5CIUA

Structural basis of the recognition of h3k36me3 by dnmt3b pwwp domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
127
Chain Sequence
EYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFDQLKPMLEWAHGGFKPTGIEGLKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of histone H3K36me3 nucleosome by human de novo DNA methyltransferases 3A and 3B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA (cytosine-5)-methyltransferase 3B
total genus 33
structure length 127
sequence length 136
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 5ciuA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ciuA01
4RG2A 3LLRA 3ME9A 1N27A 3P8DA 4GY5A 2XDPA 5KCOA 3UT1A 2FHDA 4E7JA 2L8DA 2EKOA 4QVZA 4FL6A 3OYBA 3Q1JA 2RJFA 4IUVA 4B9WA 3EAEA 3M9QA 5CIUA 2X35A 3FEOA 3META 5FRMA 1XNIA 3MP6A 5IN1A 3ASKA 3MEVA 2LVMA 5J26A 3PFSA 2EQMA 5KCHA 1OYXA 3C4SA 4E7IA 3S6WA 5KE2A 2MWOA 3DB4A 3LGFA 5M9OA 2P0KA 1WGSA 2RI2A 3O8VA 3OMCA 4N4IA 2VYTA 2RJDA 3MP8A 3FC3A 5KH6A 3OMGA 3L2UA 2EQUA 1SSFA 3L2QA 4Z02A 3OYMA 3OYFA 3OYGA 1KHCA 2RHIA 4Q5WA 2L89A 3OYCA 4QW2A 4LD6A 4HCZA 3S3MA 2RO0A 2GFAA 2JZ2A 3QIIA 3QKJA 2LDMA 2LTOA 3LYIA 5FROA 4A4HA 4A4GA 3NTKA 2BUDA 3MEAA 3OYHA 1WJRA 2GF7A 2R57A 1WJQA 3OS1A 2RJEA 4E7LA 4BE2A 3OA6A 3OQ5A 3DB3A 3OYJA 4ZTJA 2M16A 2YRVA 3F70A 4BE1A 3OYKA 1MHNA 3P8HA 4NS5A 3L2VA 2BKDN 1OZ3A 2E6NA 5J39A 2IG0A 2M1HA 2RHUA 2EQJA 3H6ZA 4BDZA 2R5AA 4N4HA 3OYEA 3MP1A 2E5QA 2RI5A 2DIGA 5C0MA 3QBYA 4ZTFA 3FLGA 1OI1A 3S3OA 2K3XA 4BE0A 3H8ZA 3OB9A 3KUFA 3MO8A 4IURA 4A4FA 4PLLA 1H3ZA 2F5KA 2QQSA 3OY9A 2EQKA 2QQRA 2RHZA 2MWPA 3NTIA 3L2RA 5FRNA 1G5VA 2DIQA 2L3RA 3UWNA 2NLUA 2BIVA 2X4XA 4UC4A 3LH0A 3S3NA 2LCCA 2GFUA 4C5IA 2R5MA 4PLIA 2M0OA 1WJSA 4II1A 3MEUA 3E9FA 4N4GA 5D6WA 3OYIA 1RI0A 2RI3A 3PMTA 5D6YA 2XK0A 4C5EA 3ZEHA 2RHYA 2CKKA 4C5GA 3L2WA 3E9GA 2LRQA 2HQEA 3DLMA 4A4EA 4E7HA 4IUUA 2X4YA 4CRIA 3OS2A 3GOXA 4BDYA 5IAYA 3L42A 3QJ6A 4QQDA 2HQXA 4IUTA 2O4XB 2G3RA 4B9XA 4EDUA 3SD4A 4FU6A 2D9TA 3PNWC 2K3YA 2RHXA 4OVAA 3LGLA 3PMIA 3MEWA 3OYDA 5C6SA 4IUQA 5KE3A 1OZ2A 4C5HA 2RJCA 3OYAA 2R58A 4IKFA 4E7KA 4BACA 5D6XA 3LX7A 2O4XA 4X34A 4QQ6A 4L59A 3CEYA 3OS0A 2WACA 2X4WA 2B8AA 2PQWA 4BD3A 2JTFA 3FDRA 3NTHA 4PL6A 4IUPA 4QQGA 3OYNA 3BDLA 2DAQA 2EFIA 3OYLA
chains in the Genus database with same CATH superfamily
4M77F 3QZ9B 1YITA 4HT8A 3CC7Q 5HY6A 4OB3B 4F14A 3HRUA 1RAIB 4OB1B 1PM3A 2QYZA 2LVMA 2DK4A 3NHNA 4FIBA 4RG8A 5FU6C 4XU0A 2RM4A 3JCMf 2CUDA 3OMCA 1YCSB 4F7UF 4HVUA 2DXCA 5GAMe 3FB9A 2K57A 1WX6A 5CKBA 1YI2T 3JB9H 2L89A 2O31A 2K3BA 2AHJB 4HCZA 3R6NA 1GFCA 2PUKB 2PZ1A 4A4HA 1D1BA 2ED1A 2LQKA 3M57A 3OS1A 2DJZA 1OQKA 4A63B 4E7ZA 2HDAA 1YN8A 3JCMP 1M2OA 1OZ3A 2M1HA 3UATA 3I35A 1SKUB 4OMFB 3OW2A 3CCQQ 2CZ0B 4JRIA 4OMLA 1VQOQ 2NUPB 5GMKm 2RHZA 1O9SA 2BIVA 2DD4A 1AVZC 2X4XA 1MMDA 4FYXB 2JM9A 2R5MA 4PLIA 2M0OA 4NOYA 2MAMA 2CYZB 4HCBA 1Q95G 1SRLA 3WVDB 1PSFA 3HL8A 3M0UA 4D8DA 3CCUT 1VIEA 3ULRB 5A0DA 3VKIA 2G3RA 2HL3A 2K3YA 1VQMQ 2VUBA 3JB9J 1Y96A 2Y4YA 3OYAA 2M02A 4J7FA 1X2QA 2CP6A 2E64A 2JMAA 1BI2A 1YI2Q 4C8QE 1ABQA 5GAMh 3P8DA 1VQ8T 3OYBA 3EGXA 1KIKA 1OV3A 1SHGA 3RBBB 4D8KA 5GANg 2YDLA 2LJ1A 2L5QA 3FIFA 4KULA 3MP6A 4CC7A 1H641 1JXOA 2PU9B 1OYXA 1A0NB 1TH7A 4CC4B 3FC3A 3CXCS 4M78G 2EGAA 3RERA 1YBYA 3RR6A 3TEEA 4J9FA 4Q5WA 1TS9A 1C1AA 2AKKA 3VS5A 4LD6A 2CP5A 2HD0A 4J9IA 4XTVA 4X9CA 4ZNXA 1BIBA 5GMKl 4R0KA 4EMKC 1WJQA 2MK5A 3EG1A 2QQAA 2MPXC 3H9NA 1VA7A 2YRVA 1PCXA 2ZPBB 4PJJA 3VS2A 2DXTA 2LCLA 2OTLT 2BZYA 2LMJA 4NS5A 1JO8A 2E6NA 4KH0B 2EQJA 2FVUA 2JNGA 3MJXA 4M7AF 2K3XA 3EG9B 2WSEE 5LJ5h 2AKLA 4IIOA 4JDSA 2EBPA 1NEBA 1HXDA 4KT0E 3H41A 3OY9A 3OW2P 3CBOA 3HKSA 3M5AA 2C0TA 4CI0C 3L2RA 2MF2A 2E6ZA 3A98A 4EMKA 2FL7A 2QGFB 3QHSA 5LJ5f 2RB6A 1I1JA 2XD0A 1I0CA 4DEXA 2A28A 5GAN4 2RA2A 1YJ9A 4XTYA 4M78F 4DQ2A 3M0SA 1M4ZA 2MI6A 2MCNA 2KDSA 4L5GA 5KYWB 4F04B 3QJ6A 4QQDA 1BI1A 1D0ZA 2CT4A 2ZPHB 2EYXA 2OTJA 1PWTA 1NYGA 2VGMA 4OVAA 4FT2A 3C94A 2E5KA 1VQLT 4J6WA 1OPKA 1QP2A 2FO0A 4F7UB 2HKNA 4OP0A 3FDRA 4QQGA 2QNFA 2CP2A 4QT7A 2QQ9A 2VVKA 5FWCA 3RKXA 2O2OA 1VQPT 2V1RA 4MDWA 4M78E 3META 1XNIA 2PVOB 1IHVA 1WXBA 3OSVA 3CQTA 5M9OA 2LZ6B 1ZSZC 2LCSA 2J05A 9ATCB 3CCLA 5KYXA 3ZBDA 1IGUA 1NEGA 1WHKA 3CCLQ 2F2WA 3E2UA 1K0SA 5CCAA 1S72T 3X20B 2VWFA 1R0BG 1Q82U 3GLXA 2K5LA 3CC7T 1YFNA 1WXUA 2JTMA 3BW1A 4BI8B 3QKJA 1RACB 4C0FA 2K79A 1LPLA 3GNGA 2YHTA 4NL3A 2RJEA 4M7AG 3DB3A 2M16A 1N8RC 2BKDN 2LC3A 4PJOE 2D8JA 5GMKi 2QQBA 1OX8A 1VIFA 2VV5A 3QBYA 1K4US 3LWHA 4BE0A 1K1ZA 2MYSA 1H8KA 2KW9A 2LQ8A 2CH4A 4J9GA 2YUNA 1ZSZA 3NTIA 4LXCA 3VYHB 4PJOF 2JUFA 4M7AE 1OOTA 2D8HA 1WJSA 3C95A 4OMOA 4N4GA 3E9FA 5KYNA 5GJVB 1PNJA 4M7DC 1VQ4A 4C92C 1ZHIA 4C5EA 2CKKA 1ZUKA 4A53A 4XTWA 2DL8A 4IUUA 2OX7A 3V7SA 1PSEA 3EHQA 3L42A 4ELYC 1Y07A 2D9TA 2ZPGB 1S72A 1OZ2A 2A08A 4IKFA 3PTAA 3EG0A 4FM4B 1BYMA 1ZBJA 4J6XA 1KD1U 2FEIA 1RAFB 3GP8A 2DAQA 3OYLA 3O5ZA 1ZLMA 5KYUA 2E10A 1YP5A 2KEAA 1QCNA 1M90U 2YLCA 2KYMA 4MZPA 1WHMA 2VXEA 4C0DB 2X3XD 3S6WA 1VQ6T 2P84A 2KVDA 1WHLA 4N4IA 1H9EA 1JEGA 1T0HA 1VQ7T 2EQUA 3L2QA 1MMNA 7AT1B 1D0XA 3QG1A 4FYVB 1D0YA 2LD7A 4QVCA 2SRCA 4K11A 1QWEA 1QVPA 5IHNA 1GL5A 1YI2A 2QK0A 4OGCA 1Q81U 4XU1A 2K5IA 3REBB 5J39A 2PNIA 5HK3A 3M0RA 3KBGA 1JXMA 2VGNA 3WXMB 4LDVA 4LDXA 4Z88A 4JRQA 3OB9A 2EYWA 1R8OB 4GLKA 2COWA 4ZN3A 4DBRA 1PKTA 1GBQA 1U3OA 2HCKA 1Q7YR 4M77D 3FRNA 3M0PA 4M7DA 2RQRA 5LJ3f 4LDWA 1GXIE 2XIDA 1RI0A 2LT1A 2ZAEA 4HT9A 3L2WA 3LW5E 4F7UG 4JPBW 2HQEA 3OBYA 2WQGA 3QPHA 1QKXA 4VUBA 2COZA 1KQ2A 4KBMB 2DTIA 1YCYA 3JCMd 3E19A 4BITA 1KC8U 1M5Q1 5GAN6 1JEIA 2YUPA 5IHKA 1WLPB 2EJ9A 4PJOB 1GFDA 2ROLA 3LWIA 1FMKA 2I0NA 4RTYA 3CCUA 2X4WA 2CZ7B 4M7DF 2QTXA 2E4HA 1FMWA 4ELZC 4R56A 4GY5A 4YTLA 3VS1A 2KT8A 2DMOA 2XDPA 3I9QA 5GAMf 4FL6A 5GAMd 2VXFA 3HTRA 3PVLA 3ASKA 4V2SA 3RDVA 3BFMA 2DYIA 4DBQA 1PD0A 2QEXT 2RQVA 4B6MA 2LJ3A 3OYGA 2M51A 4QW2A 1H1JS 2LDMA 1A8VA 4RTZA 4WCIA 3E1SA 2R57A 5FLXE 3CMEQ 3I55T 3F70A 3OYKA 1OPLA 1AWWA 3RIRA 1D3BA 2KNBB 3NMZC 4J9EA 2E1HA 3H8ZA 3C12A 4ME7A 3CD6T 2QQSA 3OSSC 2EIFA 3EGDB 3G6ET 1NLOC 8AT1B 1VQ8A 2LCCA 1VQOT 1A62A 4EIKA 1AWJA 1ZUUA 3MEUA 3NGPA 1SPKA 5DLQE 2RI3A 1TTHB 4C8QF 2M9UA 4AFQC 5A2QE 5CQXA 3SEMA 2EJFA 2KY9A 1W1FA 1EN7A 3OS2A 2PVDB 4EPCA 3I5RA 5I11A 2JVWA 4JJCA 2EYQA 1MV0B 5GANh 1KQSA 1X6GA 3PMIA 5AT1B 1JU5C 4XTUA 3VJPA 1XTDA 2EWNA 2DTHA 2RN8A 4J83A 1YNSA 3URGA 1K76A 1G3TA 2KVUA 1VQ5A 1WHHA 1BU1A 5L23A 3IQLA 1D1CA 4E7JA 2RJFA 2KRSA 4B9WA 5CQYA 3CCMT 4M75A 3M9QA 2ESWA 1ZUYA 4RCBA 4GBQA 4J5YA 5GAN5 2DXUA 4DBHA 3TSWA 3O8VA 4PFOA 4O6JA 5HKCA 4PJMA 3U23A 3G6EA 2E3IA 3L2UA 4O5VA 4Z02A 1K9MR 4AG2C 3G4ST 1FMVA 5GAOl 2GFAA 4PJNA 4FT4A 3X26B 2K5FA 2JN0A 2JMCA 3G1JA 1P92A 2LTOA 3LYIA 2QA4A 2K4YA 1M90C 2E65A 2LNHB 4ZN1A 2DRMA 2KI7A 3X25B 2QI2A 1MHNA 4FSSA 1TXQA 3PGGA 2RHUA 1M2VA 4C92G 4ZGEB 4JUVA 3I56T 3TQ7P 1MGQA 3I55Q 2KT1A 3CMAT 2DYBA 2EGCA 4C0ZA 5FRNA 3EH2A 2L3RA 4M75E 5FW9A 2KVEA 2HAXA 1V1CA 2YRCA 4EMHA 4J9BA 1ZBHA 3CCMA 3CCRQ 5D6WA 1FX7A 1YJWQ 5HCKA 1KSWA 3QXEB 3E9GA 1JJ2P 2YLBA 4LDYA 2I2LA 1M1KU 4OB0B 2HBWA 1VUBA 4PFZA 1D09B 4M78D 4XK8E 2HQHA 1SRMA 4XAXB 5I2MA 3DKMA 1MMAA 2B8AA 2ZPEB 1KD1R 2DZ9A 4IUPA 5GMKj 1E7OA 1Z9ZA 5I2SA 1X43A 3LLRA 4OB2B 2A0FB 1PRMC 2L8DA 2W0ZA 1ZBXA 2DEQA 5GJWB 2LNVA 4N0AC 2CP7A 5CIUA 2XMFA 3M53A 2DX1A 1QVGP 2D0QB 1Y71A 2EQMA 4E6RA 3CCRT 1TWBA 2HSEB 1WGSA 5GAOq 2DA9A 1GCPA 2AZSA 1TUGB 2DBMA 2GGRA 2KVQG 2XDDA 2KRNA 3VUBA 1K73R 3OYCA 1KK7A 4KGVB 1SG5A 4M7DB 1O75A 3S3MA 1QQJA 3CCJT 1VQ4Q 2KBTA 1QCOA 2ZPFB 2G80A 1BB9A 3JCMe 1LOJA 3CC4Q 1UFFA 2RD1A 4BDZA 2E3HA 4CC3A 2RI5A 1OI1A 4C0GA 2FPDA 1UG1A 2OI3A 5GAOm 2B86A 1Q7YU 1B07A 1PHTA 2RH2A 2NUTA 1WIEA 1YITT 1AEYA 1NG2A 1NPPA 3G71Q 4GLMA 3JCMX 1TU0B 3UA6A 3PMTA 1TG0A 4C5GA 1HSQA 1M3AA 2HSPA 2HNIA 4LUDA 4Z8AA 2MOXA 1YIJA 4XTXA 3SWNB 4B9XA 3SD4A 4FU6A 2HL5C 3LGLA 4HA8A 3V7CA 1NZ9A 4OMQA 2KK4A 1E7LA 1PRLC 4C5HA 3VS7A 1WXTA 2KRMA 3CMET 1YJ9Q 3NTHA 4PL6A 1Y57A 3M54A 3JB9G 1U1SA 4M7DG 2RK1A 4M75D 2VB6A 3BDLA 4RG2A 4F7UA 5KYXB 2FHDA 1VQ9T 2YRDA 2EKOA 1NJIU 4DBFA 2YWWA 2DKGA 5GAN8 1NJIC 2X35A 4KGZB 4FYWB 3MPUB 2CH4W 3PFSA 4MMKA 3JAME 4M77E 2C06A 2BE7D 1YWOA 2RMOA 1WA7A 1YJNT 5DLOA 5CAIA 2CDTA 2P4TA 2FZKB 5I21A 2MIOA 5FU6B 2EJGA 3EG2A 1ABOA 4NL2A 1ZSGA 2GF7A 2JJ9A 3GNFB 4BE2A 3QJYA 3OYJA 2DRKA 2QA4Q 2RQTA 2YUOA 3L2VA 4MMLA 2DL5A 4PJOC 4LE9A 2VC8A 3H6ZA 1VQNT 3MP1A 4M75C 4HVWA 2E12A 4ZTFA 3FLGA 1G3YA 4IURA 2FZGB 3CMEA 4PJOA 2DZCA 1WHGA 3CPWA 1EX4A 5CKHA 3LH0A 4JZ4A 3EH1A 3VS0A 1BK2A 1VQLQ 2XU8A 4M77A 2DO3A 4RMOA 2V8JA 1M8VA 1WQ7A 5IH2A 1TOVA 2VASA 4C0DC 1YITQ 4C92B 3CXCP 1UJ0A 4HCCA 4PFPA 3V8KA 2C0OA 2O4XB 4PJOG 1YHQA 2RNAA 2RK2A 2GTJA 1QP3A 4LDUA 4E7KA 3LX7A 4X34A 2ODGC 3V8LA 2K6DA 1WI7A 1KJWA 2LX7A 1JRIA 3EFSA 1TUDA 2QGGA 2JTFA 3N5BB 4ORZA 4BD3A 1VYVA 4AFZC 1KFZA 4QVZA 3ZL7C 3QWXX 4FW1A 5A0LA 2QAZA 4DOWA 5FRMA 1I5LA 5J26A 2EYYA 4J7IA 1X69A 4FW2A 5KCHA 5CO7A 4M75F 1VQ5T 1M2VB 4JRKA 4C8QA 2NYSA 4QKUA 1BCOA 2AT1B 3PT9A 2DL7A 5CKEA 4LD9K 3VS6A 2CREA 1KQ1A 1K9AA 2BTTA 1Q81C 3RMQA 3G71A 3CC2A 2IPOB 3CC2Q 1CSKA 3JCMJ 2RO0A 3QO3A 3CCEA 3HRTA 2A37A 2D1XA 1B7TA 3MEAA 3P8BB 1KQSP 1NM7A 3OQ5A 1T3SA 5FU7B 2YT6A 4BE1A 1S1NA 2A36A 2HBPA 4J9CA 3G4SA 1GJJA 2P0PA 1V29B 2O9SA 2KE9A 2YUQA 2E70A 2DL4A 2GBQA 2F5KA 4FSXA 1AWXA 1KC8R 1VQ5Q 4RCCA 3M4YA 4RTTA 2NLUA 3J80E 4KUDK 4ANJA 5DM7R 2MPHA 4FCYA 1R77A 2LP5A 2OAWA 2Z0WA 3CCRA 2D0NA 2LRQA 1M3CA 1OU8A 1X2KA 1BI0A 3CBPA 3VYGA 2ZGWA 1H92A 2HQXA 4IUTA 1VQ7A 4C92E 2H8HA 3MEWA 5KYYB 1EIFA 1X6OA 5CR2A 1QCFA 3RKWA 4Y91A 1VQ4T 3CPFA 2QEXQ 3LH5A 2O88A 3CC7A 1M9SA 1N8RR 2QXFA 2AZVA 4L59A 4C92F 4BB7A 1OULA 2WACA 1W2BP 1G8XA 4RUGA 4JJBA 2NUZA 3BDUA 3UT1A 4LNPA 1E6GA 1U06A 3MCAB 2DJQA 3QDFA 4F7UE 4ZGDB 3EG9A 3MKDA 1LJOA 5KYUB 1QLYA 2JS0A 1B34B 1W4SA 3M56A 2NWMA 1YWPA 2L0AA 3PIOA 3JV3A 3I56Q 1SSFA 1T0JA 2DTOA 3X24B 1QWFA 2EKHA 2QG9B 1M27C 3RUXA 4JLGA 3QIIA 1XQHA 5FROA 2DVEA 2BUDA 3L2ZA 3JCMV 1HD3A 4C8QC 2KQWA 4M78A 3M0QA 8ATCB 3A8OB 1NE8A 1M1KC 3P8HA 2J6OA 5LJ5e 4N4HA 1GBRA 2HJQA 2W51A 3S3OA 1AZEA 1ZX6A 3DLLA 1IB8A 1UHCA 1VQ9A 3UWNA 5GANe 1UUEA 4KH1B 3JCMQ 2A3LA 4C5IA 3CMAQ 3H0FA 5IT9E 4II1A 2SEMA 2OJ2A 3M55A 4UZWA 4RTVA 1WYXA 1WQWA 2KSSA 2RHYA 4F16A 4MZTA 1N5ZA 4KRTA 3DLMA 3RNJA 3HFNA 4BDYA 2KAFA 2CGHA 4EDUA 1W70A 2COYA 5FWBA 2RHXA 4ATOA 3OYDA 5C6SA 3SHWA 1QW1A 2RJCA 1K0XA 3V7RA 2PVGB 1MNEA 3OS0A 2XKOC 2F5TX 2OAUA 2K7AA 2EFIA 1UB4A 1FXXA 1SF9A 1Q7YC 1QMCA 3TCJA 3J7AF 4X1VA 3VS3A 3FEOA 5IN1A 2DERA 5J3BA 3C4SA 2OTJQ 2Y90A 1M3BA 5KE2A 2QDYB 3SB2A 2VKNA 3SDZA 4AFUC 4M4ZA 5CK9A 2FYKA 4C92D 3REAB 1M30A 2ENMA 2DK3A 1VOMA 3PVQA 1K9MU 2CP0A 3OYFA 2DXBA 1M1FA 1QVFS 4XU2A 3M58A 1W2BA 5GANj 1G2BA 2NUTB 4M75G 2AK5A 2KROA 1ZQ1A 1YJNQ 1YJNA 1SEMA 3GF5A 1WJRA 4JS4A 3L0OA 1XJWB 1W2BS 3TSZA 2ATCB 3CCJQ 4XU3A 1I4K1 1RABB 5GAOp 2CT3A 1EFNA 1OEBA 5C0MA 1N6AA 3JB9I 3QSUA 4LN2A 1R0CB 3JSCA 2Y4XA 1G83A 3KFVA 3CPWP 1K8AU 3HHTB 1HK9A 4BUGA 5GAN3 3S3NA 4M77C 1PD1A 1WNLA 5LL6S 1VQNA 2EQIA 2FPFA 3OYIA 1E7DA 1IHWA 2LT4A 1UGSB 1MUZA 2LQWA 4A4EA 1SHFA 1Y96B 2X4YA 1UJYA 1N9RA 1WFWA 4OF1A 5I22A 2CSIA 3NFCA 3CCMQ 1UTIA 1K8AC 3HP9A 5D7UA 4JLIA 2JM8A 3FJ5A 1QVFA 4XQ3A 3HRSA 1GL9B 1DJ7B 2M0YA 2DEUA 1ZS9A 3OYNA 1T3LA 4HKEA 2L2PA 3CCST 2JW4A 4JJNK 3EFOA 1N27A 1WPYA 4OGEA 3OW2S 2JT4A 3H0HA 2K2MA 2ROTA 3I56A 1I81A 5CVIA 2RNOA 1WZOA 2LQNA 3CMAA 3HSBA 1RLPC 2MWOA 3R6OA 5LJ3j 1GCQC 4L6V5 2RJDA 4HXJA 5EG2A 4C8QG 3EFOB 2WSCE 4ZGJB 3AT1B 1GRIA 3ZFJA 2ED0A 5IXBA 2JOYA 1BI3A 1G3SA 3UDCA 4PKCC 2ECZA 2O9VA 3WVEB 1CKAA 5ECAA 1LCKA 2ZPIB 4M75B 1BBZA 3JCMg 3OYHA 3G71T 1RAAB 2JXBA 3GIBA 2MMPA 1RL2A 3CXCA 3QYGB 4N0AA 1U5SA 1RUWA 1AHJB 3CC4T 3CBMA 3OYEA 1F1BB 3AHUA 1NPRA 2GQVA 4PJLA 5GAMj 1C0MA 1Q86U 1AD5A 4HVVA 2KR3A 4E7SA 3RMSA 2KFVA 5KYWA 1JB0E 1K9MC 3JCMc 1D3BB 1YNZA 2L3PA 4M7AB 1C6VX 1UGRB 2LC4A 4CRIA 1I5OB 1RAHB 3RESA 1HYOA 3UF4A 3M0TA 2V8KA 2QTVA 1M90R 1YHQQ 1QKWA 4DA4A 1LNXA 2JS2A 2KGTA 1Y02A 2ZZDA 2R58A 3CCJA 3KXTA 3SWNA 1PC0A 2GTOA 3T9NA 4C8QB 1Y7XA 2CZ6B 3CPWS 4ZTJA 1FYNA 1QVGA 4BY6B 6AT1B 3Q1JA 2X9HA 3L1AA 4E47A 4Y28E 1EZZB 2DF6A 3CCEQ 4J9HA 4KUIA 2YSQA 2X51A 1G3WA 3UPUA 2DBKA 1Q82R 2EYZA 2HKQB 3DB4A 1PG5B 4DEYA 2RNNA 1TUCA 2VYTA 5LJ3h 2J6FA 5KH6A 3VU3C 1BCMA 4J6YA 2CS7A 3CCQA 1YJWT 5GAOn 1VQLA 4RTXA 5LJ5j 3CCVA 5IXFA 4D6WA 2FG0A 5LJ5g 1JJ2S 4M7DE 1ZSZB 1VQ8Q 3X28B 2G6FX 2K2VA 1MNDA 1IGQA 3QZ5B 3QUIA 5IHIA 1K73U 3GPLA 2BZ8A 4E7LA 1E6HA 3A8MB 4OMNA 1K8AR 3EFRA 3MHXA 5GMKh 2RQWA 1VQKA 1VQKQ 2R5AA 1VQMT 4PJOD 1NYFA 2IVWA 3A8HB 2ODCI 3OS5A 5HK0A 1LVKA 2EGEA 4P5NA 1OU9A 1UGQB 1AWOA 3A8LB 3PIPA 1NBEB 2HMAA 3PE0A 3VS4A 2DPPB 3CCVQ 2K9GA 1QVGS 3A1PA 4HCKA 1FWZA 2XK0A 1K73C 1J3TA 1M8MA 2H3EB 1ACMB 1KHIA 5KYYA 3C0CA 3CCQT 2CZ1B 2QDLA 1YJWA 5GANd 1YIJQ 1RADB 5GANf 5D6XA 4PNOA 2ABLA 2LJ0A 4DOVA 3JB9F 1YIJT 4M7AA 4BY6C 3ER0A 2JVVA 2L3QA 3A5ZB 1WDXA 3ME9A 3BE3A 2DLPA 3BY7A 3RKYA 3GBQA 2GNCA 3EAEA 1Y0MA 2H3JA 1IREB 1VQMA 2FRYA 4E7IA 1IRXA 1PKSA 2IIMA 2NUPA 2O01E 3G7ZA 2X4JA 2E41A 1QVFP 3A8GB 4XTZA 2KYBA 1H9FA 1Q86R 1BKBA 1TSFA 3EGDA 1A63A 4A4GA 2F1LA 3NTKA 2DILA 2XG8D 3JCMW 5LJ3e 1UE9A 1X6BA 1YHQT 2QNCA 1RI9A 3QYHB 2A8VA 3H0IA 2KMTA 4RTUA 4LUEA 3FJPA 2A7YA 1JEQA 2YXYA 1Z9QA 3OYYA 4RKUE 1JJ2A 2P4RA 2E5QA 2DIGA 2QEXA 1NJIR 4CC2A 3KUFA 1H3ZA 2EQKA 2DFUA 1N9SA 1GCQA 1I07A 5GMKe 4BI3A 2GFUA 3JB9D 1Q82C 4M7DD 1UECA 5D6YA 3ZEHA 4J8OA 2GQIA 2DNUA 3I55A 2FPEA 1B3QA 3PNWC 3CCUQ 2OTLA 3HPWA 3M4GA 4C92A 5KE3A 5EC7A 2JTEA 2WSFE 2O4XA 2FB7A 3V8JA 2PQWA 3QWYA 3EHRA 3TREA 3G4SQ 3M59A 1W6XA 4EMKB 1AT1B 1MV3A 5KCOA 1JQQA 4FYYB 4A54A 5FU7C 2J06A 3EG3A 5GAN7 3MEVA 1YJ9T 2C0IA 5GAOr 1UHFA 4M7AC 1I8FA 4MDXA 3LGFA 4AFSC 3CCSA 2OTJT 4F17A 1JBMA 1X01A 1VQ9Q 3MP8A 1CKBA 4JJDA 2KXDA 3JCMb 2XICA 3OYMA 1V66A 5CKDA 2XDBA 1KHCA 2CUBA 2V1QA 5GAN2 1HJDA 3EGXB 4AG1C 4OMPA 3OA6A 1ARKA 3G6EQ 4JRPA 3CC2T 1OX9A 4BI4A 2IG0A 1VQOA 4RTWA 5LJ5d 2KXCA 2CP3A 2PTKA 4M78B 3CCSQ 3MO8A 2OTLQ 3JRZA 1UDLA 2LX9A 5CKFA 1XOVA 2RQUA 2QQRA 1G5VA 2DIQA 5L8RE 2W10A 4UC4A 2F2XA 3QDRB 1N8RU 1VQNQ 1ZA2B 4QVDA 1H3HA 1GKUB 2AIRB 1Q81R 4MZMA 5GAMg 4IIMA 2FRWA 5AYFA 2HEQA 2V26A 1VQ6Q 2P0QA 1WHJA 1V76A 2QASA 1Q86C 3JCMh 4ESRA 1X75C 2CSQA 2DE0X 3OBWA 3CCVT 1VQ7Q 2DETA 1UEBA 3HFOA 4M77G 2GCXA 4OMMA 3CEYA 1AOJA 5LJ3g 1KQSS 3CD6Q 2DM1A 3CD6A 2FZCB 3CCET 2XI9A 2L3SA 4EMGA 4AT1B 1D1AA 1KC8C 3D7SB 4IUVA 3TU4K 2F69A 3VRYA 2F2VA 1KG1A 1IO6A 4M7AD 3THKA 3CC4A 1ZA1B 3EGUA 2EW3A 2P0KA 2RI2A 2XHCA 3SWNC 4WTOB 2DD5A 3OMGA 5LJ3d 1IXDA 4PK4A 2BE9B 1B34A 4M77B 2RHIA 1VYUA 2JZ2A 1U8RA 4AMCA 2J7IA 4M78C 2V8IA 2RPNA 5DY9A 1UGVA 2EAYA 1RAGB 3NPFA 4R55A 3INZA 3VV0A 2D6FA 2PUOB 1AZGB 1VQPQ 1NLPC 1VQPA 2EVRA 2EPDA 1VQ6A 1KD1C 1M1GA 2RF0A 1UGPB 4JS5A 4A4FA 1U1TA 4WF2A 4PLLA 2MWPA 3VUZA 2HZYA 3CCLT 4Z89A 1RAEB 1VYTA 4J9DA 1VQKT 1MMGA 3UA7A 4A4KA 5A0GA 3VRZA 1RLQC 1S72Q 2BZXA 4TVRA 4E7HA 1SSHA 1X27A 2QA4T 2X3WD 3GOXA 5IAYA 1BIAA 3SFMA 4X9DA 4KGXB 4JZ3A 4IUQA 2DVJA 2DL3A 3I5SA 4Y92A 4C8QD 4BACA 1M1KR 1IZ6A 4E2FB 4QQ6A 1JJRA 2J6KA 3TVTA 2ZCFB 3J81E
chains in the Genus database with same CATH topology
3CPWS 4GY5A 4M77F 4YTLA 2XDPA 3QZ9B 4BY6B 5GAMf 4ZTJA 1QVGA 4QVZA 1YITA 4FL6A 3Q1JA 3L1AA 4HT8A 4E47A 5GAMd 4Y28E 5HY6A 5A0LA 2VXFA 4OB3B 3HRUA 4DOWA 4KUIA 5FRMA 1I5LA 4OB1B 3ASKA 2LVMA 4J7IA 5J26A 4V2SA 1G3WA 3UPUA 3BFMA 5KCHA 5CO7A 4M75F 1VQ5T 4FIBA 4RG8A 3DB4A 4JRKA 4XU0A 2RM4A 5FU6C 4C8QA 3JCMf 2QEXT 3OMCA 2VYTA 3PT9A 5LJ3h 4F7UF 2DXCA 5CKEA 5GAMe 4LD9K 3FB9A 2K57A 1KQ1A 5KH6A 3VU3C 4J6YA 2CS7A 3CCQA 5CKBA 3RMQA 3G71A 1YJWT 1Q81C 5GAOn 3OYGA 1YI2T 1VQLA 3JB9H 2L89A 3CC2A 4QW2A 5LJ5j 2AHJB 3CCVA 3JCMJ 4HCZA 4D6WA 5LJ5g 4M7DE 1JJ2S 2RO0A 2PUKB 2LDMA 3X28B 2K2VA 3QO3A 3CCEA 4A4HA 3HRTA 3QZ5B 3MEAA 3QUIA 3P8BB 2LQKA 3M57A 1K73U 3E1SA 2R57A 5FLXE 3OS1A 3GPLA 4E7LA 2DJZA 3A8MB 3OQ5A 5FU7B 3I55T 3F70A 4BE1A 3OYKA 3JCMP 2HBPA 3EFRA 3G4SA 3MHXA 5GMKh 3RIRA 1OZ3A 1VQKA 1D3BA 2P0PA 1V29B 2M1HA 2E70A 2R5AA 1VQMT 4PJOD 2IVWA 3A8HB 3OS5A 2E1HA 3H8ZA 3C12A 4OMFB 5HK0A 3OW2A 4ME7A 2CZ0B 4JRIA 3CD6T 4P5NA 2F5KA 2QQSA 4FSXA 1UGQB 3OSSC 2EIFA 5GMKm 2RHZA 3A8LB 4RCCA 3PIPA 3G6ET 1O9SA 3M4YA 3J80E 2NLUA 2BIVA 4KUDK 2DD4A 2X4XA 1VQ8A 2LCCA 2DPPB 1VQOT 2R5MA 4PLIA 5DM7R 2M0OA 3MEUA 4NOYA 5DLQE 1QVGS 2MAMA 2CYZB 1FWZA 5GAOl 4HCBA 2RI3A 2XK0A 4C8QF 3CCRA 1K73C 2LRQA 2M9UA 5A2QE 3WVDB 5CQXA 1PSFA 2EJFA 2KY9A 3HL8A 3CCUT 1BI0A 1KHIA 3OS2A 2PVDB 1VIEA 4EPCA 3CBPA 3VYGA 2ZGWA 5A0DA 2HQXA 4IUTA 2EYQA 2G3RA 3VKIA 4C92E 5GANh 1VQ7A 1KQSA 2K3YA 3PMIA 3MEWA 2CZ1B 3CCQT 2VUBA 1EIFA 1YJWA 1X6OA 5CR2A 1Y96A 5GANd 3JB9J 3RKWA 4Y91A 1VQ4T 3CPFA 2Y4YA 4XTUA 3OYAA 5GANf 3CC7A 1M9SA 5D6XA 4PNOA 3VJPA 1XTDA 2EWNA 2DTHA 2QXFA 4J83A 4J7FA 4L59A 3URGA 4BB7A 4C92F 2WACA 4DOVA 2E64A 3JB9F 1YIJT 4M7AA 4BY6C 1G3TA 1BI2A 1VQ5A 3ER0A 2JVVA 4C8QE 3A5ZB 5GAMh 3BDUA 3ME9A 3P8DA 4E7JA 3UT1A 1VQ8T 3OYBA 3BY7A 3RKYA 2RJFA 3MCAB 4B9WA 5CQYA 4F7UE 4M75A 3CCMT 3EAEA 3M9QA 4ZGDB 5GANg 3FIFA 2L5QA 4KULA 3MP6A 2H3JA 1IREB 1H641 1LJOA 1VQMA 2PU9B 4RCBA 1OYXA 4E7IA 4J5YA 5GAN5 2DXUA 1B34B 2O01E 1W4SA 3G7ZA 2X4JA 3M56A 3O8VA 4O6JA 2E41A 5HKCA 1TH7A 3FC3A 3A8GB 3PIOA 4M78G 3CXCS 4XTZA 3G6EA 3RERA 3L2UA 1YBYA 1SSFA 4O5VA 4Z02A 2DTOA 3X24B 3TEEA 4Q5WA 3G4ST 4LD6A 2HD0A 4XTVA 3RUXA 2GFAA 4JLGA 3QIIA 4FT4A 1BKBA 2K5FA 4X9CA 3X26B 2JN0A 1XQHA 1P92A 2LTOA 3LYIA 1BIBA 2DVEA 5FROA 4A4GA 3NTKA 5GMKl 2BUDA 2XG8D 3L2ZA 3JCMV 5LJ3e 2K4YA 2QA4A 3JCMW 1M90C 2E65A 4C8QC 2KQWA 4EMKC 1WJQA 4ZN1A 4M78A 1YHQT 2QQAA 3A8OB 1NE8A 2YRVA 2QI2A 2ZPBB 3QYHB 3X25B 1M1KC 2DXTA 1MHNA 2KMTA 2LCLA 3FJPA 3P8HA 4NS5A 2A7YA 3PGGA 2OTLT 2E6NA 3OYYA 4RKUE 1JJ2A 2EQJA 2RHUA 5LJ5e 4C92G 2FVUA 2JNGA 4N4HA 4ZGEB 4JUVA 2E5QA 3I56T 2DIGA 1MGQA 4M7AF 2QEXA 3S3OA 2K3XA 1KD1C 2WSEE 5LJ5h 3KUFA 3DLLA 4JDSA 3CMAT 1H3ZA 1HXDA 4KT0E 3OY9A 2EQKA 3CBOA 3HKSA 3M5AA 1N9SA 4C0ZA 4CI0C 3L2RA 2MF2A 1VQ9A 5FRNA 2L3RA 4M75E 3UWNA 2E6ZA 5GANe 2HAXA 4EMHA 3JCMQ 4EMKA 5GMKe 4BI3A 2A3LA 2GFUA 2FL7A 4C5IA 3QHSA 5IT9E 4II1A 3CCMA 5LJ5f 2RB6A 3JB9D 1Q82C 2XD0A 4M7DD 5D6WA 3M55A 1FX7A 5GAN4 2RA2A 1YJ9A 4XTYA 4M78F 1WQWA 3QXEB 5D6YA 3ZEHA 2KSSA 2RHYA 4DQ2A 2XDBA 3E9GA 4J8OA 2YLBA 4MZTA 1M4ZA 2MI6A 3DLMA 4LDYA 2KDSA 2I2LA 3HFNA 4L5GA 4BDYA 1M1KU 3I55A 2KAFA 2CGHA 3QJ6A 4QQDA 1BI1A 2ZPHB 4EDUA 2OTJA 2VGMA 3PNWC 4OB0B 4FT2A 2RHXA 4OVAA 3C94A 4ATOA 1VUBA 3OYDA 1VQLT 5C6SA 4J6WA 3HPWA 2OTLA 3M4GA 4C92A 5KE3A 1QW1A 2WSFE 1QP2A 2RJCA 4F7UB 4M78D 3V7RA 2O4XA 2PVGB 4XK8E 4OP0A 4XAXB 5I2MA 2FB7A 3OS0A 3DKMA 2XKOC 3V8JA 2B8AA 2PQWA 2ZPEB 3TREA 3FDRA 3M59A 2DZ9A 4IUPA 4QQGA 5GMKj 2F5TX 2OAUA 5I2SA 4EMKB 2EFIA 1UB4A 3LLRA 4OB2B 5KCOA 1FXXA 2QQ9A 2L8DA 1ZBXA 2DEQA 3RKXA 1Q7YC 2LNVA 4A54A 1VQPT 4N0AC 5FU7C 3TCJA 4MDWA 4M78E 5CIUA 3J7AF 3FEOA 3M53A 3META 1XNIA 5IN1A 5GAN7 5J3BA 3MEVA 1YJ9T 2PVOB 5GAOr 2D0QB 1Y71A 4M7AC 2EQMA 3C4SA 1I8FA 3OSVA 2Y90A 3CCRT 4MDXA 5KE2A 2QDYB 3LGFA 3SB2A 5M9OA 3SDZA 1WGSA 3CCSA 5GAOq 2OTJT 5CK9A 1JBMA 1X01A 2FYKA 4C92D 3MP8A 3CCLA 3ZBDA 2DK3A 3JCMb 1K9MU 2XICA 3OYMA 2KVQG 5CKDA 5CCAA 2XDDA 1S72T 3X20B 3OYFA 1Q82U 2DXBA 1M1FA 2K5LA 3GLXA 1KHCA 3CC7T 4XU2A 3VUBA 2JTMA 3M58A 3OYCA 1W2BA 1QVFS 4M7DB 3BW1A 4BI8B 5GANj 1O75A 4M75G 3S3MA 3QKJA 4C0FA 5GAN2 3CCJT 1ZQ1A 3GNGA 1YJNA 3GF5A 1WJRA 4JS4A 2ZPFB 2YHTA 4NL3A 1W2BS 2RJEA 4M7AG 3OA6A 3DB3A 4XU3A 2M16A 3JCMe 1LOJA 4JRPA 3CC2T 1I4K1 1N8RC 2BKDN 5GAOp 2RD1A 2IG0A 4BI4A 1VQOA 4PJOE 5LJ5d 4BDZA 5GMKi 2QQBA 4M78B 2RI5A 5C0MA 1N6AA 1VIFA 2VV5A 3QBYA 1OI1A 3JB9I 3LWHA 4C0GA 3QSUA 4BE0A 3JSCA 3MO8A 3JRZA 2LQ8A 2Y4XA 1K8AU 2LX9A 5CKFA 3HHTB 1XOVA 1HK9A 2QQRA 1G5VA 3NTIA 1Q7YU 5GAOm 3VYHB 2DIQA 5L8RE 4PJOF 4BUGA 5GAN3 4M7DG 2JUFA 4UC4A 3S3NA 4M77C 4M7AE 3QDRB 1WNLA 2RH2A 1N8RU 5LL6S 1VQNA 4QVDA 1WJSA 3C95A 4N4GA 3E9FA 1YITT 3OYIA 1NPPA 4M7DC 2LT4A 1VQ4A 1UGSB 4C92C 1ZHIA 3JCMX 3PMTA 4C5EA 4MZMA 2CKKA 4C5GA 4A53A 5GAMg 4XTWA 4A4EA 2HNIA 5AYFA 4IUUA 1Y96B 2X4YA 3V7SA 1YIJA 1N9RA 1PSEA 4XTXA 3L42A 4ELYC 4OF1A 3SWNB 4B9XA 1Y07A 2P0QA 3SD4A 4FU6A 2D9TA 2ZPGB 3LGLA 4HA8A 3V7CA 1NZ9A 1S72A 1Q86C 2KK4A 3JCMh 1X75C 3OBWA 3CCVT 1OZ2A 4C5HA 3NFCA 4IKFA 1UEBA 1K8AC 3HP9A 3PTAA 3HFOA 4M77G 4JLIA 2GCXA 1QVFA 3CEYA 4FM4B 4XQ3A 3CMET 1BYMA 3HRSA 5LJ3g 4J6XA 1KD1U 1KQSS 1DJ7B 3NTHA 4PL6A 3OYNA 3M54A 3JB9G 3CD6A 1U1SA 3CCET 2RK1A 3BDLA 4M75D 4HKEA 3GP8A 2DAQA 2XI9A 3OYLA 4RG2A 3CCST 4JJNK 4F7UA 1N27A 4EMGA 1WPYA 2FHDA 2E10A 4OGEA 2EKOA 3OW2S 1VQ9T 1NJIU 1KC8C 4IUVA 2DKGA 3TU4K 5GAN8 1M90U 2F69A 2YLCA 2X35A 1NJIC 1KG1A 4MZPA 3I56A 1I81A 4M7AD 3CC4A 2VXEA 5CVIA 4C0DB 3PFSA 4MMKA 3S6WA 3JAME 4M77E 3CMAA 2C06A 3R6OA 2MWOA 1VQ6T 5LJ3j 3HSBA 2P0KA 2RI2A 2XHCA 3SWNC 4N4IA 1YJNT 5DLOA 4L6V5 2RJDA 5EG2A 4C8QG 2WSCE 2DD5A 4ZGJB 3OMGA 5CAIA 1VQ7T 2EQUA 3L2QA 5LJ3d 3QG1A 3ZFJA 1B34A 2P4TA 4M77B 2RHIA 2JOYA 4QVCA 5I21A 1BI3A 1G3SA 3UDCA 4PKCC 3WVEB 2JZ2A 5FU6B 2EJGA 1U8RA 2ZPIB 4M75B 4NL2A 3JCMg 3OYHA 1QVPA 4M78C 2V8IA 2GF7A 3GNFB 5DY9A 2EAYA 4BE2A 3QJYA 3G71T 3OYJA 1YI2A 3GIBA 2MMPA 3INZA 3VV0A 4R55A 4OGCA 2D6FA 1RL2A 2PUOB 4XU1A 3CXCA 1Q81U 3L2VA 3QYGB 2K5IA 4N0AA 4MMLA 1VQPA 5J39A 1AHJB 4PJOC 5HK3A 2VC8A 3H6ZA 1VQNT 3CC4T 1VQ6A 3CBMA 3OYEA 3MP1A 3AHUA 1NPRA 2E12A 2GQVA 1M1GA 3KBGA 4M75C 2VGNA 3WXMB 3FLGA 1UGPB 4LDVA 4JS5A 4JRQA 4ZTFA 5GAMj 4LDXA 3OB9A 1G3YA 4IURA 1U1TA 4A4FA 3CMEA 2DZCA 4WF2A 4PJOA 4PLLA 3CPWA 1R8OB 4GLKA 5CKHA 1Q86U 4ZN3A 2MWPA 3VUZA 4M77D 3FRNA 3CCLT 4M7DA 3LH0A 5LJ3f 1VQKT 4LDWA 3RMSA 4A4KA 1JB0E 5A0GA 1GXIE 2XIDA 2XU8A 1K9MC 4M77A 1RI0A 3JCMc 2LT1A 4HT9A 2DO3A 3L2WA 3LW5E 4F7UG 4TVRA 1D3BB 2HQEA 2V8JA 3OBYA 1WQ7A 4RMOA 4E7HA 1M8VA 4C0DC 4M7AB 3QPHA 4C92B 2QA4T 4VUBA 1UGRB 2LC4A 4CRIA 3RESA 3GOXA 1KQ2A 5IAYA 1BIAA 4HCCA 4KBMB 3SFMA 3V8KA 2DTIA 2O4XB 4PJOG 1YCYA 2V8KA 4X9DA 3JCMd 1YHQA 3E19A 4DA4A 1KC8U 1M5Q1 1LNXA 2RK2A 5GAN6 1QP3A 4IUQA 2EJ9A 4LDUA 2ZZDA 2R58A 4C8QD 4BACA 4E7KA 3CCJA 3LX7A 4X34A 3V8LA 3KXTA 3SWNA 4PJOB 1IZ6A 3LWIA 4QQ6A 3CCUA 2X4WA 1JRIA 2CZ7B 4M7DF 3EFSA 2QTXA 3N5BB 4BD3A 2JTFA 3T9NA 4C8QB 1Y7XA 4ELZC 4R56A 2ZCFB 3J81E 2CZ6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG2 A;  3LLR A;  3ME9 A;  1N27 A;  3P8D A;  4GY5 A;  2XDP A;  5KCO A;  3UT1 A;  2FHD A;  4E7J A;  2L8D A;  2EKO A;  4QVZ A;  4FL6 A;  3OYB A;  3Q1J A;  2RJF A;  4IUV A;  4B9W A;  3EAE A;  3M9Q A;  5CIU A;  2X35 A;  3FEO A;  3MET A;  5FRM A;  1XNI A;  3MP6 A;  5IN1 A;  3ASK A;  3MEV A;  2LVM A;  5J26 A;  3PFS A;  2EQM A;  5KCH A;  1OYX A;  3C4S A;  4E7I A;  3S6W A;  5KE2 A;  2MWO A;  3DB4 A;  3LGF A;  5M9O A;  2P0K A;  1WGS A;  2RI2 A;  3O8V A;  3OMC A;  4N4I A;  2VYT A;  2RJD A;  3MP8 A;  3FC3 A;  5KH6 A;  3OMG A;  3L2U A;  2EQU A;  1SSF A;  3L2Q A;  4Z02 A;  3OYM A;  3OYF A;  3OYG A;  1KHC A;  2RHI A;  4Q5W A;  2L89 A;  3OYC A;  4QW2 A;  4LD6 A;  4HCZ A;  3S3M A;  2RO0 A;  2GFA A;  2JZ2 A;  3QII A;  3QKJ A;  2LDM A;  2LTO A;  3LYI A;  5FRO A;  4A4H A;  4A4G A;  3NTK A;  2BUD A;  3MEA A;  3OYH A;  1WJR A;  2GF7 A;  2R57 A;  1WJQ A;  3OS1 A;  2RJE A;  4E7L A;  4BE2 A;  3OA6 A;  3OQ5 A;  3DB3 A;  3OYJ A;  4ZTJ A;  2M16 A;  2YRV A;  3F70 A;  4BE1 A;  3OYK A;  1MHN A;  3P8H A;  4NS5 A;  3L2V A;  2BKD N;  1OZ3 A;  2E6N A;  5J39 A;  2IG0 A;  2M1H A;  2RHU A;  2EQJ A;  3H6Z A;  4BDZ A;  2R5A A;  4N4H A;  3OYE A;  3MP1 A;  2E5Q A;  2RI5 A;  2DIG A;  5C0M A;  3QBY A;  4ZTF A;  3FLG A;  1OI1 A;  3S3O A;  2K3X A;  4BE0 A;  3H8Z A;  3OB9 A;  3KUF A;  3MO8 A;  4IUR A;  4A4F A;  4PLL A;  1H3Z A;  2F5K A;  2QQS A;  3OY9 A;  2EQK A;  2QQR A;  2RHZ A;  2MWP A;  3NTI A;  3L2R A;  5FRN A;  1G5V A;  2DIQ A;  2L3R A;  3UWN A;  2NLU A;  2BIV A;  2X4X A;  4UC4 A;  3LH0 A;  3S3N A;  2LCC A;  2GFU A;  4C5I A;  2R5M A;  4PLI A;  2M0O A;  1WJS A;  4II1 A;  3MEU A;  3E9F A;  4N4G A;  5D6W A;  3OYI A;  1RI0 A;  2RI3 A;  3PMT A;  5D6Y A;  2XK0 A;  4C5E A;  3ZEH A;  2RHY A;  2CKK A;  4C5G A;  3L2W A;  3E9G A;  2LRQ A;  2HQE A;  3DLM A;  4A4E A;  4E7H A;  4IUU A;  2X4Y A;  4CRI A;  3OS2 A;  3GOX A;  4BDY A;  5IAY A;  3L42 A;  3QJ6 A;  4QQD A;  2HQX A;  4IUT A;  2O4X B;  2G3R A;  4B9X A;  4EDU A;  3SD4 A;  4FU6 A;  2D9T A;  3PNW C;  2K3Y A;  2RHX A;  4OVA A;  3LGL A;  3PMI A;  3MEW A;  3OYD A;  5C6S A;  4IUQ A;  5KE3 A;  1OZ2 A;  4C5H A;  2RJC A;  3OYA A;  2R58 A;  4IKF A;  4E7K A;  4BAC A;  5D6X A;  3LX7 A;  2O4X A;  4X34 A;  4QQ6 A;  4L59 A;  3CEY A;  3OS0 A;  2WAC A;  2X4W A;  2B8A A;  2PQW A;  4BD3 A;  2JTF A;  3FDR A;  3NTH A;  4PL6 A;  4IUP A;  4QQG A;  3OYN A;  3BDL A;  2DAQ A;  2EFI A;  3OYL A; 
#chains in the Genus database with same CATH topology
 4M77 F;  3QZ9 B;  1YIT A;  4HT8 A;  3CC7 Q;  5HY6 A;  4OB3 B;  4F14 A;  3HRU A;  1RAI B;  4OB1 B;  1PM3 A;  2QYZ A;  2LVM A;  2DK4 A;  3NHN A;  4FIB A;  4RG8 A;  5FU6 C;  4XU0 A;  2RM4 A;  3JCM f;  2CUD A;  3OMC A;  1YCS B;  4F7U F;  4HVU A;  2DXC A;  5GAM e;  3FB9 A;  2K57 A;  1WX6 A;  5CKB A;  1YI2 T;  3JB9 H;  2L89 A;  2O31 A;  2K3B A;  2AHJ B;  4HCZ A;  3R6N A;  1GFC A;  2PUK B;  2PZ1 A;  4A4H A;  1D1B A;  2ED1 A;  2LQK A;  3M57 A;  3OS1 A;  2DJZ A;  1OQK A;  4A63 B;  4E7Z A;  2HDA A;  1YN8 A;  3JCM P;  1M2O A;  1OZ3 A;  2M1H A;  3UAT A;  3I35 A;  1SKU B;  4OMF B;  3OW2 A;  3CCQ Q;  2CZ0 B;  4JRI A;  4OML A;  1VQO Q;  2NUP B;  5GMK m;  2RHZ A;  1O9S A;  2BIV A;  2DD4 A;  1AVZ C;  2X4X A;  1MMD A;  4FYX B;  2JM9 A;  2R5M A;  4PLI A;  2M0O A;  4NOY A;  2MAM A;  2CYZ B;  4HCB A;  1Q95 G;  1SRL A;  3WVD B;  1PSF A;  3HL8 A;  3M0U A;  4D8D A;  3CCU T;  1VIE A;  3ULR B;  5A0D A;  3VKI A;  2G3R A;  2HL3 A;  2K3Y A;  1VQM Q;  2VUB A;  3JB9 J;  1Y96 A;  2Y4Y A;  3OYA A;  2M02 A;  4J7F A;  1X2Q A;  2CP6 A;  2E64 A;  2JMA A;  1BI2 A;  1YI2 Q;  4C8Q E;  1ABQ A;  5GAM h;  3P8D A;  1VQ8 T;  3OYB A;  3EGX A;  1KIK A;  1OV3 A;  1SHG A;  3RBB B;  4D8K A;  5GAN g;  2YDL A;  2LJ1 A;  2L5Q A;  3FIF A;  4KUL A;  3MP6 A;  4CC7 A;  1H64 1;  1JXO A;  2PU9 B;  1OYX A;  1A0N B;  1TH7 A;  4CC4 B;  3FC3 A;  3CXC S;  4M78 G;  2EGA A;  3RER A;  1YBY A;  3RR6 A;  3TEE A;  4J9F A;  4Q5W A;  1TS9 A;  1C1A A;  2AKK A;  3VS5 A;  4LD6 A;  2CP5 A;  2HD0 A;  4J9I A;  4XTV A;  4X9C A;  4ZNX A;  1BIB A;  5GMK l;  4R0K A;  4EMK C;  1WJQ A;  2MK5 A;  3EG1 A;  2QQA A;  2MPX C;  3H9N A;  1VA7 A;  2YRV A;  1PCX A;  2ZPB B;  4PJJ A;  3VS2 A;  2DXT A;  2LCL A;  2OTL T;  2BZY A;  2LMJ A;  4NS5 A;  1JO8 A;  2E6N A;  4KH0 B;  2EQJ A;  2FVU A;  2JNG A;  3MJX A;  4M7A F;  2K3X A;  3EG9 B;  2WSE E;  5LJ5 h;  2AKL A;  4IIO A;  4JDS A;  2EBP A;  1NEB A;  1HXD A;  4KT0 E;  3H41 A;  3OY9 A;  3OW2 P;  3CBO A;  3HKS A;  3M5A A;  2C0T A;  4CI0 C;  3L2R A;  2MF2 A;  2E6Z A;  3A98 A;  4EMK A;  2FL7 A;  2QGF B;  3QHS A;  5LJ5 f;  2RB6 A;  1I1J A;  2XD0 A;  1I0C A;  4DEX A;  2A28 A;  5GAN 4;  2RA2 A;  1YJ9 A;  4XTY A;  4M78 F;  4DQ2 A;  3M0S A;  1M4Z A;  2MI6 A;  2MCN A;  2KDS A;  4L5G A;  5KYW B;  4F04 B;  3QJ6 A;  4QQD A;  1BI1 A;  1D0Z A;  2CT4 A;  2ZPH B;  2EYX A;  2OTJ A;  1PWT A;  1NYG A;  2VGM A;  4OVA A;  4FT2 A;  3C94 A;  2E5K A;  1VQL T;  4J6W A;  1OPK A;  1QP2 A;  2FO0 A;  4F7U B;  2HKN A;  4OP0 A;  3FDR A;  4QQG A;  2QNF A;  2CP2 A;  4QT7 A;  2QQ9 A;  2VVK A;  5FWC A;  3RKX A;  2O2O A;  1VQP T;  2V1R A;  4MDW A;  4M78 E;  3MET A;  1XNI A;  2PVO B;  1IHV A;  1WXB A;  3OSV A;  3CQT A;  5M9O A;  2LZ6 B;  1ZSZ C;  2LCS A;  2J05 A;  9ATC B;  3CCL A;  5KYX A;  3ZBD A;  1IGU A;  1NEG A;  1WHK A;  3CCL Q;  2F2W A;  3E2U A;  1K0S A;  5CCA A;  1S72 T;  3X20 B;  2VWF A;  1R0B G;  1Q82 U;  3GLX A;  2K5L A;  3CC7 T;  1YFN A;  1WXU A;  2JTM A;  3BW1 A;  4BI8 B;  3QKJ A;  1RAC B;  4C0F A;  2K79 A;  1LPL A;  3GNG A;  2YHT A;  4NL3 A;  2RJE A;  4M7A G;  3DB3 A;  2M16 A;  1N8R C;  2BKD N;  2LC3 A;  4PJO E;  2D8J A;  5GMK i;  2QQB A;  1OX8 A;  1VIF A;  2VV5 A;  3QBY A;  1K4U S;  3LWH A;  4BE0 A;  1K1Z A;  2MYS A;  1H8K A;  2KW9 A;  2LQ8 A;  2CH4 A;  4J9G A;  2YUN A;  1ZSZ A;  3NTI A;  4LXC A;  3VYH B;  4PJO F;  2JUF A;  4M7A E;  1OOT A;  2D8H A;  1WJS A;  3C95 A;  4OMO A;  4N4G A;  3E9F A;  5KYN A;  5GJV B;  1PNJ A;  4M7D C;  1VQ4 A;  4C92 C;  1ZHI A;  4C5E A;  2CKK A;  1ZUK A;  4A53 A;  4XTW A;  2DL8 A;  4IUU A;  2OX7 A;  3V7S A;  1PSE A;  3EHQ A;  3L42 A;  4ELY C;  1Y07 A;  2D9T A;  2ZPG B;  1S72 A;  1OZ2 A;  2A08 A;  4IKF A;  3PTA A;  3EG0 A;  4FM4 B;  1BYM A;  1ZBJ A;  4J6X A;  1KD1 U;  2FEI A;  1RAF B;  3GP8 A;  2DAQ A;  3OYL A;  3O5Z A;  1ZLM A;  5KYU A;  2E10 A;  1YP5 A;  2KEA A;  1QCN A;  1M90 U;  2YLC A;  2KYM A;  4MZP A;  1WHM A;  2VXE A;  4C0D B;  2X3X D;  3S6W A;  1VQ6 T;  2P84 A;  2KVD A;  1WHL A;  4N4I A;  1H9E A;  1JEG A;  1T0H A;  1VQ7 T;  2EQU A;  3L2Q A;  1MMN A;  7AT1 B;  1D0X A;  3QG1 A;  4FYV B;  1D0Y A;  2LD7 A;  4QVC A;  2SRC A;  4K11 A;  1QWE A;  1QVP A;  5IHN A;  1GL5 A;  1YI2 A;  2QK0 A;  4OGC A;  1Q81 U;  4XU1 A;  2K5I A;  3REB B;  5J39 A;  2PNI A;  5HK3 A;  3M0R A;  3KBG A;  1JXM A;  2VGN A;  3WXM B;  4LDV A;  4LDX A;  4Z88 A;  4JRQ A;  3OB9 A;  2EYW A;  1R8O B;  4GLK A;  2COW A;  4ZN3 A;  4DBR A;  1PKT A;  1GBQ A;  1U3O A;  2HCK A;  1Q7Y R;  4M77 D;  3FRN A;  3M0P A;  4M7D A;  2RQR A;  5LJ3 f;  4LDW A;  1GXI E;  2XID A;  1RI0 A;  2LT1 A;  2ZAE A;  4HT9 A;  3L2W A;  3LW5 E;  4F7U G;  4JPB W;  2HQE A;  3OBY A;  2WQG A;  3QPH A;  1QKX A;  4VUB A;  2COZ A;  1KQ2 A;  4KBM B;  2DTI A;  1YCY A;  3JCM d;  3E19 A;  4BIT A;  1KC8 U;  1M5Q 1;  5GAN 6;  1JEI A;  2YUP A;  5IHK A;  1WLP B;  2EJ9 A;  4PJO B;  1GFD A;  2ROL A;  3LWI A;  1FMK A;  2I0N A;  4RTY A;  3CCU A;  2X4W A;  2CZ7 B;  4M7D F;  2QTX A;  2E4H A;  1FMW A;  4ELZ C;  4R56 A;  4GY5 A;  4YTL A;  3VS1 A;  2KT8 A;  2DMO A;  2XDP A;  3I9Q A;  5GAM f;  4FL6 A;  5GAM d;  2VXF A;  3HTR A;  3PVL A;  3ASK A;  4V2S A;  3RDV A;  3BFM A;  2DYI A;  4DBQ A;  1PD0 A;  2QEX T;  2RQV A;  4B6M A;  2LJ3 A;  3OYG A;  2M51 A;  4QW2 A;  1H1J S;  2LDM A;  1A8V A;  4RTZ A;  4WCI A;  3E1S A;  2R57 A;  5FLX E;  3CME Q;  3I55 T;  3F70 A;  3OYK A;  1OPL A;  1AWW A;  3RIR A;  1D3B A;  2KNB B;  3NMZ C;  4J9E A;  2E1H A;  3H8Z A;  3C12 A;  4ME7 A;  3CD6 T;  2QQS A;  3OSS C;  2EIF A;  3EGD B;  3G6E T;  1NLO C;  8AT1 B;  1VQ8 A;  2LCC A;  1VQO T;  1A62 A;  4EIK A;  1AWJ A;  1ZUU A;  3MEU A;  3NGP A;  1SPK A;  5DLQ E;  2RI3 A;  1TTH B;  4C8Q F;  2M9U A;  4AFQ C;  5A2Q E;  5CQX A;  3SEM A;  2EJF A;  2KY9 A;  1W1F A;  1EN7 A;  3OS2 A;  2PVD B;  4EPC A;  3I5R A;  5I11 A;  2JVW A;  4JJC A;  2EYQ A;  1MV0 B;  5GAN h;  1KQS A;  1X6G A;  3PMI A;  5AT1 B;  1JU5 C;  4XTU A;  3VJP A;  1XTD A;  2EWN A;  2DTH A;  2RN8 A;  4J83 A;  1YNS A;  3URG A;  1K76 A;  1G3T A;  2KVU A;  1VQ5 A;  1WHH A;  1BU1 A;  5L23 A;  3IQL A;  1D1C A;  4E7J A;  2RJF A;  2KRS A;  4B9W A;  5CQY A;  3CCM T;  4M75 A;  3M9Q A;  2ESW A;  1ZUY A;  4RCB A;  4GBQ A;  4J5Y A;  5GAN 5;  2DXU A;  4DBH A;  3TSW A;  3O8V A;  4PFO A;  4O6J A;  5HKC A;  4PJM A;  3U23 A;  3G6E A;  2E3I A;  3L2U A;  4O5V A;  4Z02 A;  1K9M R;  4AG2 C;  3G4S T;  1FMV A;  5GAO l;  2GFA A;  4PJN A;  4FT4 A;  3X26 B;  2K5F A;  2JN0 A;  2JMC A;  3G1J A;  1P92 A;  2LTO A;  3LYI A;  2QA4 A;  2K4Y A;  1M90 C;  2E65 A;  2LNH B;  4ZN1 A;  2DRM A;  2KI7 A;  3X25 B;  2QI2 A;  1MHN A;  4FSS A;  1TXQ A;  3PGG A;  2RHU A;  1M2V A;  4C92 G;  4ZGE B;  4JUV A;  3I56 T;  3TQ7 P;  1MGQ A;  3I55 Q;  2KT1 A;  3CMA T;  2DYB A;  2EGC A;  4C0Z A;  5FRN A;  3EH2 A;  2L3R A;  4M75 E;  5FW9 A;  2KVE A;  2HAX A;  1V1C A;  2YRC A;  4EMH A;  4J9B A;  1ZBH A;  3CCM A;  3CCR Q;  5D6W A;  1FX7 A;  1YJW Q;  5HCK A;  1KSW A;  3QXE B;  3E9G A;  1JJ2 P;  2YLB A;  4LDY A;  2I2L A;  1M1K U;  4OB0 B;  2HBW A;  1VUB A;  4PFZ A;  1D09 B;  4M78 D;  4XK8 E;  2HQH A;  1SRM A;  4XAX B;  5I2M A;  3DKM A;  1MMA A;  2B8A A;  2ZPE B;  1KD1 R;  2DZ9 A;  4IUP A;  5GMK j;  1E7O A;  1Z9Z A;  5I2S A;  1X43 A;  3LLR A;  4OB2 B;  2A0F B;  1PRM C;  2L8D A;  2W0Z A;  1ZBX A;  2DEQ A;  5GJW B;  2LNV A;  4N0A C;  2CP7 A;  5CIU A;  2XMF A;  3M53 A;  2DX1 A;  1QVG P;  2D0Q B;  1Y71 A;  2EQM A;  4E6R A;  3CCR T;  1TWB A;  2HSE B;  1WGS A;  5GAO q;  2DA9 A;  1GCP A;  2AZS A;  1TUG B;  2DBM A;  2GGR A;  2KVQ G;  2XDD A;  2KRN A;  3VUB A;  1K73 R;  3OYC A;  1KK7 A;  4KGV B;  1SG5 A;  4M7D B;  1O75 A;  3S3M A;  1QQJ A;  3CCJ T;  1VQ4 Q;  2KBT A;  1QCO A;  2ZPF B;  2G80 A;  1BB9 A;  3JCM e;  1LOJ A;  3CC4 Q;  1UFF A;  2RD1 A;  4BDZ A;  2E3H A;  4CC3 A;  2RI5 A;  1OI1 A;  4C0G A;  2FPD A;  1UG1 A;  2OI3 A;  5GAO m;  2B86 A;  1Q7Y U;  1B07 A;  1PHT A;  2RH2 A;  2NUT A;  1WIE A;  1YIT T;  1AEY A;  1NG2 A;  1NPP A;  3G71 Q;  4GLM A;  3JCM X;  1TU0 B;  3UA6 A;  3PMT A;  1TG0 A;  4C5G A;  1HSQ A;  1M3A A;  2HSP A;  2HNI A;  4LUD A;  4Z8A A;  2MOX A;  1YIJ A;  4XTX A;  3SWN B;  4B9X A;  3SD4 A;  4FU6 A;  2HL5 C;  3LGL A;  4HA8 A;  3V7C A;  1NZ9 A;  4OMQ A;  2KK4 A;  1E7L A;  1PRL C;  4C5H A;  3VS7 A;  1WXT A;  2KRM A;  3CME T;  1YJ9 Q;  3NTH A;  4PL6 A;  1Y57 A;  3M54 A;  3JB9 G;  1U1S A;  4M7D G;  2RK1 A;  4M75 D;  2VB6 A;  3BDL A;  4RG2 A;  4F7U A;  5KYX B;  2FHD A;  1VQ9 T;  2YRD A;  2EKO A;  1NJI U;  4DBF A;  2YWW A;  2DKG A;  5GAN 8;  1NJI C;  2X35 A;  4KGZ B;  4FYW B;  3MPU B;  2CH4 W;  3PFS A;  4MMK A;  3JAM E;  4M77 E;  2C06 A;  2BE7 D;  1YWO A;  2RMO A;  1WA7 A;  1YJN T;  5DLO A;  5CAI A;  2CDT A;  2P4T A;  2FZK B;  5I21 A;  2MIO A;  5FU6 B;  2EJG A;  3EG2 A;  1ABO A;  4NL2 A;  1ZSG A;  2GF7 A;  2JJ9 A;  3GNF B;  4BE2 A;  3QJY A;  3OYJ A;  2DRK A;  2QA4 Q;  2RQT A;  2YUO A;  3L2V A;  4MML A;  2DL5 A;  4PJO C;  4LE9 A;  2VC8 A;  3H6Z A;  1VQN T;  3MP1 A;  4M75 C;  4HVW A;  2E12 A;  4ZTF A;  3FLG A;  1G3Y A;  4IUR A;  2FZG B;  3CME A;  4PJO A;  2DZC A;  1WHG A;  3CPW A;  1EX4 A;  5CKH A;  3LH0 A;  4JZ4 A;  3EH1 A;  3VS0 A;  1BK2 A;  1VQL Q;  2XU8 A;  4M77 A;  2DO3 A;  4RMO A;  2V8J A;  1M8V A;  1WQ7 A;  5IH2 A;  1TOV A;  2VAS A;  4C0D C;  1YIT Q;  4C92 B;  3CXC P;  1UJ0 A;  4HCC A;  4PFP A;  3V8K A;  2C0O A;  2O4X B;  4PJO G;  1YHQ A;  2RNA A;  2RK2 A;  2GTJ A;  1QP3 A;  4LDU A;  4E7K A;  3LX7 A;  4X34 A;  2ODG C;  3V8L A;  2K6D A;  1WI7 A;  1KJW A;  2LX7 A;  1JRI A;  3EFS A;  1TUD A;  2QGG A;  2JTF A;  3N5B B;  4ORZ A;  4BD3 A;  1VYV A;  4AFZ C;  1KFZ A;  4QVZ A;  3ZL7 C;  3QWX X;  4FW1 A;  5A0L A;  2QAZ A;  4DOW A;  5FRM A;  1I5L A;  5J26 A;  2EYY A;  4J7I A;  1X69 A;  4FW2 A;  5KCH A;  5CO7 A;  4M75 F;  1VQ5 T;  1M2V B;  4JRK A;  4C8Q A;  2NYS A;  4QKU A;  1BCO A;  2AT1 B;  3PT9 A;  2DL7 A;  5CKE A;  4LD9 K;  3VS6 A;  2CRE A;  1KQ1 A;  1K9A A;  2BTT A;  1Q81 C;  3RMQ A;  3G71 A;  3CC2 A;  2IPO B;  3CC2 Q;  1CSK A;  3JCM J;  2RO0 A;  3QO3 A;  3CCE A;  3HRT A;  2A37 A;  2D1X A;  1B7T A;  3MEA A;  3P8B B;  1KQS P;  1NM7 A;  3OQ5 A;  1T3S A;  5FU7 B;  2YT6 A;  4BE1 A;  1S1N A;  2A36 A;  2HBP A;  4J9C A;  3G4S A;  1GJJ A;  2P0P A;  1V29 B;  2O9S A;  2KE9 A;  2YUQ A;  2E70 A;  2DL4 A;  2GBQ A;  2F5K A;  4FSX A;  1AWX A;  1KC8 R;  1VQ5 Q;  4RCC A;  3M4Y A;  4RTT A;  2NLU A;  3J80 E;  4KUD K;  4ANJ A;  5DM7 R;  2MPH A;  4FCY A;  1R77 A;  2LP5 A;  2OAW A;  2Z0W A;  3CCR A;  2D0N A;  2LRQ A;  1M3C A;  1OU8 A;  1X2K A;  1BI0 A;  3CBP A;  3VYG A;  2ZGW A;  1H92 A;  2HQX A;  4IUT A;  1VQ7 A;  4C92 E;  2H8H A;  3MEW A;  5KYY B;  1EIF A;  1X6O A;  5CR2 A;  1QCF A;  3RKW A;  4Y91 A;  1VQ4 T;  3CPF A;  2QEX Q;  3LH5 A;  2O88 A;  3CC7 A;  1M9S A;  1N8R R;  2QXF A;  2AZV A;  4L59 A;  4C92 F;  4BB7 A;  1OUL A;  2WAC A;  1W2B P;  1G8X A;  4RUG A;  4JJB A;  2NUZ A;  3BDU A;  3UT1 A;  4LNP A;  1E6G A;  1U06 A;  3MCA B;  2DJQ A;  3QDF A;  4F7U E;  4ZGD B;  3EG9 A;  3MKD A;  1LJO A;  5KYU B;  1QLY A;  2JS0 A;  1B34 B;  1W4S A;  3M56 A;  2NWM A;  1YWP A;  2L0A A;  3PIO A;  3JV3 A;  3I56 Q;  1SSF A;  1T0J A;  2DTO A;  3X24 B;  1QWF A;  2EKH A;  2QG9 B;  1M27 C;  3RUX A;  4JLG A;  3QII A;  1XQH A;  5FRO A;  2DVE A;  2BUD A;  3L2Z A;  3JCM V;  1HD3 A;  4C8Q C;  2KQW A;  4M78 A;  3M0Q A;  8ATC B;  3A8O B;  1NE8 A;  1M1K C;  3P8H A;  2J6O A;  5LJ5 e;  4N4H A;  1GBR A;  2HJQ A;  2W51 A;  3S3O A;  1AZE A;  1ZX6 A;  3DLL A;  1IB8 A;  1UHC A;  1VQ9 A;  3UWN A;  5GAN e;  1UUE A;  4KH1 B;  3JCM Q;  2A3L A;  4C5I A;  3CMA Q;  3H0F A;  5IT9 E;  4II1 A;  2SEM A;  2OJ2 A;  3M55 A;  4UZW A;  4RTV A;  1WYX A;  1WQW A;  2KSS A;  2RHY A;  4F16 A;  4MZT A;  1N5Z A;  4KRT A;  3DLM A;  3RNJ A;  3HFN A;  4BDY A;  2KAF A;  2CGH A;  4EDU A;  1W70 A;  2COY A;  5FWB A;  2RHX A;  4ATO A;  3OYD A;  5C6S A;  3SHW A;  1QW1 A;  2RJC A;  1K0X A;  3V7R A;  2PVG B;  1MNE A;  3OS0 A;  2XKO C;  2F5T X;  2OAU A;  2K7A A;  2EFI A;  1UB4 A;  1FXX A;  1SF9 A;  1Q7Y C;  1QMC A;  3TCJ A;  3J7A F;  4X1V A;  3VS3 A;  3FEO A;  5IN1 A;  2DER A;  5J3B A;  3C4S A;  2OTJ Q;  2Y90 A;  1M3B A;  5KE2 A;  2QDY B;  3SB2 A;  2VKN A;  3SDZ A;  4AFU C;  4M4Z A;  5CK9 A;  2FYK A;  4C92 D;  3REA B;  1M30 A;  2ENM A;  2DK3 A;  1VOM A;  3PVQ A;  1K9M U;  2CP0 A;  3OYF A;  2DXB A;  1M1F A;  1QVF S;  4XU2 A;  3M58 A;  1W2B A;  5GAN j;  1G2B A;  2NUT B;  4M75 G;  2AK5 A;  2KRO A;  1ZQ1 A;  1YJN Q;  1YJN A;  1SEM A;  3GF5 A;  1WJR A;  4JS4 A;  3L0O A;  1XJW B;  1W2B S;  3TSZ A;  2ATC B;  3CCJ Q;  4XU3 A;  1I4K 1;  1RAB B;  5GAO p;  2CT3 A;  1EFN A;  1OEB A;  5C0M A;  1N6A A;  3JB9 I;  3QSU A;  4LN2 A;  1R0C B;  3JSC A;  2Y4X A;  1G83 A;  3KFV A;  3CPW P;  1K8A U;  3HHT B;  1HK9 A;  4BUG A;  5GAN 3;  3S3N A;  4M77 C;  1PD1 A;  1WNL A;  5LL6 S;  1VQN A;  2EQI A;  2FPF A;  3OYI A;  1E7D A;  1IHW A;  2LT4 A;  1UGS B;  1MUZ A;  2LQW A;  4A4E A;  1SHF A;  1Y96 B;  2X4Y A;  1UJY A;  1N9R A;  1WFW A;  4OF1 A;  5I22 A;  2CSI A;  3NFC A;  3CCM Q;  1UTI A;  1K8A C;  3HP9 A;  5D7U A;  4JLI A;  2JM8 A;  3FJ5 A;  1QVF A;  4XQ3 A;  3HRS A;  1GL9 B;  1DJ7 B;  2M0Y A;  2DEU A;  1ZS9 A;  3OYN A;  1T3L A;  4HKE A;  2L2P A;  3CCS T;  2JW4 A;  4JJN K;  3EFO A;  1N27 A;  1WPY A;  4OGE A;  3OW2 S;  2JT4 A;  3H0H A;  2K2M A;  2ROT A;  3I56 A;  1I81 A;  5CVI A;  2RNO A;  1WZO A;  2LQN A;  3CMA A;  3HSB A;  1RLP C;  2MWO A;  3R6O A;  5LJ3 j;  1GCQ C;  4L6V 5;  2RJD A;  4HXJ A;  5EG2 A;  4C8Q G;  3EFO B;  2WSC E;  4ZGJ B;  3AT1 B;  1GRI A;  3ZFJ A;  2ED0 A;  5IXB A;  2JOY A;  1BI3 A;  1G3S A;  3UDC A;  4PKC C;  2ECZ A;  2O9V A;  3WVE B;  1CKA A;  5ECA A;  1LCK A;  2ZPI B;  4M75 B;  1BBZ A;  3JCM g;  3OYH A;  3G71 T;  1RAA B;  2JXB A;  3GIB A;  2MMP A;  1RL2 A;  3CXC A;  3QYG B;  4N0A A;  1U5S A;  1RUW A;  1AHJ B;  3CC4 T;  3CBM A;  3OYE A;  1F1B B;  3AHU A;  1NPR A;  2GQV A;  4PJL A;  5GAM j;  1C0M A;  1Q86 U;  1AD5 A;  4HVV A;  2KR3 A;  4E7S A;  3RMS A;  2KFV A;  5KYW A;  1JB0 E;  1K9M C;  3JCM c;  1D3B B;  1YNZ A;  2L3P A;  4M7A B;  1C6V X;  1UGR B;  2LC4 A;  4CRI A;  1I5O B;  1RAH B;  3RES A;  1HYO A;  3UF4 A;  3M0T A;  2V8K A;  2QTV A;  1M90 R;  1YHQ Q;  1QKW A;  4DA4 A;  1LNX A;  2JS2 A;  2KGT A;  1Y02 A;  2ZZD A;  2R58 A;  3CCJ A;  3KXT A;  3SWN A;  1PC0 A;  2GTO A;  3T9N A;  4C8Q B;  1Y7X A;  2CZ6 B;  3CPW S;  4ZTJ A;  1FYN A;  1QVG A;  4BY6 B;  6AT1 B;  3Q1J A;  2X9H A;  3L1A A;  4E47 A;  4Y28 E;  1EZZ B;  2DF6 A;  3CCE Q;  4J9H A;  4KUI A;  2YSQ A;  2X51 A;  1G3W A;  3UPU A;  2DBK A;  1Q82 R;  2EYZ A;  2HKQ B;  3DB4 A;  1PG5 B;  4DEY A;  2RNN A;  1TUC A;  2VYT A;  5LJ3 h;  2J6F A;  5KH6 A;  3VU3 C;  1BCM A;  4J6Y A;  2CS7 A;  3CCQ A;  1YJW T;  5GAO n;  1VQL A;  4RTX A;  5LJ5 j;  3CCV A;  5IXF A;  4D6W A;  2FG0 A;  5LJ5 g;  1JJ2 S;  4M7D E;  1ZSZ B;  1VQ8 Q;  3X28 B;  2G6F X;  2K2V A;  1MND A;  1IGQ A;  3QZ5 B;  3QUI A;  5IHI A;  1K73 U;  3GPL A;  2BZ8 A;  4E7L A;  1E6H A;  3A8M B;  4OMN A;  1K8A R;  3EFR A;  3MHX A;  5GMK h;  2RQW A;  1VQK A;  1VQK Q;  2R5A A;  1VQM T;  4PJO D;  1NYF A;  2IVW A;  3A8H B;  2ODC I;  3OS5 A;  5HK0 A;  1LVK A;  2EGE A;  4P5N A;  1OU9 A;  1UGQ B;  1AWO A;  3A8L B;  3PIP A;  1NBE B;  2HMA A;  3PE0 A;  3VS4 A;  2DPP B;  3CCV Q;  2K9G A;  1QVG S;  3A1P A;  4HCK A;  1FWZ A;  2XK0 A;  1K73 C;  1J3T A;  1M8M A;  2H3E B;  1ACM B;  1KHI A;  5KYY A;  3C0C A;  3CCQ T;  2CZ1 B;  2QDL A;  1YJW A;  5GAN d;  1YIJ Q;  1RAD B;  5GAN f;  5D6X A;  4PNO A;  2ABL A;  2LJ0 A;  4DOV A;  3JB9 F;  1YIJ T;  4M7A A;  4BY6 C;  3ER0 A;  2JVV A;  2L3Q A;  3A5Z B;  1WDX A;  3ME9 A;  3BE3 A;  2DLP A;  3BY7 A;  3RKY A;  3GBQ A;  2GNC A;  3EAE A;  1Y0M A;  2H3J A;  1IRE B;  1VQM A;  2FRY A;  4E7I A;  1IRX A;  1PKS A;  2IIM A;  2NUP A;  2O01 E;  3G7Z A;  2X4J A;  2E41 A;  1QVF P;  3A8G B;  4XTZ A;  2KYB A;  1H9F A;  1Q86 R;  1BKB A;  1TSF A;  3EGD A;  1A63 A;  4A4G A;  2F1L A;  3NTK A;  2DIL A;  2XG8 D;  3JCM W;  5LJ3 e;  1UE9 A;  1X6B A;  1YHQ T;  2QNC A;  1RI9 A;  3QYH B;  2A8V A;  3H0I A;  2KMT A;  4RTU A;  4LUE A;  3FJP A;  2A7Y A;  1JEQ A;  2YXY A;  1Z9Q A;  3OYY A;  4RKU E;  1JJ2 A;  2P4R A;  2E5Q A;  2DIG A;  2QEX A;  1NJI R;  4CC2 A;  3KUF A;  1H3Z A;  2EQK A;  2DFU A;  1N9S A;  1GCQ A;  1I07 A;  5GMK e;  4BI3 A;  2GFU A;  3JB9 D;  1Q82 C;  4M7D D;  1UEC A;  5D6Y A;  3ZEH A;  4J8O A;  2GQI A;  2DNU A;  3I55 A;  2FPE A;  1B3Q A;  3PNW C;  3CCU Q;  2OTL A;  3HPW A;  3M4G A;  4C92 A;  5KE3 A;  5EC7 A;  2JTE A;  2WSF E;  2O4X A;  2FB7 A;  3V8J A;  2PQW A;  3QWY A;  3EHR A;  3TRE A;  3G4S Q;  3M59 A;  1W6X A;  4EMK B;  1AT1 B;  1MV3 A;  5KCO A;  1JQQ A;  4FYY B;  4A54 A;  5FU7 C;  2J06 A;  3EG3 A;  5GAN 7;  3MEV A;  1YJ9 T;  2C0I A;  5GAO r;  1UHF A;  4M7A C;  1I8F A;  4MDX A;  3LGF A;  4AFS C;  3CCS A;  2OTJ T;  4F17 A;  1JBM A;  1X01 A;  1VQ9 Q;  3MP8 A;  1CKB A;  4JJD A;  2KXD A;  3JCM b;  2XIC A;  3OYM A;  1V66 A;  5CKD A;  2XDB A;  1KHC A;  2CUB A;  2V1Q A;  5GAN 2;  1HJD A;  3EGX B;  4AG1 C;  4OMP A;  3OA6 A;  1ARK A;  3G6E Q;  4JRP A;  3CC2 T;  1OX9 A;  4BI4 A;  2IG0 A;  1VQO A;  4RTW A;  5LJ5 d;  2KXC A;  2CP3 A;  2PTK A;  4M78 B;  3CCS Q;  3MO8 A;  2OTL Q;  3JRZ A;  1UDL A;  2LX9 A;  5CKF A;  1XOV A;  2RQU A;  2QQR A;  1G5V A;  2DIQ A;  5L8R E;  2W10 A;  4UC4 A;  2F2X A;  3QDR B;  1N8R U;  1VQN Q;  1ZA2 B;  4QVD A;  1H3H A;  1GKU B;  2AIR B;  1Q81 R;  4MZM A;  5GAM g;  4IIM A;  2FRW A;  5AYF A;  2HEQ A;  2V26 A;  1VQ6 Q;  2P0Q A;  1WHJ A;  1V76 A;  2QAS A;  1Q86 C;  3JCM h;  4ESR A;  1X75 C;  2CSQ A;  2DE0 X;  3OBW A;  3CCV T;  1VQ7 Q;  2DET A;  1UEB A;  3HFO A;  4M77 G;  2GCX A;  4OMM A;  3CEY A;  1AOJ A;  5LJ3 g;  1KQS S;  3CD6 Q;  2DM1 A;  3CD6 A;  2FZC B;  3CCE T;  2XI9 A;  2L3S A;  4EMG A;  4AT1 B;  1D1A A;  1KC8 C;  3D7S B;  4IUV A;  3TU4 K;  2F69 A;  3VRY A;  2F2V A;  1KG1 A;  1IO6 A;  4M7A D;  3THK A;  3CC4 A;  1ZA1 B;  3EGU A;  2EW3 A;  2P0K A;  2RI2 A;  2XHC A;  3SWN C;  4WTO B;  2DD5 A;  3OMG A;  5LJ3 d;  1IXD A;  4PK4 A;  2BE9 B;  1B34 A;  4M77 B;  2RHI A;  1VYU A;  2JZ2 A;  1U8R A;  4AMC A;  2J7I A;  4M78 C;  2V8I A;  2RPN A;  5DY9 A;  1UGV A;  2EAY A;  1RAG B;  3NPF A;  4R55 A;  3INZ A;  3VV0 A;  2D6F A;  2PUO B;  1AZG B;  1VQP Q;  1NLP C;  1VQP A;  2EVR A;  2EPD A;  1VQ6 A;  1KD1 C;  1M1G A;  2RF0 A;  1UGP B;  4JS5 A;  4A4F A;  1U1T A;  4WF2 A;  4PLL A;  2MWP A;  3VUZ A;  2HZY A;  3CCL T;  4Z89 A;  1RAE B;  1VYT A;  4J9D A;  1VQK T;  1MMG A;  3UA7 A;  4A4K A;  5A0G A;  3VRZ A;  1RLQ C;  1S72 Q;  2BZX A;  4TVR A;  4E7H A;  1SSH A;  1X27 A;  2QA4 T;  2X3W D;  3GOX A;  5IAY A;  1BIA A;  3SFM A;  4X9D A;  4KGX B;  4JZ3 A;  4IUQ A;  2DVJ A;  2DL3 A;  3I5S A;  4Y92 A;  4C8Q D;  4BAC A;  1M1K R;  1IZ6 A;  4E2F B;  4QQ6 A;  1JJR A;  2J6K A;  3TVT A;  2ZCF B;  3J81 E; 
#chains in the Genus database with same CATH homology
 3CPW S;  4GY5 A;  4M77 F;  4YTL A;  2XDP A;  3QZ9 B;  4BY6 B;  5GAM f;  4ZTJ A;  1QVG A;  4QVZ A;  1YIT A;  4FL6 A;  3Q1J A;  3L1A A;  4HT8 A;  4E47 A;  5GAM d;  4Y28 E;  5HY6 A;  5A0L A;  2VXF A;  4OB3 B;  3HRU A;  4DOW A;  4KUI A;  5FRM A;  1I5L A;  4OB1 B;  3ASK A;  2LVM A;  4J7I A;  5J26 A;  4V2S A;  1G3W A;  3UPU A;  3BFM A;  5KCH A;  5CO7 A;  4M75 F;  1VQ5 T;  4FIB A;  4RG8 A;  3DB4 A;  4JRK A;  4XU0 A;  2RM4 A;  5FU6 C;  4C8Q A;  3JCM f;  2QEX T;  3OMC A;  2VYT A;  3PT9 A;  5LJ3 h;  4F7U F;  2DXC A;  5CKE A;  5GAM e;  4LD9 K;  3FB9 A;  2K57 A;  1KQ1 A;  5KH6 A;  3VU3 C;  4J6Y A;  2CS7 A;  3CCQ A;  5CKB A;  3RMQ A;  3G71 A;  1YJW T;  1Q81 C;  5GAO n;  3OYG A;  1YI2 T;  1VQL A;  3JB9 H;  2L89 A;  3CC2 A;  4QW2 A;  5LJ5 j;  2AHJ B;  3CCV A;  3JCM J;  4HCZ A;  4D6W A;  5LJ5 g;  4M7D E;  1JJ2 S;  2RO0 A;  2PUK B;  2LDM A;  3X28 B;  2K2V A;  3QO3 A;  3CCE A;  4A4H A;  3HRT A;  3QZ5 B;  3MEA A;  3QUI A;  3P8B B;  2LQK A;  3M57 A;  1K73 U;  3E1S A;  2R57 A;  5FLX E;  3OS1 A;  3GPL A;  4E7L A;  2DJZ A;  3A8M B;  3OQ5 A;  5FU7 B;  3I55 T;  3F70 A;  4BE1 A;  3OYK A;  3JCM P;  2HBP A;  3EFR A;  3G4S A;  3MHX A;  5GMK h;  3RIR A;  1OZ3 A;  1VQK A;  1D3B A;  2P0P A;  1V29 B;  2M1H A;  2E70 A;  2R5A A;  1VQM T;  4PJO D;  2IVW A;  3A8H B;  3OS5 A;  2E1H A;  3H8Z A;  3C12 A;  4OMF B;  5HK0 A;  3OW2 A;  4ME7 A;  2CZ0 B;  4JRI A;  3CD6 T;  4P5N A;  2F5K A;  2QQS A;  4FSX A;  1UGQ B;  3OSS C;  2EIF A;  5GMK m;  2RHZ A;  3A8L B;  4RCC A;  3PIP A;  3G6E T;  1O9S A;  3M4Y A;  3J80 E;  2NLU A;  2BIV A;  4KUD K;  2DD4 A;  2X4X A;  1VQ8 A;  2LCC A;  2DPP B;  1VQO T;  2R5M A;  4PLI A;  5DM7 R;  2M0O A;  3MEU A;  4NOY A;  5DLQ E;  1QVG S;  2MAM A;  2CYZ B;  1FWZ A;  5GAO l;  4HCB A;  2RI3 A;  2XK0 A;  4C8Q F;  3CCR A;  1K73 C;  2LRQ A;  2M9U A;  5A2Q E;  3WVD B;  5CQX A;  1PSF A;  2EJF A;  2KY9 A;  3HL8 A;  3CCU T;  1BI0 A;  1KHI A;  3OS2 A;  2PVD B;  1VIE A;  4EPC A;  3CBP A;  3VYG A;  2ZGW A;  5A0D A;  2HQX A;  4IUT A;  2EYQ A;  2G3R A;  3VKI A;  4C92 E;  5GAN h;  1VQ7 A;  1KQS A;  2K3Y A;  3PMI A;  3MEW A;  2CZ1 B;  3CCQ T;  2VUB A;  1EIF A;  1YJW A;  1X6O A;  5CR2 A;  1Y96 A;  5GAN d;  3JB9 J;  3RKW A;  4Y91 A;  1VQ4 T;  3CPF A;  2Y4Y A;  4XTU A;  3OYA A;  5GAN f;  3CC7 A;  1M9S A;  5D6X A;  4PNO A;  3VJP A;  1XTD A;  2EWN A;  2DTH A;  2QXF A;  4J83 A;  4J7F A;  4L59 A;  3URG A;  4BB7 A;  4C92 F;  2WAC A;  4DOV A;  2E64 A;  3JB9 F;  1YIJ T;  4M7A A;  4BY6 C;  1G3T A;  1BI2 A;  1VQ5 A;  3ER0 A;  2JVV A;  4C8Q E;  3A5Z B;  5GAM h;  3BDU A;  3ME9 A;  3P8D A;  4E7J A;  3UT1 A;  1VQ8 T;  3OYB A;  3BY7 A;  3RKY A;  2RJF A;  3MCA B;  4B9W A;  5CQY A;  4F7U E;  4M75 A;  3CCM T;  3EAE A;  3M9Q A;  4ZGD B;  5GAN g;  3FIF A;  2L5Q A;  4KUL A;  3MP6 A;  2H3J A;  1IRE B;  1H64 1;  1LJO A;  1VQM A;  2PU9 B;  4RCB A;  1OYX A;  4E7I A;  4J5Y A;  5GAN 5;  2DXU A;  1B34 B;  2O01 E;  1W4S A;  3G7Z A;  2X4J A;  3M56 A;  3O8V A;  4O6J A;  2E41 A;  5HKC A;  1TH7 A;  3FC3 A;  3A8G B;  3PIO A;  4M78 G;  3CXC S;  4XTZ A;  3G6E A;  3RER A;  3L2U A;  1YBY A;  1SSF A;  4O5V A;  4Z02 A;  2DTO A;  3X24 B;  3TEE A;  4Q5W A;  3G4S T;  4LD6 A;  2HD0 A;  4XTV A;  3RUX A;  2GFA A;  4JLG A;  3QII A;  4FT4 A;  1BKB A;  2K5F A;  4X9C A;  3X26 B;  2JN0 A;  1XQH A;  1P92 A;  2LTO A;  3LYI A;  1BIB A;  2DVE A;  5FRO A;  4A4G A;  3NTK A;  5GMK l;  2BUD A;  2XG8 D;  3L2Z A;  3JCM V;  5LJ3 e;  2K4Y A;  2QA4 A;  3JCM W;  1M90 C;  2E65 A;  4C8Q C;  2KQW A;  4EMK C;  1WJQ A;  4ZN1 A;  4M78 A;  1YHQ T;  2QQA A;  3A8O B;  1NE8 A;  2YRV A;  2QI2 A;  2ZPB B;  3QYH B;  3X25 B;  1M1K C;  2DXT A;  1MHN A;  2KMT A;  2LCL A;  3FJP A;  3P8H A;  4NS5 A;  2A7Y A;  3PGG A;  2OTL T;  2E6N A;  3OYY A;  4RKU E;  1JJ2 A;  2EQJ A;  2RHU A;  5LJ5 e;  4C92 G;  2FVU A;  2JNG A;  4N4H A;  4ZGE B;  4JUV A;  2E5Q A;  3I56 T;  2DIG A;  1MGQ A;  4M7A F;  2QEX A;  3S3O A;  2K3X A;  1KD1 C;  2WSE E;  5LJ5 h;  3KUF A;  3DLL A;  4JDS A;  3CMA T;  1H3Z A;  1HXD A;  4KT0 E;  3OY9 A;  2EQK A;  3CBO A;  3HKS A;  3M5A A;  1N9S A;  4C0Z A;  4CI0 C;  3L2R A;  2MF2 A;  1VQ9 A;  5FRN A;  2L3R A;  4M75 E;  3UWN A;  2E6Z A;  5GAN e;  2HAX A;  4EMH A;  3JCM Q;  4EMK A;  5GMK e;  4BI3 A;  2A3L A;  2GFU A;  2FL7 A;  4C5I A;  3QHS A;  5IT9 E;  4II1 A;  3CCM A;  5LJ5 f;  2RB6 A;  3JB9 D;  1Q82 C;  2XD0 A;  4M7D D;  5D6W A;  3M55 A;  1FX7 A;  5GAN 4;  2RA2 A;  1YJ9 A;  4XTY A;  4M78 F;  1WQW A;  3QXE B;  5D6Y A;  3ZEH A;  2KSS A;  2RHY A;  4DQ2 A;  2XDB A;  3E9G A;  4J8O A;  2YLB A;  4MZT A;  1M4Z A;  2MI6 A;  3DLM A;  4LDY A;  2KDS A;  2I2L A;  3HFN A;  4L5G A;  4BDY A;  1M1K U;  3I55 A;  2KAF A;  2CGH A;  3QJ6 A;  4QQD A;  1BI1 A;  2ZPH B;  4EDU A;  2OTJ A;  2VGM A;  3PNW C;  4OB0 B;  4FT2 A;  2RHX A;  4OVA A;  3C94 A;  4ATO A;  1VUB A;  3OYD A;  1VQL T;  5C6S A;  4J6W A;  3HPW A;  2OTL A;  3M4G A;  4C92 A;  5KE3 A;  1QW1 A;  2WSF E;  1QP2 A;  2RJC A;  4F7U B;  4M78 D;  3V7R A;  2O4X A;  2PVG B;  4XK8 E;  4OP0 A;  4XAX B;  5I2M A;  2FB7 A;  3OS0 A;  3DKM A;  2XKO C;  3V8J A;  2B8A A;  2PQW A;  2ZPE B;  3TRE A;  3FDR A;  3M59 A;  2DZ9 A;  4IUP A;  4QQG A;  5GMK j;  2F5T X;  2OAU A;  5I2S A;  4EMK B;  2EFI A;  1UB4 A;  3LLR A;  4OB2 B;  5KCO A;  1FXX A;  2QQ9 A;  2L8D A;  1ZBX A;  2DEQ A;  3RKX A;  1Q7Y C;  2LNV A;  4A54 A;  1VQP T;  4N0A C;  5FU7 C;  3TCJ A;  4MDW A;  4M78 E;  5CIU A;  3J7A F;  3FEO A;  3M53 A;  3MET A;  1XNI A;  5IN1 A;  5GAN 7;  5J3B A;  3MEV A;  1YJ9 T;  2PVO B;  5GAO r;  2D0Q B;  1Y71 A;  4M7A C;  2EQM A;  3C4S A;  1I8F A;  3OSV A;  2Y90 A;  3CCR T;  4MDX A;  5KE2 A;  2QDY B;  3LGF A;  3SB2 A;  5M9O A;  3SDZ A;  1WGS A;  3CCS A;  5GAO q;  2OTJ T;  5CK9 A;  1JBM A;  1X01 A;  2FYK A;  4C92 D;  3MP8 A;  3CCL A;  3ZBD A;  2DK3 A;  3JCM b;  1K9M U;  2XIC A;  3OYM A;  2KVQ G;  5CKD A;  5CCA A;  2XDD A;  1S72 T;  3X20 B;  3OYF A;  1Q82 U;  2DXB A;  1M1F A;  2K5L A;  3GLX A;  1KHC A;  3CC7 T;  4XU2 A;  3VUB A;  2JTM A;  3M58 A;  3OYC A;  1W2B A;  1QVF S;  4M7D B;  3BW1 A;  4BI8 B;  5GAN j;  1O75 A;  4M75 G;  3S3M A;  3QKJ A;  4C0F A;  5GAN 2;  3CCJ T;  1ZQ1 A;  3GNG A;  1YJN A;  3GF5 A;  1WJR A;  4JS4 A;  2ZPF B;  2YHT A;  4NL3 A;  1W2B S;  2RJE A;  4M7A G;  3OA6 A;  3DB3 A;  4XU3 A;  2M16 A;  3JCM e;  1LOJ A;  4JRP A;  3CC2 T;  1I4K 1;  1N8R C;  2BKD N;  5GAO p;  2RD1 A;  2IG0 A;  4BI4 A;  1VQO A;  4PJO E;  5LJ5 d;  4BDZ A;  5GMK i;  2QQB A;  4M78 B;  2RI5 A;  5C0M A;  1N6A A;  1VIF A;  2VV5 A;  3QBY A;  1OI1 A;  3JB9 I;  3LWH A;  4C0G A;  3QSU A;  4BE0 A;  3JSC A;  3MO8 A;  3JRZ A;  2LQ8 A;  2Y4X A;  1K8A U;  2LX9 A;  5CKF A;  3HHT B;  1XOV A;  1HK9 A;  2QQR A;  1G5V A;  3NTI A;  1Q7Y U;  5GAO m;  3VYH B;  2DIQ A;  5L8R E;  4PJO F;  4BUG A;  5GAN 3;  4M7D G;  2JUF A;  4UC4 A;  3S3N A;  4M77 C;  4M7A E;  3QDR B;  1WNL A;  2RH2 A;  1N8R U;  5LL6 S;  1VQN A;  4QVD A;  1WJS A;  3C95 A;  4N4G A;  3E9F A;  1YIT T;  3OYI A;  1NPP A;  4M7D C;  2LT4 A;  1VQ4 A;  1UGS B;  4C92 C;  1ZHI A;  3JCM X;  3PMT A;  4C5E A;  4MZM A;  2CKK A;  4C5G A;  4A53 A;  5GAM g;  4XTW A;  4A4E A;  2HNI A;  5AYF A;  4IUU A;  1Y96 B;  2X4Y A;  3V7S A;  1YIJ A;  1N9R A;  1PSE A;  4XTX A;  3L42 A;  4ELY C;  4OF1 A;  3SWN B;  4B9X A;  1Y07 A;  2P0Q A;  3SD4 A;  4FU6 A;  2D9T A;  2ZPG B;  3LGL A;  4HA8 A;  3V7C A;  1NZ9 A;  1S72 A;  1Q86 C;  2KK4 A;  3JCM h;  1X75 C;  3OBW A;  3CCV T;  1OZ2 A;  4C5H A;  3NFC A;  4IKF A;  1UEB A;  1K8A C;  3HP9 A;  3PTA A;  3HFO A;  4M77 G;  4JLI A;  2GCX A;  1QVF A;  3CEY A;  4FM4 B;  4XQ3 A;  3CME T;  1BYM A;  3HRS A;  5LJ3 g;  4J6X A;  1KD1 U;  1KQS S;  1DJ7 B;  3NTH A;  4PL6 A;  3OYN A;  3M54 A;  3JB9 G;  3CD6 A;  1U1S A;  3CCE T;  2RK1 A;  3BDL A;  4M75 D;  4HKE A;  3GP8 A;  2DAQ A;  2XI9 A;  3OYL A;  4RG2 A;  3CCS T;  4JJN K;  4F7U A;  1N27 A;  4EMG A;  1WPY A;  2FHD A;  2E10 A;  4OGE A;  2EKO A;  3OW2 S;  1VQ9 T;  1NJI U;  1KC8 C;  4IUV A;  2DKG A;  3TU4 K;  5GAN 8;  1M90 U;  2F69 A;  2YLC A;  2X35 A;  1NJI C;  1KG1 A;  4MZP A;  3I56 A;  1I81 A;  4M7A D;  3CC4 A;  2VXE A;  5CVI A;  4C0D B;  3PFS A;  4MMK A;  3S6W A;  3JAM E;  4M77 E;  3CMA A;  2C06 A;  3R6O A;  2MWO A;  1VQ6 T;  5LJ3 j;  3HSB A;  2P0K A;  2RI2 A;  2XHC A;  3SWN C;  4N4I A;  1YJN T;  5DLO A;  4L6V 5;  2RJD A;  5EG2 A;  4C8Q G;  2WSC E;  2DD5 A;  4ZGJ B;  3OMG A;  5CAI A;  1VQ7 T;  2EQU A;  3L2Q A;  5LJ3 d;  3QG1 A;  3ZFJ A;  1B34 A;  2P4T A;  4M77 B;  2RHI A;  2JOY A;  4QVC A;  5I21 A;  1BI3 A;  1G3S A;  3UDC A;  4PKC C;  3WVE B;  2JZ2 A;  5FU6 B;  2EJG A;  1U8R A;  2ZPI B;  4M75 B;  4NL2 A;  3JCM g;  3OYH A;  1QVP A;  4M78 C;  2V8I A;  2GF7 A;  3GNF B;  5DY9 A;  2EAY A;  4BE2 A;  3QJY A;  3G71 T;  3OYJ A;  1YI2 A;  3GIB A;  2MMP A;  3INZ A;  3VV0 A;  4R55 A;  4OGC A;  2D6F A;  1RL2 A;  2PUO B;  4XU1 A;  3CXC A;  1Q81 U;  3L2V A;  3QYG B;  2K5I A;  4N0A A;  4MML A;  1VQP A;  5J39 A;  1AHJ B;  4PJO C;  5HK3 A;  2VC8 A;  3H6Z A;  1VQN T;  3CC4 T;  1VQ6 A;  3CBM A;  3OYE A;  3MP1 A;  3AHU A;  1NPR A;  2E12 A;  2GQV A;  1M1G A;  3KBG A;  4M75 C;  2VGN A;  3WXM B;  3FLG A;  1UGP B;  4LDV A;  4JS5 A;  4JRQ A;  4ZTF A;  5GAM j;  4LDX A;  3OB9 A;  1G3Y A;  4IUR A;  1U1T A;  4A4F A;  3CME A;  2DZC A;  4WF2 A;  4PJO A;  4PLL A;  3CPW A;  1R8O B;  4GLK A;  5CKH A;  1Q86 U;  4ZN3 A;  2MWP A;  3VUZ A;  4M77 D;  3FRN A;  3CCL T;  4M7D A;  3LH0 A;  5LJ3 f;  1VQK T;  4LDW A;  3RMS A;  4A4K A;  1JB0 E;  5A0G A;  1GXI E;  2XID A;  2XU8 A;  1K9M C;  4M77 A;  1RI0 A;  3JCM c;  2LT1 A;  4HT9 A;  2DO3 A;  3L2W A;  3LW5 E;  4F7U G;  4TVR A;  1D3B B;  2HQE A;  2V8J A;  3OBY A;  1WQ7 A;  4RMO A;  4E7H A;  1M8V A;  4C0D C;  4M7A B;  3QPH A;  4C92 B;  2QA4 T;  4VUB A;  1UGR B;  2LC4 A;  4CRI A;  3RES A;  3GOX A;  1KQ2 A;  5IAY A;  1BIA A;  4HCC A;  4KBM B;  3SFM A;  3V8K A;  2DTI A;  2O4X B;  4PJO G;  1YCY A;  2V8K A;  4X9D A;  3JCM d;  1YHQ A;  3E19 A;  4DA4 A;  1KC8 U;  1M5Q 1;  1LNX A;  2RK2 A;  5GAN 6;  1QP3 A;  4IUQ A;  2EJ9 A;  4LDU A;  2ZZD A;  2R58 A;  4C8Q D;  4BAC A;  4E7K A;  3CCJ A;  3LX7 A;  4X34 A;  3V8L A;  3KXT A;  3SWN A;  4PJO B;  1IZ6 A;  3LWI A;  4QQ6 A;  3CCU A;  2X4W A;  1JRI A;  2CZ7 B;  4M7D F;  3EFS A;  2QTX A;  3N5B B;  4BD3 A;  2JTF A;  3T9N A;  4C8Q B;  1Y7X A;  4ELZ C;  4R56 A;  2ZCF B;  3J81 E;  2CZ6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...