4PL6A 4XU2A 3UDCA 3G71A 4PJOF 3ZEHA 4QVCA 3R6OA 4OMFB 1WGSA 1Q81U 1OZ3A 1M1KC 5CR2A 2MF2A 2RHIA 3WVEB 1WQWA 3A5ZB 3BDUA 4CRIA 2VC8A 3BFMA 3RMSA 2DXTA 4PJOA 2BKDN 2PVDB 4QVDA 1BI2A 3H6ZA 1D3BA 5FRMA 4XTYA 3OA6A 4A53A 5C0MA 3OYNA 3OYLA 1VQMT 3JB9J 2GFAA 3NTIA 3OSVA 2CYZB 1XTDA 2NLUA 3MEAA 4HT8A 1VQMA 3LX7A 2DK3A 1WJRA 2RI3A 2X35A 3HRSA 4ELYC 1G5VA 2JTMA 4C5EA 2AHJB 4PJOC 1VIFA 3CD6T 2RI2A 4E7LA 2LCCA 3GIBA 4JLIA 1VQPT 2E64A 5LJ5d 3OS2A 3OYGA 1H3ZA 3OMGA 4BI3A 1GXIE 2R5AA 5GAOr 3L2VA 1VQPA 5DY9A 4MMLA 3CCLT 3V7CA 1YJ9T 1Q86C 2L8DA 3QKJA 3L1AA 2QQRA 2MMPA 4GLKA 3GOXA 1M90U 4M77D 2E5QA 3EFRA 2RM4A 3E9FA 2JNGA 1NJIC 1YJ9A 3CCLA 4J6WA 4E7KA 3CCEA 1Y71A 3N5BB 1I4K1 3OYJA 3ZFJA 2K5FA 3S3MA 1M8VA 1UGSB 1N8RC 2ZPEB 3BW1A 2RK2A 3E9GA 4JDSA 2L89A 2RJDA 2JUFA 4JUVA 4MZPA 4N4GA 4EMGA 4JRPA 3JCMb 3H8ZA 3BY7A 3OB9A 5GAN2 3J81E 5J26A 2QQBA 4M77E 1X75C 4ZGEB 4E7IA 2WSFE 4M78D 4ZN1A 4ME7A 4PJOG 3OYDA 1S72T 2MI6A 3QPHA 5DLQE 1I5LA 2HAXA 3G4SA 1U1SA 2VGNA 4B9XA 3E1SA 4KT0E 1LJOA 5CK9A 4KUDK 1NPPA 4M7AF 4M7DG 4BB7A 1WNLA 3L2WA 2WACA 4XK8E 2BUDA 3E19A 4NL3A 3EFSA 5LL6S 4X9DA 3CEYA 5GAN3 5GANj 1KHCA 4NS5A 4WF2A 5KCOA 4XU1A 4C92D 2O01E 3SWNB 3JB9F 3PIOA 3QIIA 4ZGJB 3CCST 5DLOA 3SD4A 2DTOA 4BDYA 3L2QA 3QHSA 5LJ3j 1VQKT 3OS0A 3JB9I 3OS5A 3CCSA 3MP8A 3HL8A 4HCBA 2QEXT 3LYIA 1VQKA 1QP3A 1VUBA 3RKXA 2L3RA 5GMKl 3G6EA 2KAFA 2B8AA 2QEXA 1MHNA 4C8QB 1RI0A 5CKBA 3O8VA 4IURA 2RB6A 3A8LB 4C92E 3QYHB 1Y07A 2KVQG 1K8AU 3FJPA 4PLLA 2EQMA 1YHQT 4C5GA 2JOYA 2DD5A 3QUIA 2RI5A 5GAN6 5GAOm 4M75F 3LLRA 3DB4A 2GF7A 3NTHA 1KHIA 1UGRB 1EIFA 2P0KA 3GNGA 2ZGWA 2G3RA 5A0LA 2HD0A 5L8RE 2DAQA 1NJIU 3JCMW 1WJQA 5FLXE 4XTWA 5FU6C 4EPCA 2RJEA 3MP6A 4J8OA 2DEQA 3OYBA 4L59A 3I56T 4II1A 4Y91A 2EAYA 3S6WA 3M57A 4BI4A 1YBYA 3I56A 2RD1A 4EMKB 4FU6A 3HP9A 4M77A 4KBMB 2X4WA 2DXCA 3NFCA 5GANe 3JCMV 2R5MA 3QBYA 5CQYA 2D6FA 4OB0B 1VQOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYX A;  3LX7 A;  1WJR A;  2RI3 A;  2X35 A;  2O4X B;  4E7J A;  3NTK A;  2M0O A;  2M16 A;  1G5V A;  3KUF A;  4C5E A;  3L2R A;  3OYE A;  2X4X A;  2RI2 A;  4E7L A;  2LCC A;  4BE1 A;  5D6Y A;  4QQD A;  3ASK A;  3OS2 A;  5IAY A;  3MET A;  3OYG A;  1H3Z A;  3OMG A;  2EQK A;  3OYA A;  3MEW A;  5FRO A;  2R5A A;  3L2V A;  2MWO A;  4IUU A;  2HQE A;  3S3N A;  2K3Y A;  2L8D A;  3QKJ A;  2QQR A;  4N4I A;  2RHZ A;  4N4H A;  3GOX A;  2E5Q A;  2FHD A;  5D6X A;  4E7H A;  3S3O A;  3E9F A;  5FRN A;  3DB3 A;  4E7K A;  3OYJ A;  2O4X A;  3BDL A;  1OI1 A;  3PMI A;  4IUT A;  3OYH A;  4OVA A;  5KE3 A;  3L2U A;  3S3M A;  4GY5 A;  1OZ2 A;  3OYC A;  2CKK A;  3UT1 A;  2LTO A;  4BE0 A;  3E9G A;  4BAC A;  2L89 A;  2QQS A;  2RJD A;  4N4G A;  4IUQ A;  2LDM A;  2F5K A;  5CIU A;  2XK0 A;  4B9W A;  3P8H A;  3H8Z A;  3OB9 A;  2XDP A;  3FDR A;  4QW2 A;  5J26 A;  4E7I A;  3OS1 A;  3OYD A;  4QQ6 A;  2YRV A;  2BIV A;  2RHX A;  3Q1J A;  2RHU A;  4IUP A;  4B9X A;  2E6N A;  4IUV A;  4FL6 A;  4HCZ A;  4ZTF A;  2JZ2 A;  3FLG A;  2JTF A;  3L42 A;  3L2W A;  4BD3 A;  2K3X A;  2WAC A;  2BUD A;  2DIG A;  3P8D A;  5J39 A;  2RHY A;  2D9T A;  3CEY A;  3OY9 A;  3OYM A;  1KHC A;  2PQW A;  5D6W A;  4NS5 A;  5KCO A;  2RO0 A;  3C4S A;  3MP1 A;  4EDU A;  3QII A;  2GFU A;  5M9O A;  3SD4 A;  2DIQ A;  4BDY A;  3L2Q A;  3OYI A;  3OS0 A;  3QJ6 A;  3MP8 A;  3UWN A;  3PNW C;  3LGL A;  3LYI A;  3M9Q A;  4UC4 A;  3DLM A;  4X34 A;  1N27 A;  2EQU A;  2L3R A;  2RJF A;  3LH0 A;  2B8A A;  4RG2 A;  4BE2 A;  1MHN A;  3MEU A;  1RI0 A;  2EKO A;  2RJC A;  3O8V A;  4IUR A;  2R58 A;  2EQJ A;  4Q5W A;  3FC3 A;  4IKF A;  2R57 A;  4C5H A;  4PLL A;  4A4G A;  2EQM A;  4A4F A;  5KE2 A;  4C5G A;  3OYF A;  4QQG A;  5KCH A;  2RI5 A;  3LLR A;  3DB4 A;  2GF7 A;  3NTH A;  5KH6 A;  1XNI A;  2M1H A;  2P0K A;  3OMC A;  4PLI A;  2G3R A;  3OYK A;  3LGF A;  4PL6 A;  2DAQ A;  3FEO A;  2VYT A;  1WJQ A;  3F70 A;  3ME9 A;  3ZEH A;  3PFS A;  1WJS A;  4C5I A;  1SSF A;  2RJE A;  3MP6 A;  4A4H A;  2EFI A;  2LVM A;  4BDZ A;  1WGS A;  3MEV A;  1OZ3 A;  4ZTJ A;  2RHI A;  2MWP A;  5IN1 A;  5C6S A;  3OYB A;  4L59 A;  4II1 A;  2HQX A;  4CRI A;  4Z02 A;  3PMT A;  3S6W A;  2BKD N;  2LRQ A;  3EAE A;  3MO8 A;  3H6Z A;  4FU6 A;  5FRM A;  2X4Y A;  3OA6 A;  4LD6 A;  4QVZ A;  2X4W A;  4A4E A;  5C0M A;  3OYN A;  2GFA A;  3NTI A;  3OQ5 A;  3OYL A;  2R5M A;  3QBY A;  2IG0 A;  3MEA A;  2NLU A; 
#chains in the Genus database with same CATH topology
 5LJ5 g;  1W4S A;  3CCJ T;  1X69 A;  3G71 T;  3CCU T;  2M16 A;  5LJ3 e;  3FJ5 A;  1Q81 C;  3KUF A;  3ZL7 C;  1T0H A;  4FYX B;  3G1J A;  4NOY A;  2ATC B;  2LZ6 B;  4L6V 5;  1AZG B;  4GLM A;  4M77 C;  4F7U A;  3CC2 T;  2YUO A;  2F5T X;  3RKY A;  4M78 A;  2VXE A;  2DL7 A;  4E7S A;  2V8K A;  1LVK A;  2BE9 B;  3PIP A;  5GMK i;  2HDA A;  2CGH A;  2DBM A;  3CCV T;  3CME A;  3CCM T;  2M02 A;  3M0U A;  2DXU A;  3JRZ A;  2RQW A;  4HVU A;  3A8M B;  4FSX A;  3JB9 F;  4HA8 A;  1B34 B;  4M75 D;  3JCM Q;  1ZSZ A;  2P4T A;  2QAS A;  2P84 A;  3Q1J A;  1N9R A;  3LH5 A;  3JSC A;  1RAB B;  1VQ4 A;  2QA4 A;  2YLC A;  4RMO A;  2DYB A;  2RHY A;  4M75 E;  2QI2 A;  3M59 A;  4GBQ A;  4AFS C;  2GFU A;  2A8V A;  1T3L A;  3CME Q;  2LQW A;  1TWB A;  5A0G A;  2EYW A;  4X34 A;  2RK1 A;  1BU1 A;  3INZ A;  4RG2 A;  4XTZ A;  2KRS A;  2O9V A;  3TEE A;  2EQJ A;  2KT1 A;  2R57 A;  2E12 A;  2HKQ B;  4OB3 B;  4C92 G;  1VQ4 Q;  1BYM A;  3GF5 A;  3VS4 A;  4WTO B;  2KSS A;  2QA4 Q;  1XNI A;  2K2V A;  2O31 A;  4RTU A;  4OMM A;  1N9S A;  3PTA A;  4VUB A;  3DKM A;  4HVW A;  3RUX A;  2LVM A;  2HNI A;  3TRE A;  3EAE A;  4M7A C;  2HSE B;  4A4E A;  1T0J A;  4TVR A;  5IHK A;  2DMO A;  3NTK A;  1WI7 A;  4AG1 C;  2Y4Y A;  2AK5 A;  4XTU A;  2EQI A;  3OYA A;  5FRO A;  1PSF A;  2MCN A;  3S3N A;  1YJN A;  5GMK h;  2ZPG B;  1ZUY A;  2RHZ A;  4O5V A;  2DYI A;  2SEM A;  2RA2 A;  5KYY A;  1MGQ A;  4BE0 A;  2DNU A;  2CZ6 B;  2F5K A;  2LNV A;  4KH0 B;  3TU4 K;  1WIE A;  3QG1 A;  4R55 A;  3QWX X;  1VA7 A;  3OYY A;  2KFV A;  2PUO B;  4QQ6 A;  2YRV A;  3CPW P;  2KVU A;  2BIV A;  1MNE A;  2PVO B;  3E2U A;  1YJN Q;  2EW3 A;  1C6V X;  2OAU A;  3CME T;  2D9T A;  2I2L A;  1XOV A;  2JS2 A;  2K4Y A;  1NE8 A;  3CPF A;  2E70 A;  5FU7 C;  1BCM A;  1TS9 A;  1K4U S;  2FPE A;  3M54 A;  1P92 A;  2M9U A;  5GAM e;  2GNC A;  2DL8 A;  2EQU A;  2LQ8 A;  2QAZ A;  2CZ7 B;  2EGE A;  5KE2 A;  3HKS A;  1WXB A;  3J80 E;  5CQX A;  3VKI A;  3OMC A;  3X25 B;  3OYK A;  2KBT A;  3JB9 H;  1YN8 A;  4C92 B;  3LGF A;  2DF6 A;  4HKE A;  3PFS A;  1WJS A;  1BKB A;  2XHC A;  4C5I A;  2H8H A;  4NL2 A;  2WSC E;  4LD9 K;  2E6Z A;  2HQX A;  1TTH B;  1C1A A;  3I5R A;  3QDF A;  2DL3 A;  2XIC A;  1D0Y A;  2V1Q A;  2RH2 A;  4CI0 C;  2WSE E;  1HXD A;  5CKH A;  4ZTJ A;  1KSW A;  5GAO p;  3DLL A;  1VQ6 T;  5A2Q E;  2IVW A;  1M1G A;  2EVR A;  1WPY A;  5LJ5 e;  2COZ A;  3JCM g;  1SRM A;  4M4Z A;  2CSI A;  1K8A R;  5EC7 A;  4BIT A;  1PD1 A;  2RQU A;  4PJO D;  1G3W A;  3QYG B;  3V8J A;  1ZX6 A;  1OX8 A;  2KVE A;  3O5Z A;  2OAW A;  4LUE A;  3EH2 A;  3CBO A;  1WYX A;  2O4X A;  1YCS B;  1OZ2 A;  2DRM A;  1I07 A;  2LMJ A;  2KI7 A;  1V29 B;  1OU8 A;  5FWC A;  4DBR A;  1MMA A;  4PJO E;  3P8H A;  1YIJ T;  4PJM A;  4D8D A;  4RG8 A;  1X6O A;  1YJN T;  3MHX A;  4AMC A;  2VKN A;  5IXB A;  4JJC A;  2OTL A;  1ZHI A;  2PTK A;  3JCM d;  2OTJ A;  3J7A F;  3BE3 A;  4OF1 A;  2L2P A;  3HFO A;  4D6W A;  3C4S A;  4J9G A;  2LC4 A;  3M4G A;  2LJ3 A;  1R77 A;  3CPW S;  3WXM B;  4C8Q G;  3PNW C;  2VV5 A;  4DQ2 A;  1K1Z A;  1ZUK A;  2G80 A;  2O9S A;  2RJC A;  2VB6 A;  4Q5W A;  3FC3 A;  2QTV A;  2OTL Q;  3OYF A;  2E10 A;  1SKU B;  2AZS A;  2OTJ Q;  1D0Z A;  1IZ6 A;  1X43 A;  1JU5 C;  1B34 A;  2H3J A;  3GLX A;  4PL6 A;  1AWO A;  1MMG A;  4XU2 A;  4PJO F;  3R6O A;  5CR2 A;  4CRI A;  1RAG B;  3RMS A;  1EFN A;  2NYS A;  3H6Z A;  2HBW A;  5HCK A;  2AZV A;  3OA6 A;  4A53 A;  5C0M A;  3OYL A;  3NTI A;  2EKH A;  2CYZ B;  1XTD A;  2NLU A;  3MEA A;  1WJR A;  4HXJ A;  2X35 A;  1R0B G;  2AHJ B;  1TSF A;  1E7L A;  2K6D A;  2LCC A;  4JLI A;  4Z88 A;  3OYG A;  1GXI E;  5GAO r;  3L2V A;  2VVK A;  3V7C A;  2L8D A;  1IGU A;  3GOX A;  1RAA B;  2YT6 A;  2JNG A;  2KYM A;  3ZFJ A;  1UGS B;  1Q7Y R;  2VWF A;  3E9G A;  1BCO A;  1QLY A;  2NUZ A;  1U06 A;  4HVV A;  2YWW A;  3BY7 A;  1F1B B;  4ZGE B;  1X75 C;  4M78 D;  4ME7 A;  3OYD A;  3QPH A;  1I5L A;  1HSQ A;  2VGN A;  3E1S A;  1NPP A;  1UHC A;  3CEY A;  4X9D A;  5GAN 3;  4OMN A;  1KHC A;  4NS5 A;  5KCO A;  1ZA2 B;  2O01 E;  3HTR A;  3QII A;  5DLO A;  5KYU A;  3L2Q A;  3QHS A;  1TUG B;  2JW4 A;  1VQK T;  3OS0 A;  3CCS A;  3THK A;  3RKX A;  2L3R A;  2QEX A;  4C8Q B;  3O8V A;  4IUR A;  1K8A U;  1UEC A;  2EQM A;  2DFU A;  4C5G A;  1QVG P;  2A0F B;  5GAO m;  5GAN 6;  3C0C A;  3DB4 A;  4B6M A;  1UGR B;  1EX4 A;  2P0K A;  2G3R A;  1NJI U;  1WJQ A;  5FLX E;  1QMC A;  3CCS Q;  3OYB A;  3I56 T;  4II1 A;  1OUL A;  4Y91 A;  3CXC P;  2HQH A;  1YBY A;  2ABL A;  3JCM V;  2R5M A;  2GBQ A;  1WFW A;  1QWE A;  4DEX A;  4F7U F;  2F1L A;  4FCY A;  2JM9 A;  4MDX A;  4M78 F;  5I21 A;  3HRT A;  5CKF A;  3M4Y A;  5LJ3 h;  3CCU A;  2LCS A;  1M1K R;  5IXF A;  4J7F A;  1VQ8 T;  1RUW A;  4OMO A;  5GAN f;  2P0P A;  3CC2 A;  1B3Q A;  3LWI A;  1E6H A;  4DBQ A;  1VQN A;  5LJ3 f;  1SHF A;  1UDL A;  2DZ9 A;  1OI1 A;  1UHF A;  1JRI A;  5GAO n;  2MPH A;  4PNO A;  4C92 A;  3CCV A;  3CCM A;  2QQ9 A;  3URG A;  3VJP A;  1N5Z A;  4QW2 A;  3CCU Q;  2GTJ A;  1Q86 R;  2EIF A;  1ARK A;  2RHX A;  4M77 G;  2RHU A;  1YI2 A;  1WHH A;  3CC2 Q;  5KYN A;  1QVF P;  3FLG A;  1AHJ B;  2OX7 A;  3CQT A;  3L42 A;  1KQS S;  2VXF A;  4ANJ A;  2FZG B;  3IQL A;  1VQN Q;  2KRN A;  4OML A;  2FYK A;  3QDR B;  2CZ1 B;  2YUQ A;  1TU0 B;  2MOX A;  3CCV Q;  2RNN A;  2DTI A;  3CCM Q;  1AEY A;  3TSW A;  3LGL A;  3R6N A;  2KY9 A;  3EG2 A;  4FIB A;  1N27 A;  3LH0 A;  2ZPB B;  4C0Z A;  5HK0 A;  4BE2 A;  3MEU A;  3REB B;  2AIR B;  4C0F A;  2IPO B;  2NUT B;  1YI2 Q;  4FYY B;  2LX9 A;  2QK0 A;  2M1H A;  2AKK A;  2RQR A;  1RAI B;  4J9H A;  1YP5 A;  3HPW A;  2DKG A;  1A63 A;  1Q7Y U;  2EFI A;  2JMC A;  3KXT A;  3JB9 D;  1K8A C;  1SG5 A;  4Z02 A;  3M0T A;  3UA6 A;  1QVG S;  1JJ2 S;  2XDD A;  4R56 A;  2D1X A;  2DLP A;  2DPP B;  3CBM A;  2NWM A;  3OQ5 A;  3RBB B;  2EYY A;  3RMQ A;  2DE0 X;  3X28 B;  2GGR A;  2FVU A;  1PC0 A;  3CC7 T;  2O4X B;  1WQ7 A;  4BUG A;  1K9A A;  2IIM A;  3OYE A;  3L2R A;  3CXC S;  2VGM A;  3CC4 Q;  2E4H A;  4FM4 B;  5CKD A;  2KEA A;  4JZ3 A;  2KE9 A;  4RCC A;  3MET A;  3MEW A;  3QXE B;  2MWO A;  1W2B A;  2CUB A;  2XI9 A;  2DM1 A;  4PJJ A;  3M0Q A;  3A8O B;  2DO3 A;  3CMA T;  1NEG A;  3EG9 B;  3PMI A;  4M7A G;  3CBP A;  4M75 C;  5GAN 5;  2BZY A;  1I8F A;  4YTL A;  1VIE A;  2QQS A;  4F04 B;  2LDM A;  4J9C A;  3FB9 A;  5GMK m;  4B9W A;  1UFF A;  1BI1 A;  3FDR A;  1C0M A;  2L3S A;  2C06 A;  4LDX A;  5FWB A;  1LCK A;  1RAE B;  4C0D B;  2X51 A;  1VQN T;  1ZLM A;  2E1H A;  4FL6 A;  4MZT A;  1PD0 A;  2K3X A;  5J39 A;  4N0A C;  4M77 B;  4J7I A;  3I9Q A;  2CT3 A;  2C0T A;  4HT9 A;  2DIQ A;  2RQT A;  5CKE A;  2EBP A;  2P0Q A;  2KXC A;  1QVF S;  1YI2 T;  5GAM h;  2ODG C;  3L0O A;  3VYH B;  1V66 A;  1U5S A;  1M1K U;  1KD1 R;  2A37 A;  4M7D A;  2H3E B;  1HD3 A;  2ZCF B;  1YNZ A;  5KCH A;  1A0N B;  1QWF A;  2DTH A;  4QKU A;  1GCP A;  4X9C A;  5GAM f;  2VYT A;  1NZ9 A;  2MIO A;  3ME9 A;  5GAN 8;  3V8K A;  5IN1 A;  2MWP A;  3GNF B;  1Y96 B;  3JCM P;  2DA9 A;  4MZM A;  4C0G A;  4LD6 A;  3X20 B;  3A1P A;  3QO3 A;  1Q86 U;  2W0Z A;  3MJX A;  4J9E A;  3CC4 T;  1Q7Y C;  2KYB A;  2M0O A;  1FMV A;  1OEB A;  2A3L A;  2DL5 A;  1B7T A;  3REA B;  1VQ6 A;  1W1F A;  2DXB A;  4Y92 A;  4D8K A;  4JS4 A;  2CP0 A;  4BE1 A;  1D1B A;  2DZC A;  4E47 A;  5LJ5 h;  1QKW A;  3VS2 A;  3WVD B;  1Y7X A;  4C8Q A;  3SWN C;  2F69 A;  2CP2 A;  1I1J A;  4MDW A;  3U23 A;  5L23 A;  1NG2 A;  1TG0 A;  2AKL A;  4FYV B;  4KGV B;  2CP3 A;  2I0N A;  2EYQ A;  5FRN A;  3GBQ A;  3EH1 A;  2XG8 D;  2YRD A;  5LJ5 f;  2KRO A;  3CPW A;  4GY5 A;  3CCQ T;  3UA7 A;  2JTE A;  3OYC A;  5KYX B;  4M7A B;  5GJV B;  4PFZ A;  5KYU B;  1VQ6 Q;  2XDP A;  2MYS A;  2HZY A;  1A8V A;  2EJ9 A;  1YIJ A;  2LCL A;  1M5Q 1;  2EJG A;  4IUP A;  1OPL A;  2Y4X A;  5FU6 B;  1E7O A;  1IHW A;  2V8I A;  1NYG A;  4F14 A;  1YHQ A;  4JJD A;  4A54 A;  2PU9 B;  4EMK C;  4RKU E;  5I22 A;  4M77 F;  1H8K A;  2JVW A;  2CH4 W;  3DLM A;  2PUK B;  2HL5 C;  2J05 A;  1KQ2 A;  4BI8 B;  1JXM A;  1YIJ Q;  1PNJ A;  2J6K A;  2L5Q A;  2ZAE A;  2C0I A;  2ZPH B;  3A8H B;  2F2X A;  4V2S A;  1KK7 A;  8ATC B;  1YHQ Q;  1J3T A;  1EZZ B;  3UDC A;  3ZEH A;  3VRY A;  1WGS A;  4RTW A;  1OZ3 A;  1M1K C;  2MF2 A;  1W6X A;  2VC8 A;  4ZNX A;  3NMZ C;  4JPB W;  2K2M A;  1Z9Q A;  1VQM T;  1QQJ A;  1M3C A;  4HT8 A;  2FPF A;  2RI3 A;  3HRS A;  1E6G A;  4ELY C;  3EG1 A;  4C5E A;  1UTI A;  2KNB B;  1Q82 R;  4PJO C;  1VQP T;  4RTV A;  2J7I A;  3OMG A;  4BI3 A;  1AVZ C;  4F17 A;  3CCL T;  1YJ9 T;  1Q86 C;  3QKJ A;  2NUT A;  2K7A A;  4GLK A;  4RTX A;  2W51 A;  2FZK B;  2E5Q A;  3E9F A;  2FZC B;  1K9M R;  3CCE A;  1HYO A;  3S3M A;  1M8V A;  3H0H A;  2ZPE B;  1Y02 A;  1U3O A;  1PM3 A;  2V26 A;  4JDS A;  2RJD A;  2JUF A;  4MZP A;  4N4G A;  4EMG A;  3JCM b;  4LN2 A;  4RTY A;  3J81 E;  4E7I A;  4RTT A;  2DET A;  4ZN1 A;  1S1N A;  2MI6 A;  5DLQ E;  1YWP A;  3G4S A;  1U1S A;  2KW9 A;  4KUD K;  4M7A F;  4M7D G;  4BB7 A;  4F16 A;  5AT1 B;  4XK8 E;  2BUD A;  5LL6 S;  2EGC A;  3CCE Q;  4C92 D;  2QYZ A;  3EG0 A;  3PIO A;  2DTO A;  1KC8 R;  1T3S A;  3MP8 A;  3HL8 A;  4HCB A;  1VQK A;  9ATC B;  2JMA A;  1VUB A;  1MHN A;  1I5O B;  1RI0 A;  3A8L B;  4C92 E;  3G4S Q;  2PNI A;  3EG9 A;  3QYH B;  3FJP A;  1YHQ T;  3EHQ A;  2DER A;  2JOY A;  1RAH B;  3QUI A;  1PCX A;  2DD5 A;  2RI5 A;  5IHI A;  2E3I A;  1GCQ A;  1YFN A;  2ECZ A;  2BZ8 A;  2HD0 A;  4AG2 C;  3JCM W;  4XTW A;  4EPC A;  4J8O A;  1VQK Q;  4BI4 A;  3I56 A;  2RD1 A;  1WHK A;  4FU6 A;  4M77 A;  4KBM B;  2X4W A;  5CQY A;  1VQO T;  3JCM X;  4HCK A;  1VQ9 T;  1OV3 A;  3I5S A;  3P8B B;  4DOV A;  5HY6 A;  2HSP A;  3FIF A;  3M56 A;  2K57 A;  2C0O A;  3G7Z A;  3GP8 A;  3TQ7 P;  3KFV A;  4IUU A;  2HQE A;  1VQ8 A;  5IHN A;  3VS3 A;  1BIA A;  3GPL A;  4C92 F;  5IT9 E;  2QNF A;  3I56 Q;  1X6G A;  1MUZ A;  3BDL A;  3L2U A;  2J6O A;  1FXX A;  3RKW A;  1H3H A;  2P4R A;  3VUZ A;  1BBZ A;  2LTO A;  1SPK A;  4M78 C;  1G8X A;  2A36 A;  2M51 A;  5HK3 A;  2RNO A;  1FX7 A;  4IUQ A;  2NUP A;  1OOT A;  1K0S A;  2V8J A;  2XU8 A;  1Y96 A;  2E6N A;  2KGT A;  2J6F A;  2KMT A;  2RF0 A;  3CCE T;  2L3P A;  1VQ8 Q;  1KD1 C;  2DIG A;  2GTO A;  3PE0 A;  1N8R R;  3JCM c;  2DL4 A;  4KGZ B;  5D6W A;  4E7Z A;  1QCO A;  5CVI A;  4M7D B;  1ZSZ C;  2O2O A;  4DBF A;  2A7Y A;  4LUD A;  1KQS P;  2YHT A;  4PJL A;  1X2K A;  2E5K A;  2GQI A;  3SDZ A;  1U8R A;  1UJY A;  3UWN A;  2W10 A;  2MAM A;  3UPU A;  3G4S T;  1Q82 U;  4XTX A;  5GMK j;  1KIK A;  2YUP A;  4BY6 C;  3H0I A;  4FT2 A;  3M58 A;  4XU0 A;  5LJ3 g;  4RTZ A;  3VYG A;  2ED1 A;  5EG2 A;  5AYF A;  3ULR B;  5KYX A;  4OB1 B;  4F7U E;  4M7A A;  1KG1 A;  1K9M U;  4M78 E;  4QT7 A;  1TXQ A;  1R8O B;  4P5N A;  1GFD A;  1I81 A;  4JS5 A;  1B07 A;  2LT4 A;  3OSS C;  1O75 A;  2WQG A;  2LRQ A;  2YLB A;  3RDV A;  3EFO B;  3RR6 A;  3V7S A;  3OW2 P;  4ZN3 A;  2KDS A;  3PVQ A;  3JAM E;  5D7U A;  2IG0 A;  4LXC A;  1JJ2 P;  1U1T A;  3M5A A;  4CC7 A;  1MMN A;  2XID A;  4L5G A;  3VS6 A;  2YDL A;  1SF9 A;  3CC7 A;  5LJ3 d;  1YCY A;  1PRL C;  1JBM A;  1BB9 A;  2BTT A;  1ZQ1 A;  2DVJ A;  1LNX A;  2MK5 A;  2EQK A;  6AT1 B;  1M3A A;  3VS7 A;  2X3X D;  2RPN A;  1KC8 U;  2QXF A;  2K5L A;  4N4H A;  2FL7 A;  2FHD A;  4E7H A;  1GBR A;  3CMA A;  2ENM A;  5GAN h;  1X27 A;  8AT1 B;  4LE9 A;  4AFZ C;  2V1R A;  5KYW B;  2BZX A;  1NEB A;  3CC7 Q;  1YIT Q;  1ZUU A;  3NHN A;  4C8Q D;  3JCM J;  4PFP A;  1VQ5 T;  3T9N A;  2CRE A;  3JCM e;  2EWN A;  4BD3 A;  2JVV A;  1KJW A;  2DK4 A;  3CMA Q;  2DVE A;  4M75 G;  2JT4 A;  1NLP C;  5DM7 R;  2VAS A;  1M90 R;  2CH4 A;  3RER A;  1JEG A;  4M7D F;  2FPD A;  2RJF A;  2XD0 A;  2B86 A;  1GJJ A;  2LC3 A;  2XKO C;  2D8J A;  1UGQ B;  1X01 A;  1OU9 A;  1M1F A;  3EGD B;  3M53 A;  2QGF B;  3HFN A;  1AOJ A;  4PLI A;  2KXD A;  4PK4 A;  1Q82 C;  3EG3 A;  4LDY A;  1SSF A;  3CD6 A;  2CDT A;  1HJD A;  5C6S A;  2HKN A;  2RQV A;  1H92 A;  4PKC C;  3MO8 A;  1JO8 A;  2HEQ A;  3VS0 A;  1KFZ A;  3SFM A;  1D0X A;  2X4J A;  3VUB A;  3C12 A;  3MPU B;  1K9M C;  1D1C A;  1OYX A;  4OGE A;  1M3B A;  4JRK A;  1NPR A;  4C8Q F;  3CC4 A;  2DX1 A;  4XAX B;  1N8R U;  1BI0 A;  4J5Y A;  2GQV A;  5GJW B;  3SHW A;  3I55 T;  4UZW A;  4FSS A;  3OW2 S;  3CD6 Q;  1RAC B;  1GKU B;  1S72 A;  1VQL T;  5D6X A;  5J3B A;  3CCR T;  4JRI A;  4LDW A;  2KQW A;  2CT4 A;  4OMQ A;  5GAM g;  1OQK A;  1YIT T;  1Z9Z A;  1X2Q A;  2DD4 A;  3CCQ A;  1VQ7 T;  1KC8 C;  1PRM C;  4O6J A;  2M0Y A;  1LOJ A;  3VS5 A;  3LWH A;  4IUV A;  3VU3 C;  2FEI A;  2JXB A;  5I11 A;  1IRE B;  1S72 Q;  4LNP A;  2YXY A;  1CKA A;  3SEM A;  1D09 B;  3C95 A;  2Y90 A;  5CAI A;  4DA4 A;  1M4Z A;  2RO0 A;  3MP1 A;  5M9O A;  1AT1 B;  3QJ6 A;  2A28 A;  3CCQ Q;  1WLP B;  3M9Q A;  1NLO C;  4UC4 A;  4M75 B;  4CC2 A;  5GAM d;  2JN0 A;  3NPF A;  2QTX A;  2EKO A;  1M8M A;  2D0Q B;  2DRK A;  4IKF A;  2F2W A;  1ZBX A;  1M2V B;  2EYZ A;  2O88 A;  1GFC A;  4EMH A;  4C0D C;  1VYV A;  2PVG B;  3FEO A;  4J6Y A;  2LQK A;  2HCK A;  4OMF B;  2RHI A;  3BFM A;  2DXT A;  1SHG A;  2PVD B;  4QVD A;  1BI2 A;  2E3H A;  4E2F B;  5FRM A;  4XTY A;  1EN7 A;  3OYN A;  3JB9 J;  2GFA A;  1H9F A;  2KT8 A;  1VQM A;  3LX7 A;  1W2B P;  1G5V A;  2JTM A;  1VIF A;  3CD6 T;  4E7L A;  5LJ5 d;  1H3Z A;  2NUP B;  2R5A A;  1VQP A;  2G6F X;  5DY9 A;  4J9B A;  2LJ1 A;  3L1A A;  1M90 U;  4KRT A;  2MMP A;  1A62 A;  4M77 D;  2K79 A;  1H9E A;  3EFR A;  3CCL A;  2DBK A;  1YJ9 A;  4J6W A;  4E7K A;  4CC3 A;  2K5F A;  1G83 A;  1N8R C;  3BW1 A;  1VQM Q;  2L89 A;  1SSH A;  3H0F A;  2DIL A;  1PKT A;  3H8Z A;  3OB9 A;  5GAN 2;  4M77 E;  3H9N A;  2WSF E;  4PJO G;  1S72 T;  4PJN A;  1JXO A;  3EFO A;  4KT0 E;  1LJO A;  5CK9 A;  2CP7 A;  1VQP Q;  1WNL A;  3L2W A;  1YWO A;  2WAC A;  4NL3 A;  2EYX A;  3EFS A;  5GAN j;  1QCF A;  3CCL Q;  1YJ9 Q;  4WF2 A;  4XU1 A;  2LX7 A;  3SWN B;  1IRX A;  4ZGJ B;  3SD4 A;  5LJ3 j;  1Y0M A;  1UJ0 A;  3RNJ A;  1M27 C;  1WDX A;  2X9H A;  1QP3 A;  1PWT A;  2COY A;  3G6E A;  5CKB A;  1K73 R;  1WZO A;  4M75 F;  3NTH A;  1OPK A;  3LLR A;  2GF7 A;  1VYU A;  5KYW A;  3GNG A;  1ZBJ A;  5A0L A;  1PG5 B;  5L8R E;  2DAQ A;  5FU6 C;  2RJE A;  2SRC A;  1M30 A;  2EPD A;  2EAY A;  3S6W A;  1ACM B;  3M57 A;  3G6E Q;  4EMK B;  3HP9 A;  3NGP A;  2D6F A;  4OB0 B;  4ZGD B;  1GRI A;  1M9S A;  1HK9 A;  4M7A D;  3X26 B;  4E7J A;  3H41 A;  1VQO A;  1G3S A;  2L0A A;  4Z8A A;  2L3Q A;  3FRN A;  2X4X A;  1VQ9 A;  1G2B A;  3HRU A;  5FU7 B;  1RAD B;  2K3Y A;  3M55 A;  1UUE A;  2CS7 A;  4M7A E;  3EGD A;  3S3O A;  1W2B S;  5I2S A;  1WHJ A;  2J06 A;  2KK4 A;  1MMD A;  4LDV A;  1QW1 A;  1DJ7 B;  1ZSG A;  1E7D A;  4JLG A;  5CO7 A;  2ZPF B;  1RI9 A;  4DBH A;  5CIU A;  1JEQ A;  2XK0 A;  1VQO Q;  2CP5 A;  3PVL A;  1M90 C;  1VQ9 Q;  1XQH A;  1VQ4 T;  2QA4 T;  4C92 C;  3ER0 A;  3SB2 A;  4PJO B;  4RUG A;  1D3B B;  1ZBH A;  2OJ2 A;  4CC4 B;  3MCA B;  4R0K A;  1GBQ A;  1MV0 B;  2K5I A;  4EDU A;  1KD1 U;  2EJF A;  1UGP B;  4LDU A;  2DJZ A;  3C94 A;  4F7U G;  1IB8 A;  4RCB A;  1UB4 A;  4M78 G;  1QCN A;  1GL5 A;  5CCA A;  1ZS9 A;  2CZ0 B;  3V8L A;  4DEY A;  4JRQ A;  2VUB A;  2ZZD A;  2XDB A;  2QQA A;  2YUN A;  4AT1 B;  5KH6 A;  1NBE B;  1CSK A;  3ZBD A;  1UE9 A;  1FYN A;  4Y28 E;  3F70 A;  1AD5 A;  2YSQ A;  4A4H A;  3G6E T;  1TOV A;  3MEV A;  1G3Y A;  1YJW A;  3PMT A;  4FW1 A;  1JQQ A;  2LT1 A;  2X4Y A;  1NJI R;  4ORZ A;  1YNS A;  2HBP A;  2D8H A;  3OBY A;  3TVT A;  2FG0 A;  1WX6 A;  4J9D A;  3KBG A;  5D6Y A;  4M75 A;  5IAY A;  1KQ1 A;  5GMK e;  5GAM j;  2E41 A;  1JB0 E;  2RN8 A;  1YJW Q;  1IXD A;  1QP2 A;  4J83 A;  1UGV A;  4ATO A;  1M2V A;  5FW9 A;  4OMP A;  3PGG A;  4FW2 A;  4OVA A;  5KE3 A;  4AFU C;  1RL2 A;  1SRL A;  2CKK A;  3UT1 A;  1Q81 R;  1K73 U;  3QWY A;  4N0A A;  3EGX B;  1KQS A;  1H64 1;  1R0C B;  1VQ5 A;  1W70 A;  2JTF A;  3JCM h;  3D7S B;  1XJW B;  5I2M A;  3OY9 A;  2PQW A;  2Z0W A;  1FMW A;  1AWW A;  3X24 B;  3OYI A;  4E6R A;  3QZ9 B;  4FT4 A;  4Z89 A;  2QGG A;  3JCM f;  5LJ5 j;  4MMK A;  4F7U B;  1SEM A;  2XMF A;  1Y57 A;  5GAN 4;  4M78 B;  2CP6 A;  3VV0 A;  1TUC A;  3EHR A;  2R58 A;  1O9S A;  4A4F A;  1JJR A;  4QQG A;  1VQ5 Q;  2HL3 A;  3MKD A;  2KRM A;  3TCJ A;  1WHL A;  1FWZ A;  4DOW A;  1ZA1 B;  1AZE A;  1PSE A;  3OW2 A;  4KUL A;  1N6A A;  3JV3 A;  2GCX A;  4BDZ A;  1JJ2 A;  1QVG A;  4A4K A;  4M7D C;  1RLQ C;  4AFQ C;  1ZSZ B;  5GAN g;  3AT1 B;  1Q95 G;  2FRY A;  2ROT A;  2RNA A;  3UF4 A;  4QVZ A;  1WA7 A;  1BI3 A;  4JJN K;  3SWN A;  4XTV A;  3CXC A;  1D1A A;  5GAN 7;  1QVP A;  2ED0 A;  5GAO l;  1AWX A;  2BE7 D;  1VYT A;  4BY6 B;  5HKC A;  4KUI A;  3M0R A;  4QQD A;  3ASK A;  1YJW T;  3JB9 G;  1G3T A;  2A08 A;  1UEB A;  4ELZ C;  1AWJ A;  4OGC A;  4HCC A;  3I55 A;  1WHM A;  3PT9 A;  3HSB A;  2YRC A;  4N4I A;  2ZPI B;  2LD7 A;  3M0P A;  3M0S A;  3VRZ A;  5A0D A;  3DB3 A;  4M7D D;  1VQL A;  1PKS A;  3OBW A;  3OYH A;  4IUT A;  4XU3 A;  2D0N A;  5GAN d;  3CCR A;  2DJQ A;  2QDY B;  1IO6 A;  3QZ5 B;  5IH2 A;  4C8Q C;  2ODC I;  4BAC A;  1MV3 A;  2JJ9 A;  3L2Z A;  4J9F A;  1YIT A;  1BIB A;  2K9G A;  4OP0 A;  1VQ7 A;  1RAF B;  3OS1 A;  2E65 A;  2OTL T;  3VS1 A;  1ABO A;  4M7D E;  2QNC A;  1TH7 A;  3RES A;  4EMK A;  3AHU A;  2OTJ T;  1V76 A;  4HCZ A;  4ZTF A;  2JZ2 A;  3I55 Q;  3A8G B;  1K73 C;  1WXU A;  2FB7 A;  3P8D A;  1GL9 B;  4XQ3 A;  3OYM A;  3RIR A;  2LQN A;  1TUD A;  1VQL Q;  3HHT B;  3QSU A;  1FMK A;  1RLP C;  1IGQ A;  3CCR Q;  2KVD A;  2LP5 A;  1QVF A;  4J6X A;  4OB2 B;  2OI3 A;  2HJQ A;  3LW5 E;  4EIK A;  1VQ7 Q;  1NM7 A;  2X3W D;  2QEX Q;  1CKB A;  1PHT A;  4WCI A;  1WXT A;  4PFO A;  4C5H A;  4A4G A;  1JEI A;  2DEU A;  3EGU A;  2HMA A;  2JM8 A;  3V7R A;  5GAO q;  4A63 B;  5KYY B;  3CCJ A;  2EGA A;  4C8Q E;  1X6B A;  3QJY A;  3G71 A;  1K76 A;  4QVC A;  1UG1 A;  1Q81 U;  4JJB A;  3WVE B;  1WQW A;  3A5Z B;  3BDU A;  1H1J S;  1OX9 A;  2LNH B;  3TSZ A;  4PJO A;  2BKD N;  5ECA A;  2QDL A;  1D3B A;  3UAT A;  3A98 A;  3OSV A;  2JS0 A;  2DK3 A;  2RMO A;  2F2V A;  2RI2 A;  4K11 A;  3GIB A;  3CCJ Q;  2E64 A;  3G71 Q;  2MPX C;  3OS2 A;  4MML A;  2QQR A;  4ESR A;  2RM4 A;  7AT1 B;  2ESW A;  2QG9 B;  1Y71 A;  3N5B B;  1I4K 1;  3OYJ A;  1K0X A;  2RK2 A;  1V1C A;  4JUV A;  4JRP A;  2ROL A;  2CSQ A;  1NYF A;  2AT1 B;  5J26 A;  2QQB A;  4KGX B;  1IHV A;  3I35 A;  2HAX A;  2COW A;  4B9X A;  3E19 A;  1I0C A;  4J9I A;  3CCS T;  4JZ4 A;  4BDY A;  4X1V A;  3JB9 I;  3OS5 A;  1WHG A;  4FYW B;  2QEX T;  3LYI A;  1M2O A;  5GMK l;  2KR3 A;  2KAF A;  2B8A A;  1LPL A;  2CUD A;  1QKX A;  4IIM A;  2RB6 A;  1ABQ A;  2PZ1 A;  1Y07 A;  2KVQ G;  4PLL A;  1MND A;  1NJI C;  1KHI A;  1EIF A;  2ZGW A;  1VOM A;  2FO0 A;  3EGX A;  3MP6 A;  2DEQ A;  4L59 A;  4KH1 B;  1GCQ C;  4IIO A;  2K3B A;  2FRW A;  2DXC A;  3NFC A;  5GAN e;  3QBY A;  1BK2 A;  2LJ0 A; 
#chains in the Genus database with same CATH homology
 4ZGD B;  5LJ5 g;  1M9S A;  1W4S A;  4F7U F;  1HK9 A;  3JCM X;  3X26 B;  3CCJ T;  4M7A D;  4E7J A;  1VQ9 T;  3G71 T;  1VQO A;  3CCU T;  1G3S A;  2M16 A;  5LJ3 e;  4MDX A;  3P8B B;  4M78 F;  3KUF A;  4DOV A;  5HY6 A;  3HRT A;  5I21 A;  1Q81 C;  3FIF A;  3FRN A;  3M4Y A;  5CKF A;  2X4X A;  4NOY A;  3M56 A;  4L6V 5;  5LJ3 h;  3CCU A;  1VQ9 A;  2K57 A;  4M77 C;  4F7U A;  3CC2 T;  3G7Z A;  4J7F A;  2F5T X;  3GP8 A;  1VQ8 T;  3RKY A;  4M78 A;  3HRU A;  2VXE A;  5GAN f;  2P0P A;  3CC2 A;  2V8K A;  4IUU A;  2HQE A;  5FU7 B;  2K3Y A;  3LWI A;  1VQ8 A;  3M55 A;  3PIP A;  2CS7 A;  1BIA A;  5GMK i;  3GPL A;  4C92 F;  3S3O A;  1W2B S;  5I2S A;  5IT9 E;  1VQN A;  4M7A E;  5LJ3 f;  2CGH A;  2DZ9 A;  3BDL A;  1OI1 A;  3CCV T;  3L2U A;  1FXX A;  3RKW A;  2KK4 A;  3CME A;  1JRI A;  3CCM T;  3VUZ A;  4LDV A;  2DXU A;  3JRZ A;  1QW1 A;  2LTO A;  1DJ7 B;  4M78 C;  4PNO A;  4C92 A;  5GAO n;  3CCV A;  3A8M B;  4FSX A;  4JLG A;  5CO7 A;  2ZPF B;  1FX7 A;  4IUQ A;  2QQ9 A;  5HK3 A;  4HA8 A;  3CCM A;  5CIU A;  2XK0 A;  3URG A;  3VJP A;  1B34 B;  4M75 D;  4QW2 A;  3JCM Q;  1M90 C;  2V8J A;  2XU8 A;  2P4T A;  1Y96 A;  2EIF A;  1XQH A;  2RHX A;  3Q1J A;  1VQ4 T;  4M77 G;  1N9R A;  2RHU A;  2QA4 T;  1YI2 A;  2E6N A;  4C92 C;  3ER0 A;  2KMT A;  3SB2 A;  3JSC A;  3CCE T;  4PJO B;  3FLG A;  1VQ4 A;  1AHJ B;  3L42 A;  2QA4 A;  2YLC A;  4RMO A;  2VXF A;  2DIG A;  1KD1 C;  1D3B B;  1KQS S;  2RHY A;  3MCA B;  3JCM c;  4M7D B;  5D6W A;  5CVI A;  2FYK A;  4M75 E;  2K5I A;  3QDR B;  2A7Y A;  2QI2 A;  3M59 A;  4EDU A;  2CZ1 B;  1KD1 U;  2EJF A;  2GFU A;  2YHT A;  1UGP B;  4LDU A;  2DJZ A;  3C94 A;  4F7U G;  3SDZ A;  5A0G A;  4RCB A;  1U8R A;  1UB4 A;  2DTI A;  3UWN A;  4M78 G;  2MAM A;  3UPU A;  3LGL A;  2KY9 A;  4X34 A;  2RK1 A;  4FIB A;  3G4S T;  1N27 A;  3LH0 A;  2ZPB B;  4C0Z A;  5HK0 A;  3INZ A;  4RG2 A;  4XTZ A;  5CCA A;  4BE2 A;  4XTX A;  2CZ0 B;  3MEU A;  5GMK j;  3V8L A;  1Q82 U;  3TEE A;  4BY6 C;  2EQJ A;  2VUB A;  4C0F A;  4JRQ A;  2ZZD A;  4FT2 A;  3M58 A;  4XU0 A;  2R57 A;  5LJ3 g;  3VYG A;  2XDB A;  2E12 A;  2QQA A;  4OB3 B;  5EG2 A;  4C92 G;  2LX9 A;  1BYM A;  3GF5 A;  5KH6 A;  2KSS A;  5AYF A;  1XNI A;  2M1H A;  4OB1 B;  2K2V A;  3ZBD A;  4F7U E;  4M7A A;  1KG1 A;  1K9M U;  4M78 E;  1N9S A;  3HPW A;  4Y28 E;  3PTA A;  4VUB A;  2DKG A;  3DKM A;  3F70 A;  1Q7Y U;  3RUX A;  4A4H A;  2EFI A;  2LVM A;  3G6E T;  1R8O B;  3MEV A;  3KXT A;  4P5N A;  5GAN 8;  1G3Y A;  1YJW A;  3JB9 D;  1K8A C;  2HNI A;  3TRE A;  4Z02 A;  3PMT A;  1I81 A;  4JS5 A;  2LT4 A;  1QVG S;  3OSS C;  2XDD A;  1O75 A;  2LRQ A;  3EAE A;  4R56 A;  1JJ2 S;  4M7A C;  2LT1 A;  2YLB A;  2DPP B;  3V7S A;  2X4Y A;  3CBM A;  4A4E A;  4ZN3 A;  2KDS A;  3OQ5 A;  3JAM E;  2IG0 A;  2HBP A;  3OBY A;  3RMQ A;  1U1T A;  3M5A A;  4TVR A;  2XID A;  3X28 B;  2FVU A;  4L5G A;  3CC7 T;  2O4X B;  1WQ7 A;  4BUG A;  3NTK A;  2Y4Y A;  3L2R A;  3OYE A;  3CC7 A;  3CXC S;  2VGM A;  5LJ3 d;  1YCY A;  1JBM A;  4FM4 B;  5CKD A;  3KBG A;  5D6Y A;  4M75 A;  4XTU A;  1ZQ1 A;  4RCC A;  5IAY A;  3MET A;  1LNX A;  2EQK A;  3OYA A;  1KQ1 A;  3MEW A;  3QXE B;  5FRO A;  5GMK e;  5GAM j;  2MWO A;  2E41 A;  1JB0 E;  1W2B A;  1PSF A;  1KC8 U;  1YJN A;  2QXF A;  3S3N A;  2XI9 A;  5GMK h;  2K5L A;  2ZPG B;  3A8O B;  4N4H A;  2FL7 A;  2RHZ A;  1QP2 A;  2DO3 A;  3CMA T;  2FHD A;  4E7H A;  4J83 A;  4ATO A;  4O5V A;  3PGG A;  3CMA A;  3PMI A;  4M7A G;  3CBP A;  4M75 C;  4OVA A;  5KE3 A;  1RL2 A;  5GAN 5;  5GAN h;  2RA2 A;  2CKK A;  3UT1 A;  1MGQ A;  1I8F A;  4BE0 A;  4YTL A;  1VIE A;  1K73 U;  2QQS A;  2LDM A;  2CZ6 B;  2F5K A;  2LNV A;  4N0A A;  3FB9 A;  5GMK m;  3TU4 K;  4B9W A;  3QG1 A;  4R55 A;  1BI1 A;  3FDR A;  3OYY A;  2C06 A;  2PUO B;  4LDX A;  4C8Q D;  3JCM J;  4QQ6 A;  2YRV A;  2BIV A;  4C0D B;  1KQS A;  1VQ5 T;  3T9N A;  1VQN T;  1H64 1;  2E1H A;  4FL6 A;  3JCM e;  2PVO B;  4MZT A;  1VQ5 A;  2EWN A;  2JTF A;  3JCM h;  4BD3 A;  2K3X A;  5J39 A;  2OAU A;  4N0A C;  2JVV A;  4M77 B;  3CME T;  2D9T A;  2I2L A;  5I2M A;  3OY9 A;  1Q82 C;  1XOV A;  2PQW A;  2K4Y A;  4J7I A;  1NE8 A;  4C8Q E;  3CPF A;  2E70 A;  5FU7 C;  4HT9 A;  3X24 B;  2DIQ A;  2DVE A;  4M75 G;  3OYI A;  3QZ9 B;  5DM7 R;  4FT4 A;  3M54 A;  3JCM f;  1P92 A;  5LJ5 j;  3RER A;  2M9U A;  5CKE A;  5GAM e;  2P0Q A;  4MMK A;  4F7U B;  1QVF S;  4M7D F;  2EQU A;  2RJF A;  1YI2 T;  2XD0 A;  5GAM h;  5GAN 4;  4M78 B;  3VYH B;  2XKO C;  3VV0 A;  2LQ8 A;  1M1K U;  2R58 A;  1O9S A;  1UGQ B;  2CZ7 B;  4M7D A;  1X01 A;  1M1F A;  2ZCF B;  3M53 A;  4A4F A;  5KE2 A;  3HKS A;  4QQG A;  5KCH A;  3J80 E;  5CQX A;  3HFN A;  3TCJ A;  3VKI A;  2DTH A;  1FWZ A;  3OMC A;  4X9C A;  5GAM f;  4PLI A;  3X25 B;  3OYK A;  4DOW A;  3JB9 H;  1PSE A;  4C92 B;  3LGF A;  3OW2 A;  4KUL A;  2VYT A;  1NZ9 A;  3ME9 A;  1N6A A;  3PFS A;  4HKE A;  1WJS A;  1BKB A;  1SSF A;  2GCX A;  2XHC A;  4LDY A;  3V8K A;  4C5I A;  4NL2 A;  4A4K A;  4BDZ A;  1QVG A;  1JJ2 A;  3CD6 A;  4M7D C;  2WSC E;  5IN1 A;  2MWP A;  3GNF B;  2E6Z A;  5C6S A;  4LD9 K;  2HQX A;  5GAN g;  1Y96 B;  4PKC C;  3MO8 A;  2XIC A;  2RH2 A;  4CI0 C;  2WSE E;  3JCM P;  4MZM A;  1HXD A;  3SFM A;  4C0G A;  4LD6 A;  4QVZ A;  1BI3 A;  2X4J A;  5CKH A;  3X20 B;  4JJN K;  4ZTJ A;  3QO3 A;  3VUB A;  5GAO p;  1Q86 U;  3DLL A;  3C12 A;  1K9M C;  3SWN A;  4XTV A;  3CC4 T;  1OYX A;  5A2Q E;  1VQ6 T;  3CXC A;  5GAN 7;  1QVP A;  1Q7Y C;  2IVW A;  2M0O A;  2A3L A;  1M1G A;  1NPR A;  4JRK A;  4OGE A;  4C8Q F;  5GAO l;  3CC4 A;  1VQ6 A;  2DXB A;  1WPY A;  4BY6 B;  4XAX B;  4JS4 A;  1N8R U;  1BI0 A;  4J5Y A;  5HKC A;  4KUI A;  5LJ5 e;  3JCM g;  4BE1 A;  2GQV A;  4QQD A;  2DZC A;  3ASK A;  4E47 A;  1YJW T;  5LJ5 h;  3JB9 G;  3I55 T;  1G3T A;  3WVD B;  1UEB A;  1Y7X A;  4C8Q A;  3OW2 S;  4ELZ C;  3SWN C;  4OGC A;  2F69 A;  4HCC A;  4PJO D;  3I55 A;  1G3W A;  1S72 A;  3PT9 A;  3QYG B;  3V8J A;  3HSB A;  4MDW A;  1VQL T;  4N4I A;  5D6X A;  2ZPI B;  2EYQ A;  5A0D A;  5J3B A;  3DB3 A;  3CCR T;  5FRN A;  1VQL A;  4M7D D;  3CBO A;  2XG8 D;  3OBW A;  2O4X A;  4JRI A;  4LDW A;  3OYH A;  2KQW A;  4IUT A;  4XU3 A;  5LJ5 f;  5GAN d;  4GY5 A;  3CPW A;  1OZ2 A;  3CCQ T;  3CCR A;  2QDY B;  3OYC A;  3QZ5 B;  5GAM g;  4C8Q C;  1YIT T;  4BAC A;  2DD4 A;  4M7A B;  3CCQ A;  1V29 B;  1VQ7 T;  3L2Z A;  1YIT A;  4PJO E;  1BIB A;  1KC8 C;  3P8H A;  1YIJ T;  2XDP A;  4OP0 A;  1VQ7 A;  4RG8 A;  1X6O A;  3OS1 A;  2E65 A;  4O6J A;  1LOJ A;  2EJ9 A;  3MHX A;  1YJN T;  2OTL T;  1TH7 A;  3RES A;  1YIJ A;  2LCL A;  4M7D E;  3LWH A;  4EMK A;  3AHU A;  1M5Q 1;  2EJG A;  2OTJ T;  4IUP A;  4IUV A;  3VU3 C;  2OTL A;  4HCZ A;  1ZHI A;  4ZTF A;  2JZ2 A;  1IRE B;  3JCM d;  2OTJ A;  3A8G B;  2Y4X A;  1K73 C;  2FB7 A;  3P8D A;  4OF1 A;  3J7A F;  5FU6 B;  4XQ3 A;  3C95 A;  3RIR A;  3OYM A;  3HFO A;  2Y90 A;  2V8I A;  5CAI A;  1YHQ A;  4D6W A;  1M4Z A;  2RO0 A;  4A54 A;  4DA4 A;  3HHT B;  3C4S A;  3MP1 A;  3QSU A;  5M9O A;  2LC4 A;  2PU9 B;  3M4G A;  4EMK C;  4RKU E;  3CPW S;  4J6X A;  1QVF A;  4OB2 B;  3QJ6 A;  3WXM B;  4C8Q G;  3PNW C;  4M77 F;  3M9Q A;  4UC4 A;  2VV5 A;  3DLM A;  2PUK B;  4M75 B;  4DQ2 A;  3LW5 E;  5GAM d;  1KQ2 A;  2JN0 A;  2QTX A;  2EKO A;  4BI8 B;  2RJC A;  2D0Q B;  4Q5W A;  3FC3 A;  4IKF A;  4C5H A;  4A4G A;  2L5Q A;  3OYF A;  2E10 A;  1ZBX A;  2ZPH B;  3A8H B;  4EMH A;  4V2S A;  4C0D C;  1IZ6 A;  3V7R A;  5GAO q;  3CCJ A;  1B34 A;  2H3J A;  2PVG B;  3FEO A;  3GLX A;  3QJY A;  2LQK A;  4J6Y A;  4PL6 A;  4XU2 A;  3UDC A;  3G71 A;  4PJO F;  3ZEH A;  4QVC A;  3R6O A;  4OMF B;  1WGS A;  1Q81 U;  1OZ3 A;  1M1K C;  5CR2 A;  2MF2 A;  2RHI A;  3WVE B;  1WQW A;  3A5Z B;  3BDU A;  4CRI A;  2VC8 A;  3BFM A;  3RMS A;  2DXT A;  4PJO A;  2BKD N;  2PVD B;  4QVD A;  1BI2 A;  3H6Z A;  1D3B A;  5FRM A;  4XTY A;  3OA6 A;  4A53 A;  5C0M A;  3OYN A;  3OYL A;  1VQM T;  3JB9 J;  2GFA A;  3NTI A;  3OSV A;  2CYZ B;  1XTD A;  2NLU A;  3MEA A;  4HT8 A;  1VQM A;  3LX7 A;  2DK3 A;  1WJR A;  2RI3 A;  2X35 A;  3HRS A;  4ELY C;  1G5V A;  2JTM A;  4C5E A;  2AHJ B;  4PJO C;  1VIF A;  3CD6 T;  2RI2 A;  4E7L A;  2LCC A;  3GIB A;  4JLI A;  1VQP T;  2E64 A;  5LJ5 d;  3OS2 A;  3OYG A;  1H3Z A;  3OMG A;  4BI3 A;  1GXI E;  2R5A A;  5GAO r;  3L2V A;  1VQP A;  5DY9 A;  4MML A;  3CCL T;  3V7C A;  1YJ9 T;  1Q86 C;  2L8D A;  3QKJ A;  3L1A A;  2QQR A;  2MMP A;  4GLK A;  3GOX A;  1M90 U;  4M77 D;  2E5Q A;  3EFR A;  2RM4 A;  3E9F A;  2JNG A;  1NJI C;  1YJ9 A;  3CCL A;  4J6W A;  4E7K A;  3CCE A;  1Y71 A;  3N5B B;  1I4K 1;  3OYJ A;  3ZFJ A;  2K5F A;  3S3M A;  1M8V A;  1UGS B;  1N8R C;  2ZPE B;  3BW1 A;  2RK2 A;  3E9G A;  4JDS A;  2L89 A;  2RJD A;  2JUF A;  4JUV A;  4MZP A;  4N4G A;  4EMG A;  4JRP A;  3JCM b;  3H8Z A;  3BY7 A;  3OB9 A;  5GAN 2;  3J81 E;  5J26 A;  2QQB A;  4M77 E;  1X75 C;  4ZGE B;  4E7I A;  2WSF E;  4M78 D;  4ZN1 A;  4ME7 A;  4PJO G;  3OYD A;  1S72 T;  2MI6 A;  3QPH A;  5DLQ E;  1I5L A;  2HAX A;  3G4S A;  1U1S A;  2VGN A;  4B9X A;  3E1S A;  4KT0 E;  1LJO A;  5CK9 A;  4KUD K;  1NPP A;  4M7A F;  4M7D G;  4BB7 A;  1WNL A;  3L2W A;  2WAC A;  4XK8 E;  2BUD A;  3E19 A;  4NL3 A;  3EFS A;  5LL6 S;  4X9D A;  3CEY A;  5GAN 3;  5GAN j;  1KHC A;  4NS5 A;  4WF2 A;  5KCO A;  4XU1 A;  4C92 D;  2O01 E;  3SWN B;  3JB9 F;  3PIO A;  3QII A;  4ZGJ B;  3CCS T;  5DLO A;  3SD4 A;  2DTO A;  4BDY A;  3L2Q A;  3QHS A;  5LJ3 j;  1VQK T;  3OS0 A;  3JB9 I;  3OS5 A;  3CCS A;  3MP8 A;  3HL8 A;  4HCB A;  2QEX T;  3LYI A;  1VQK A;  1QP3 A;  1VUB A;  3RKX A;  2L3R A;  5GMK l;  3G6E A;  2KAF A;  2B8A A;  2QEX A;  1MHN A;  4C8Q B;  1RI0 A;  5CKB A;  3O8V A;  4IUR A;  2RB6 A;  3A8L B;  4C92 E;  3QYH B;  1Y07 A;  2KVQ G;  1K8A U;  3FJP A;  4PLL A;  2EQM A;  1YHQ T;  4C5G A;  2JOY A;  2DD5 A;  3QUI A;  2RI5 A;  5GAN 6;  5GAO m;  4M75 F;  3LLR A;  3DB4 A;  2GF7 A;  3NTH A;  1KHI A;  1UGR B;  1EIF A;  2P0K A;  3GNG A;  2ZGW A;  2G3R A;  5A0L A;  2HD0 A;  5L8R E;  2DAQ A;  1NJI U;  3JCM W;  1WJQ A;  5FLX E;  4XTW A;  5FU6 C;  4EPC A;  2RJE A;  3MP6 A;  4J8O A;  2DEQ A;  3OYB A;  4L59 A;  3I56 T;  4II1 A;  4Y91 A;  2EAY A;  3S6W A;  3M57 A;  4BI4 A;  1YBY A;  3I56 A;  2RD1 A;  4EMK B;  4FU6 A;  3HP9 A;  4M77 A;  4KBM B;  2X4W A;  2DXC A;  3NFC A;  5GAN e;  3JCM V;  2R5M A;  3QBY A;  5CQY A;  2D6F A;  4OB0 B;  1VQO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...