1A62A

Crystal structure of the rna-binding domain of the transcriptional terminator protein rho
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription termination
molecule keywords RHO
publication title Crystal structure of the RNA-binding domain from transcription termination factor rho.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07497 Rho_RNA_bind Rho termination factor, RNA-binding domain
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a62A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a62A02
2AHOB 1JJGA 1XMQQ 1UEBA 3PO2H 2Y0SG 3PUYA 4P74A 3HOYG 1G291 3KJPA 3GTQH 3UDIA 3STBC 3HKZE 5LMNQ 1VQ8A 3K80C 4IFDG 4IPHA 5GQOA 4X65L 2R93G 4DV2Q 1Q1EA 1Y14B 4PZ8A 5IP7H 4DUYQ 2I5LX 4DKAC 3F8TA 2JA7H 2VL6A 1FGUA 4JI2Q 3M7NA 2UXBL 5EAYA 4X64L 1X56A 5IYCH 4A3FH 4JV5Q 1C0AA 2LSSA 5IWAL 4P75A 1YJNA 4IJLA 1I94L 3U4VA 1X3GA 1E1OA 4DNIA 2UUAL 4BY7G 1W3SA 1JB7A 1LYLA 2CKZB 1GVPA 4GLAC 4BA1I 5IYBG 4IO9A 3CD6A 3IRBA 2OCEA 3TRZA 4GKJL 3AYHB 1VQNA 3KFUA 4A3DG 2A8VA 2AWOA 4YCUA 5C44G 1EIYB 4X65Q 3FKIH 1AE2A 4KI0A 2YV5A 3H0GH 3D31A 1JE5A 3HFZB 3PCOB 3BJUA 2UXBQ 4A4IA 4RMFA 4X64Q 1YNXA 1NBWA 1TWGH 1L0WA 2PI2E 4DUZL 5IWAQ 3M4QA 3PUZA 4R4OA 3PIPA 4HIOA 1M90C 3ULPA 4DR6L 2N49A 5IYDG 1I94Q 2UUAQ 4YHHL 4HIDA 4PG3A 3VDYA 1VQMA 2V1CC 4HJ8A 2OTLA 5LMNW 4HJ9A 4GKJQ 3HKSA 4LW1A 3I7FA 4MNOA 1MJEA 1IXRA 1HNWL 2VW9A 3W5OA 1A62A 3F1ZA 5IE8A 3DM3A 4UPAA 4R4QA 1GD7A 3AFQA 2F3IA 3TS0A 4A3GH 1VQ7A 2HIVA 4DR5L 4DR4L 3EIVA 2NVXH 1VQBA 3JAMc 2D62A 4DUZQ 1HR0L 1VQLA 1U0LA 2VY3A 3A0JA 3PO2G 4KHPL 4DR6Q 5C3EH 1UE7A 3UE0A 4IFDI 4GOPA 4YHHQ 1VQFA 5BR8L 3UDGA 4DV3L 2IT1A 4OONA 2E2JH 1PH7A 1EWIA 1Q7YC 1UE6A 4ME3A 3GTLH 2NZOA 3FP9A 4YWMA 5IP7G 4GNXB 3T1HL 4PZ7A 1HJPA 2OQKA 4A3EG 2YTYA 1K8AC 1IBML 2ZTDA 1ASZA 2K5HA 1A8VA 3DLLA 2JA7G 1HNWQ 2JEBI 5IYCG 4A3FG 2CFMA 2A19A 1YVCA 4DR1L 3GD7A 1X65A 3K0XA 3Q8DA 1VQKA 1VQIA 4DR5Q 4A93H 1HH2P 1IL2A 4DR4Q 4JI1L 2NVYH 4A3JG 3CCEA 4BA2I 3BZKA 3LGJA 3J81i 1HR0Q 2OTJA 5GAHC 4KHPQ 5BR8Q 3S16H 4DV3Q 3A74A 4B3ML 1IBKQ 3A5UA 2D0OA 4YWKA 4KHZA 3FKIG 3KDFA 3I4OA 5IYBH 2RF4A 1V1QA 4L5SA 1YHBA 2CWAA 2HJQA 4RG1A 2HHHL 2FXQA 3BZCA 1IBMQ 3KF6B 4DR7L 4LF4L 4BBSH 1N32L 3WWVA 4HJ7A 3K7AH 3J81j 3H3VH 3HOXH 2VUMH 1Y1VH 5HY6A 4DR1Q 1PH5A 3I56A 1TWCH 1A0IA 3J7ZC 5GADC 2K14A 2WB1E 1QUQA 2R7FA 4JI1Q 3S17H 3PUWA 3GDEA 1XPRA 3HOWH 1VQDA 2GVAA 3ER0A 1SN8A 1SLJA 2IHFA 2E8GA 1VQPA 1PVOA 4DV4L 1OXTA 2ID0A 4B3MQ 2Y0SE 1J6QA 1PH4A 5M5XH 2OQ0A 4HIMA 1K0RA 4NPSA 2VUMG 2NN6G 1J5EL 2UU9L 2HHHQ 4C2MH 4JOIC 4A3GG 2Q2HA 2R6GA 2JA8H 2IY5B 4LFCL 3AEVA 3S2HH 1LUZA 1L1OB 4DR7Q 1N32Q 1G51A 1OXXK 2WB1G 1EOVA 1LM0A 4JYAL 2NZHA 5C3EG 4JBMA 1KRTA 3RN2A 5K36G 3S1NH 4UP9A 1XJVA 3TEHB 1N36L 1PH9A 3S1MH 4OWXB 4DV7L 1SE8A 2PNHA 4DV4Q 4KLKA 3CAMA 1YIJA 1Q8KA 2ALYB 1O7IA 2VZAA 4A3BH 1VQGA 1X9NA 1PH1A 4OXPA 1J5EQ 3CCMA 4UY8C 2UU9Q 4HJAA 4A3EH 4QQBX 2DUDA 5AJ3L 4A76A 4LFCQ 1I50H 4A93G 3K7UC 2Q2TA 1SRUA 1B7YB 3K81C 4JYAQ 4LFBL 5FJ8G 2PQAB 1K8GA 2EIFA 5IT9c 2RHQB 2RHSB 5M5YH 2AWNA 1E7ZA 4A3JH 1S40A 1N36Q 3M4OH 4DV7Q 2E2HH 4OX9L 3CC7A 4R1JA 4YCWA 1E3PA 1N9WA 3E0EA 1R9TH 4POGA 2Z6KC 1CKMA 3UDXA 1X3FA 4GN4B 4BBSG 4H02A 3GTGH 1Z9FA 1VQAA 2JE6I 1HZCA 1Y1VG 3HOXG 1RL2A 1Q86C 1KD1C 3A5ZB 5AJ3Q 1AH9A 4BY1H 4DK3C 1CKOA 4APVA 2K5VA 1SR3A 2WP8J 3CC4A 1PH6A 1B8AA 2YU9H 4IPDA 3OW2A 4LF9L 5E7NA 2ASBA 3HOWG 4LFBQ 4GLVB 4EQ5A 3TS2A 3RLNA 2EQSA 2PMZE 4O2DA 3SGIA 4LWCA 2NN6I 4AQYL 4A3KH 2RCNA 4OX9Q 4WJ3M 3ULLA 3M4PA 1E22A 4MZ9A 4QL5A 3UDFA 4AYBG 2B29A 1KHIA 2CWPA 1S3OA 4A3IH 1V43A 4TVAB 2JA8G 1V9PA 3KLWA 1KIXA 1PHJA 2UUCL 4GNXA 4LF8L 3HOUH 3PO3G 2MNAA 4JC0A 4WJ4A 1N33L 1AE3A 1BBUA 4MTNA 2BA0A 1PH3A 1XNRL 1OXVA 1PFSA 4JI7L 3M85A 3RLFA 1EQQA 4QGUA 3I4MH 4DAMA 2ZJRA 2NVQH 2N78A 1OXUA 2I0QA 3U58A 1SFOH 4AQYQ 2K5NA 2Q2UA 2HT1A 4QIWE 2I5HA 1HNXL 4A3BG 4A3CH 2VQFL 2L15A 2QNCA 2I5MX 2Z0SA 4GN3B 4L5TA 1BVSA 5M3FH 1PH2A 1L2FA 3RZDH 4Y52H 2UUCQ 1NJIC 4LF8Q 4BXXH 1WCMH 1N33Q 4ALPA 3KF6A 2MFIA 4QY7A 2F4VL 1XNRQ 4LUVA 4P72A 3PSIA 3RR5A 5GROA 1CSQA 3RNUA 4A3MH 1K83H 5FJ8H 3PF5A 3MEFA 4DPGA 3EN2A 5LMUL 3KF8B 4C3JH 3PIOA 2B63H 4R4IA 1VQ5A 2K50A 3H3VI 1HNXQ 4GKKL 1PYBA 1YZ6A 2YTXA 1N34L 2VQFQ 1D7QA 1HR0W 1NMGA 2MO0A 4JBWA 1SMXA 3T1HQ 2KHJA 3CCLA 3GTOH 3NELA 4BY1G 1TWAH 4R4CA 2E5LL 3RZOH 1I5FA 2ES2A 4DV0L 2MO1A 3G71A 4X6AH 1JMCA 4K0KL 1KC8C 5M3MH 4NB3A 2F4VQ 4GOPC 4AH6A 4JBKA 1L1OA 1KQSA 2LXJA 4JI6L 4POFA 4A3KG 3STBD 2CCZA 1I3QH 3F2DA 5M5WH 1OTCA 4AIMA 2UXDL 5LMUQ 2ZJPA 1ASYA 1KL9A 3OYYA 1A63A 5FLMH 4FDBA 2KCMA 4A3IG 4GKKQ 4IPGA 2UUBL 1X3EA 2R92H 2ZTEA 4EX5A 4A75A 4A3LH 1M1KC 3HOUG 1LTLA 4OWTB 3CMAA 5JEAJ 1FVIA 2N3SA 2WFWA 1CUKA 1U5KA 1Y1WG 1S72A 2E5LQ 5JJLA 1BKBA 2WAQG 5C4XH 3S24A 4DV0Q 1IBLL 4LF4Q 4K0KQ 4OO1G 1IYJB 3I4MG 4DAYB 3PV0A 2QEXA 3M3YH 1Q82C 1YJWA 1Q46A 3E9IA 1H95A 3KYHC 3PUXA 1XPUA 3TREA 4JI6Q 1EIFA 3CCQA 2PQAA 4A3CG 2IX1A 1VQHA 3S1RH 2K52A 3GTJH 2UXDQ 1E1TA 2YYZA 1G6PA 1VQ4A 5M3FG 3GO5A 2UUBQ 2XGTA 5GAGC 2UXCL 3PGZA 1QVFA 1YBYA 3D0FA 4BXXG 1WCMG 4LF7L 4LF6L 1TXYA 3JAMi 5C4JH 4DV1L 4JI2L 4C3HH 1W2BA 5JEAG 1FJGL 1IBLQ 4UP8A 1OXSC 4YY3L 2GN5A 4A3MG 1VQEA 4BBRH 3OTOL 1K73C 1MJCA 4LF5L 3GTKH 3PUVA 3MXNB 3ICEA 2AKWB 4XIGS 4XTCS 3FHWA 1D8LA 5C0XJ 2B63G 3HOZG 2C35B 4X62L 3F2CA 1N8RC 1P8LA 4YWLA 1HZAA 1TWHH 3CCRA 4DR2L 1XMOL 2IHEA 5J3BA 3J81c 4C3IH 2PI2A 2UXCQ 4AYBE 2QNFA 3G6EA 1QZHA 5IP9H 4JCVE 4LF6Q 4LF7Q 3HOVH 5M3MG 3EBEA 2GVBA 4DV1Q 3CCUA 3AQQA 1SROA 1T9HA 1FJGQ 3CCJA 4YY3Q 3B6YA 3E9HA 1CKNB 1P16A 2R7DA 4J15A 3OTOQ 1QZGA 4LF5Q 3J80c 4O0AA 3H15A 3JC66 1XPOA 1QVCA 2DGYA 1HNZL 1MIUA 1K3RA 5FLMG 1WFQA 2ZM6L 4X62Q 1JJCB 2R92G 3HKZG 4PZ6A 5C0XG 1XMOQ 4DR2Q 1VS0A 4L5RC 4A3LG 2BA1A 1Q1BA 4YCVA 5HGQA 1VCIA 2MQHA 4OO1I 1TWFH 3G48A 1YHAA 4IPCA 1HZ9A 5C4XG 4B3TL 4JI5L 5DLQE 4GN5A 1VQOA 1WYDA 3NBHB 2ATWA 1Y1WH 3S14H 3KJOA 3CF5A 1GO3E 1KRSA 1GKHA 2Q2IA 3L7ZC 4GS3A 3CW2C 4QJFA 1XNQL 3I4NH 4LF9Q 1DGSA 2BH8A 2JJQA 2JA5H 2KBNA 4IJHA 2QGQA 1HNZQ 2CQOA 2A1AA 1C7YA 1VQ6A 2ZM6Q 5H1SE 2N8NA 2B3GA 2JA9A 2D0PA 1VQCA 1YI2A 1X54A 2HIXA 1VQJA 1EYGA 3S2DH 2VS1A 4TQUS 1K9MC 3W1GA 1BBWA 4B3TQ 4JI5Q 4BBRG 3T1YL 3CP0A 2YTVA 1B70B 5JJIA 1JT8A 1MKHA 1E7DA 3CXCA 4JI4L 3L0OA 4HIKA 4JI7Q 1XNQQ 2JA6H 1PA6A 2R7ZH 2KENA 4L5QA 4LUOA 3BU2A 4LFAL 3PO3H 2KCTA 2KHIA 2LXKA 4PMWA 1IBKL 1Z47A 4JG2A 5GAEC 1WJJA 4B3SL 4JI3L 3S15H 3HOZH 4JI8L 3UE1A 4GNXC 4DR3L 1GM5A 3HOYH 1UE1A 5IP9G 1UE5A 3HOVG 2JQOA 1YHQA 4Y7NH 2H5XA 1PH8A 1EN7A 4X66L 3M9BA 4R4TA 2R93H 2F52A 2VNUD 4DV5L 3T1YQ 2XTIA 1Q12A 2WAQE 3CCVA 1XTDA 2EXDA 1YITA 4JOIA 3G4SA 1WOCA 2QA4A 4NXNL 3U4ZA 3U50C 4DV6L 1UWVA 2E2IH 4JI4Q 1KXLA 3NENA 5C0XI 4GOPB 1YEZA 5ELOA 1IZ6A 2AMCB 3L2PA 2JK8A 2K75A 3NEMA 4GLXA 1EFWA 4JI0L 4UP7A 3J7A5 4P71A 4LFAQ 4BY7H 3I2ZA 4LUZA 4NXML 5JJKA 3CC2A 4B3SQ 4JI3Q 2NVTH 3KOJA 4JI8Q 4DR3Q 1N34Q 3H0GG 1E24A 4A3DH 5FLXc 2OWOA 5IY0A 3CMEA 3ULJA 2IX0A 3J80i 5C44H 1PYSB 4B3RL 4X66Q 4JBJA 1X55A 3CPWA 3I4NG 3AFPA 1NTGA 4DV5Q 1RIPA 3CQZH 3RLOA 2JA5G 2VQEL 3RN5A 1KAWA 4NXNQ 4DV6Q 1EUJA 3W1BA 1NY4A 3GTMH 4JI0Q 4IOAA 1YJ9A 1FL0A 1E7LA 1XMQL 1EQRA 3CCSA 1VQ9A 4LNQA 4IFDJ 5IYDH 3KDFB 3CPFA 1WI5A 3I55A 4NXMQ 5LMNL 1CSPA 1X6OA 3K8AA 2ZTCA 2HQLA 3GTPH 1I6HH 1NE3A 4DK6C 4DV2L 4P73A 3ZJYC 4DUYL 1QVGA 3F2BA 1L1OC 3S1QH 4B3RQ 3ERSX 2Z6KA 3PF4A 4JV5L 1Q81C 2JEAI 4IOCA 1PV4A 1NMFA 1QUQB 1HZBA 2JA6G 2R7ZG 2VQEQ 4HJ5A 2ZJQA 1C9OA 3TQYA 2K4KA 5ELNA 1JJ2A 1CKNA 2BH2A 4OWWB
chains in the Genus database with same CATH superfamily
4WORA 1B9NA 1BQQT 2RNNA 1UEBA 3HOYG 2FMCA 1KDAA 3P7JA 5LMNQ 1CQVA 4IFDG 5KNDA 2KVEA 1Y14B 4PZ8A 3C3LA 5IP7H 4LK1C 3F8TA 2JA7H 1FGUA 2UXBL 3M7NA 2EDGA 5M5XB 3T51B 2R92B 5IYCH 2LSSA 1CHQD 5IWAL 4AYBB 3TP6A 5T1GA 1VF5C 2SDFA 2H1EA 1I94L 1X3GA 4BY7G 1IW7C 2CKZB 1U4PA 2QDBA 2EYLA 2PQEA 1X3QA 4GKJL 4Z9CB 1VQNA 4A3DG 1KLGD 2AWOA 4YCUA 2B2WA 2RDHA 5HGTA 1EIYB 4K8IA 1QWYA 3S1RB 1DM0B 1JE5A 1DZ1A 3PCOB 1NBWA 4RA8A 3M4QA 2F0OA 1M90C 1AZQA 1BUVT 4RAUC 3ULPA 4C3HB 5IYDG 2UUAQ 4YHHL 4HIDA 2K5QA 3J80E 4HJ8A 3QO2A 2XVSA 5M5YB 2XNAC 1IXRA 2KHSA 3W5OA 2Z9HA 3VR2A 3A56A 1O7LA 4UPAA 1SYBA 4R4QA 2RQXA 1XXGA 2HIVA 4DR5L 2NVXH 5KEEA 4DUZQ 1STGA 4M8AA 4DR6Q 2XWJB 1UE7A 3UE0A 5K36H 1DD2A 3R3OA 2F0VA 3UDGA 4DV3L 1W6JA 2IT1A 3OWFA 2NZOA 2W51A 5IP7G 4PZ7A 1ASZA 2JA7G 2ZTDA 4N9TA 2JEBI 1F77A 5FKAC 5IYCG 2CFMA 2DJFC 4DR1L 3GD7A 1X65A 3Q8DA 2R3ZA 1VQIA 3IFTA 4KKTA 4DR4Q 1SE2A 1G6PA 2NVYH 1HR0Q 1LV9A 4KHPQ 1JJRA 1Y1WB 3S14B 4B3ML 3NHHA 5EBCA 3I4OA 2RF4A 5C6AA 2K1BA 4BBSH 3K7AH 3HOXH 4ZRZA 1Y1VH 5HY6A 3I56A 3BVGA 3J7ZC 2WB1E 1ENAA 1QUQA 2MP1A 1JOQA 3PUWA 3HOWH 5AFWA 1PVOA 2E8GA 2WINB 1B50A 2R7ZB 1K0RA 3GQBA 4NPSA 5DAUA 1J5EL 1NAPA 1VF7A 4C2MH 4IUTA 4S3SA 3Q24A 2IY5B 4LFCL 1EFID 2G9DA 5BN3A 1G51A 4IURA 4ZKBB 2K01A 3MXGA 4O1NA 5K36G 3RN2A 3RZOB 5KYLA 3QKJA 1PH9A 4OWXB 1LTGD 1ZXTA 4EQNA 2F0EA 4DV4Q 1HCZA 1V8QA 3CAMA 3HGBA 3P1HA 2ALYB 4L63B 1O7IA 1VQGA 3BDCA 2UU9Q 4A3EH 2AUKA 5AJ3L 2F0TA 2PZTA 1BCPF 1CZGA 1JC7A 5EKLA 3K81C 4LFBL 2PQAB 4O42A 3H3VC 4A3JH 2I07B 4H0LC 1N36Q 5CV4A 5IOCA 3M4OH 1Y8PB 3CC7A 1E3PA 3E0EA 4POGA 2Z6KC 3GTMB 2JP1A 3UDXA 1MSGA 1X3FA 4BBSG 1JEQA 3GTGH 1OO9B 3HOXG 1Q86C 1HZCA 1Y1VG 2Z4HA 4BY1H 4DK3C 1CKOA 4EVOA 2Z1CA 3ND9A 2YU9H 1QOHA 5EPLA 4IPDA 5I9PA 3OW2A 3HOWG 4H13C 4I65A 1PZID 2F0FA 1TS5A 3OIPA 4OX9Q 2MPHA 4PV1C 3GTKB 3M4PA 1E22A 3UDFA 1BBXC 1KHIA 3FEWX 3M4YA 1HA5A 4DFAA 1KIXA 1ZS9A 3DXJC 2RBMA 4MTNA 2BA0A 3I91A 4N9PA 2CVRA 4JI7L 2B2VA 3A55A 1SMYD 2JN4A 3I4MH 3LNNA 1QB5D 1XTCD 4DAMA 1DJRD 1SE3A 3MC0B 3SVMA 2L55A 4FF2A 2I5HA 1HNXL 4IUVA 4KY5A 2I5MX 2Z0SA 1ZYRD 4TSSA 4Y52H 2UUCQ 4LF8Q 1VMPA 3MXUA 4LUVA 4XT3B 4P72A 5GROA 2NZ1D 2LS01 3RNUA 4KV6A 2JYOA 1NNXA 5FJ8H 3K57A 1LT4D 1K28A 4QB4A 5LMUL 3PIOA 4PNYA 1GUGA 4C3IG 1YNSA 2AQ1B 4G7HC 1VMCA 1GUWA 1HFNA 2L0CA 2E74C 2B2TA 3GTOH 3T1HQ 3NQTA 1YNNC 4BY1G 1I4HA 2E5LL 1I5FA 3G71A 1WTVA 1JICA 2F4VQ 3EROA 4GOPC 1EY7A 4TRDA 4JI6L 4P2CB 2QEJC 2CCZA 2O2LD 1OTCA 4AIMA 1A63A 2P5ZX 3E5SA 2NTSA 2QF7A 4GKKQ 2UUBL 1B3AA 2R92H 1MHWC 3L3OC 4G57A 1M1KC 1LTLA 5JEAJ 2E2JB 1S72A 1PZKD 3S24A 4LF4Q 4K0KQ 4CJ1B 3HOYB 3I4MG 4DAYB 1TIID 2A69D 1IW7D 1YJWA 2DNCA 3K5MA 3TREA 1EIFA 2KEEA 2HQEA 2PQAA 2X6GA 3S1RH 2K52A 2UXDQ 1E1TA 4ZK9B 4QCLA 1VQ4A 2XGTA 5CV7A 2UXCL 1SJED 5E4XA 4LF6L 1TXYA 4BY7B 1WTXA 5C4JH 4C3HH 1MGSA 4QF4A 4YIJA 1IBLQ 1F2YA 1OXSC 1K73C 2B39A 3OSOA 3OPOA 4A3DB 3Q23A 1D8LA 3HOZG 4X62L 2VUMB 1P8LA 3TDQA 3J81c 1BNZA 3G6EA 1Y69U 4NMZA 1QZHA 5IP9H 3GP7A 3CCUA 1EY9A 1RHPA 1FJGQ 4CJ0B 3E9HA 4LF5Q 2R7DA 1QZGA 3NWTA 4O0AA 1QVCA 2DGYA 1MIUA 1K3RA 5FOBB 2R92G 3HKZG 3HS0C 4XYOA 5IT9E 5JPMC 2L5TA 3S1MB 1YHAA 1HZ9A 4CKBA 4B3TL 4JI5L 4G7OC 5DLQE 4GN5A 2PW5A 3NBHB 2ATWA 1Y1WH 3S14H 3KJOA 1KRSA 1S5DD 2BDNA 2BH8A 4OIKA 4RGNA 1CT1D 2CQOA 5ELFA 1SBBB 2N8NA 1HUMA 3V05A 4V190 1VQCA 1WTQA 4K6DA 1EIGA 4TQUS 3W1GA 2E2HB 4QIWB 4HMIA 1R9TB 3BVMA 3E3XA 3RUZA 1U4LA 1BCPB 2R7ZH 3Q0AA 4LUOA 1A3UA 1D5ZC 2F0KA 1Z47A 5GAEC 5C5MA 1GM5A 4DR3L 1UE1A 1RD9D 5IP9G 2G5DA 2H5XA 3M9BA 5HURA 2F52A 1R4QB 3T1YQ 3OIQA 2WAQE 2D2CC 1XTDA 2EXDA 1YITA 4X3KA 1KXLA 4JI4Q 3VA7A 4DV6L 3VR4A 3NENA 1D6EC 5C0XI 4DAYA 3NQIA 2JK8A 3SK5A 3VR6A 3MWYW 4LFAQ 1SNOA 3BYTB 2EY6A 4NXML 5DM63 1GXDC 3KOJA 3TP7A 5EQ0A 3CHBD 1STBA 1E24A 3K5OA 3ERQA 1SFOB 1ZEQX 3ULJA 5C44H 1X55A 1PRTD 1NTGA 4KD3A 4DV5Q 1RIPA 2VQEL 2QILA 1KAWA 3G6JB 5D65A 3RZDB 2EYPA 2RCFA 3GTMH 2QW7A 4IFDJ 4RGOS 2NVYB 3K8AA 3R93A 1O7YA 3W2DA 3FLGA 3TP8A 3MFGA 1EY0A 1NE3A 2A5HA 4DV2L 4P73A 3F2BA 3S1QH 1CK1A 2L9HA 5CV9A 3PF4A 1PV4A 2R7ZG 1ET9A 3A8KE 1K8MA 1ONLA 2M00A 1XMQQ 2XRSD 1TR5A 4P74A 2QDLA 3KJPA 2EYMA 3STBC 2EY5A 4RH6A 4J6HA 3HOWB 5M5WB 1B9MA 4DKAC 2CW0C 5KNBA 5EAYA 4X64L 5COYA 4JV5Q 1SNCA 3DHQA 2PCFB 3H94A 3MTSA 3NBHA 1E1OA 1W3SA 1JB7A 1CFMA 1H9SB 2N88A 1LYLA 3TN2A 1LT6D 4IO9A 3CD6A 1SAPA 3AYHB 1GJXA 5FK9C 1I4RA 4B9WA 5C44G 5J22A 4X65Q 3MA2B 3FKIH 2RSNA 4N8X1 3D31A 4RMFA 1UEAB 1TWGH 2PI2E 4DXGA 1UNSA 3PUZA 2N49A 3VDYA 1PXUA 4WRDA 1KDCA 1YNND 1S5CD 1SNDA 1HHVA 4MNOA 2KQ3A 1RTOA 4KD4A 1MJEA 1SXTA 4HSVA 1A62A 3F1ZA 1TWHB 2Z6BA 2TSSA 1F2MA 1GUSA 1XX8A 5CIUA 1GD7A 3AFQA 2HCIA 4C3IB 1TU2B 1VQ7A 3E0JA 4WJWA 3EIVA 2V4DA 1VQBA 3JAMc 1VQLA 3D4RA 3MFYA 1D2BA 5IGEA 5BR8L 3QIAA 2E2JH 2YU9B 4ME3A 1WD0A 2EY1A 3FP9A 4YWMA 3T1HL 1K8AC 3IFDA 1HNWQ 1A8VA 2J4XA 1SYDA 3PIP3 2A19A 5EBDA 2QKIC 2RNOA 4DK1A 4JI1L 2IJ0A 3BZKA 3LGJA 1SMYC 2GA4B 1IBKQ 3I4NB 2D0OA 4R8IA 3FKIG 1Q8IA 1ZKOA 4L5SA 2CWAA 1IBMQ 1AW7A 4DR7L 4LF4L 3WWVA 4HJ7A 3J81j 1KABA 2VUMH 1H9JA 4ZYSA 3S2DB 2K14A 2R7FA 1VQDA 1STHA 1SLJA 1VQPA 4BITA 3OW7A 1OXTA 2ID0A 4KMUC 1WTWA 2Y0SE 1PH4A 2JA6B 1V1PB 1U4RA 2ICIA 2HHHQ 2R6GA 3FVQA 2JA8H 3HOZB 3AEVA 1N32Q 2JVWA 1JORA 1OXXK 1GL9B 1LM0A 5FLXL 2NZHA 4JBMA 1KRTA 3S1NH 4QUCA 3S1MH 1SE8A 3NBIA 1H9SA 3VYSA 3BZDB 2DUDA 5JJZA 4A76A 1I50H 1VDZA 3DUZA 3HKZB 4N8FA 1MI2A 1B7YB 4JYAQ 3I4LA 2EIFA 2RHQB 2A69C 1E7ZA 4DV7Q 2E2HH 4R1JA 3HEJA 1N9WA 1R9TH 3BG3A 1CKMA 1STAA 4GN4B 1U9RA 2VUMG 2JE6I 1KD1C 2B2UC 3LWUA 1AP0A 1BR9A 2K5VA 1SR3A 1GJJA 2WP8J 5DNFA 3CC4A 2ASBA 2DY7A 5E7NA 5I6YA 3C46A 1AN8A 4GLVB 5C4JB 3WDNA 1EY5A 2PMZE 4O2DA 3SGIA 4HEDA 4A3KH 5CV5A 4WJ3M 1EEID 3ULLA 4MZ9A 4QL5A 1Y8OB 4B9XA 1PLFA 3D4WA 4A3IH 4TVAB 2JA8G 4OEMB 4IZ8A 4EGVA 4JC0A 1M8AA 1C8CA 3URYA 1PH3A 1XNRL 4UHVA 1PFSA 5BN5A 1WTPA 3FRPB 3NXWA 1OXUA 2I0QA 3DEOA 2AUJD 1SFOH 4AQYQ 4NP5A 5A35A 2Q2UA 2HT1A 2KA7A 2XWBB 3P20A 5FO7B 3BDLA 1JOOA 3V2TA 1BVSA 4F7XA 3RZDH 2RKSA 2WQGA 2IPKD 3CRLC 4DN4M 1N33Q 5ELCA 4DNRB 2RVLA 2F0PA 2K05A 3RR5A 2NYZD 5CV8A 4XQJA 1EU4A 4DPGA 4C3JH 4HAEA 1L0YB 3H3VI 4KKSA 4J8QA 1PYBA 2YTXA 1D7QA 2VQFQ 3MAQA 2KHJA 4RWSC 3NELA 1V1PA 4CDCC 2MO1A 2C9OA 4X3TA 1JOKA 4AH6A 2F0MA 3LLRA 2LXJA 2L11A 5F2DA 1G2SA 2EJFC 4POFA 4A3KG 3STBD 5M5WH 1D1KA 2ZJPA 3BDOA 3OYYA 1HTLD 5FLMH 1E0BA 1LACA 1LO5D 4A3IG 1X3EA 2ZTEA 5C0XH 2CW0D 1R4PB 1FVIA 2N3SA 2WFWA 1U5KA 3MZ5A 5JJLA 4DV0Q 2WV6D 3OMCA 3T13A 1Q46A 3KYHC 1XPUA 5EPJA 4ME5A 2IX1A 2B2TC 2YYZA 3R8BA 3HG9A 4A93B 2D5DA 1QVFA 1YBYA 4LF7L 2FINB 3ONAB 1K8OA 4DV1L 1A3VA 4FXGC 4YY3L 1VQEA 4K5WA 3PUVA 1PRTC 1PFNA 4RHRA 4C3JG 5C44B 3UI2A 4K5VA 3K59A 1JWUD 3AB9A 3K5LA 1XMOL 1EWCA 1TWHH 4DR2L 5J3BA 1O7ZA 4NW2A 4C3IH 5IGBA 4AYBE 1EQVA 4EQOA 3ZYYX 2GVBA 3RMHA 2EY2A 1T9HA 3D8GA 3CCJA 1P16A 2DNEA 3OTOQ 3J80c 1AFPA 1XPOA 3JC66 3S1QB 5FLMG 3SXHA 1JJCB 3E6ZX 4OIJA 4PZ6A 4PMCA 5C0XG 4L5RC 1VS0A 1RJTA 2BA1A 4YCVA 2MQHA 3G48A 2OT2A 5C4HA 1PTOC 5FO8B 1X32A 1VQOA 1IKLA 1WYDA 4F8MA 4A3BB 4QJFA 2Q2IA 4ZQ3A 3I4NH 3L7ZC 1G6ZA 1DGSA 2JJQA 1HNZQ 1AEXA 1KTKA 2ZM6Q 5H1SE 2IW3A 2JA9A 1M4VA 3J80L 1YI2A 3EFXD 1SNQA 3S2DH 1K9MC 2JXMB 2NB0A 3CRKC 1BBWA 1I4PA 1FR3A 3M7GA 1JT8A 4DAVA 1MKHA 1E7DA 4XQQA 3L0OA 1XNQQ 3FKIB 2JA6H 5FO9B 2A6HC 1Z6HA 3VR3A 1IBKL 1TWGB 1K3BC 3HOZH 4JI3L 2KVDA 3UE1A 4GNXC 1GHKA 1UE5A 4V0BA 2X6LA 4Y7NH 1EN7A 1TKWB 4X66L 4R4TA 5D3IB 4ZLTF 1Z7TA 3TBIB 1D5XC 1Q12A 3CCVA 1IYUA 3G4SA 3U4ZA 3U50C 1UWVA 3K6OA 2KUMA 4GOPB 2KCCA 3HOUB 1ENFA 2AMCB 4JI0L 3A7LA 1EFWA 4P71A 3I2ZA 4LUZA 1G2TA 3I3CA 4B3SQ 4RGMA 4JI8Q 1N34Q 3H0GG 2B2YC 5D3DA 4IN3A 5CMDA 2TMPA 2OWOA 4NDXA 4OGQC 2IX0A 3J80i 2Q8TA 3I4NG 3CQZH 3RLOA 1XYIA 3RN5A 2EYFA 2HDMA 1MBYA 5M3FB 4NXNQ 3FPPA 3W1BA 4JK1C 1FL0A 1VQ9A 3EJIA 3ND8A 5I4DA 3CPFA 4ABNA 1WI5A 5KRUA 5LMNL 4X3UA 2KVUA 3HRZC 1K83B 1I6HH 4DK6C 5CBEE 3NTIA 4R8NA 1QVGA 1L1OC 4B3RQ 4CBVA 2Z6KA 1Q81C 4IOCA 2JA6G 1JCKB 2A6EC 1C9OA 1TWAB 1B4OA 3TQYA 5ELNA 1A15A 1JJ2A 1HR0W 4NKLA 2BH2A 5K5PA 1A3TA 4L8JA 5ELDA 1JJGA 4G4KA 1RF2D 1G291 4ILWA 1VQ8A 3K80C 5GQOA 2F0JA 1DYQA 1I3QB 1Q1EA 4J1MA 4C1NI 4DUYQ 1QE6A 5M9OA 3NE5B 2EXZA 3AU7A 2KFVA 3LWEA 5ELEA 1C0AA 4RKBA 4P75A 1LTBD 4KKUA 1CA6A 3D4DA 4B08A 4IJLA 2UUAL 4DNIA 2JA8B 2BDOA 1JWSD 4GLAC 4BA1I 1H9EA 4KJNA 5IYBG 3IRBA 2OCEA 3BYYB 2A8VA 3S1NB 4R9WA 2YV5A 3GTJB 4TKOB 1Q90A 3J81L 2O5JC 3HFZB 4X3SA 3BJUA 2UXBQ 4BWGB 5I2YA 1ESRA 4DUZL 5IWAQ 3PIPA 4DR6L 4I7AA 1I94Q 5KNCA 5L37A 1I50B 4PG3A 5KYIA 5CORA 2OTLA 4GKJQ 4LW1A 3IL8A 2O5IC 1U4MA 2IX3A 4K2LA 2VW9A 3A54A 3I72A 3DM3A 4H7BA 5C3XA 4RHSA 3TS0A 2I46A 2F3WA 4DR4L 3DWAA 2D62A 1HR0L 2EYJA 2VY3A 4KHPL 1HA6A 4F87A 4GOPA 4YHHQ 1B2TA 1TY2A 4K5XA 2XSCA 3QG1A 1PH7A 3L9AX 1UE6A 3KLRA 4RFBA 3KUPA 1JQYD 1HJPA 2OQKA 3G7LA 2YTYA 3DLLA 4A3KB 1Q3LA 3PQIA 1EZ6A 3K0XA 4DR5Q 4A3IB 4A93H 3CCEA 4BA2I 4MHEA 3J81i 1HFGA 4HCSA 5GAHC 1KDBA 4DV3Q 1C48A 4YWKA 1T5XD 5I6WA 4KHZA 1V1QA 4RG1A 2HJQA 1LTRD 2FXQA 2J0TD 1EYAA 2F0QA 2SNMA 3A7AB 3H3VH 2XIWA 4DR1Q 2CH4A 5GADC 4XXEA 1KAAA 3S17H 4JW0A 4KN7C 1XPRA 3GDEA 2Z8LA 1DOMA 2SOBA 3DWPA 1SN8A 3ER0A 1TVXA 5IGGA 5IODA 4DV4L 1QCBD 4B3MQ 5EKIA 4K6LA 2IWHA 3SR1A 4KN4C 4DXFA 2UU9L 3QB3A 5E3FA 2JSOA 4BS9A 4C3JB 2F0UA 4JOIC 3TSSA 2Q2HA 4QMGA 3NK9A 2WKCA 2Y0SB 1SE4A 5LL6X 4KY6A 5FLXE 1GUOA 3NWSA 2AQ2B 2EJMA 4UP9A 2FJ2A 3TEHB 1N36L 4I7ZC 2PNRC 2PNHA 3DWQA 1H9RA 2HD3A 4FO2A 4MTKA 1PTOD 1YIJA 2VZAA 4RCOA 4A3BH 1J5EQ 3CCMA 4UY8C 4HJAA 4DF7A 4QQBX 4IUQA 1STYA 5I9OA 2K7VA 4UZWA 4LFCQ 4A93G 2NVTB 3OWEB 1WVLA 1K8GA 4E6IA 5IT9c 2RHSB 3AMUA 3MEHA 2AWNA 3KLSX 3VYRA 2PPBC 4OX9L 1MD2D 4YCWA 1TY0A 4H02A 1Z9FA 1VQAA 3U9OA 2DK4A 3A5ZB 5AJ3Q 5C3WA 1S5BD 1EY8A 2A6HD 5E4WC 5G3LD 2OXPA 3K58A 1PMRA 4KJOA 1B8AA 5KGUA 1PH6A 4LFBQ 1GKUB 1E2ZA 4GZYC 4EQ5A 2EJGC 3RLNA 4LWCA 1I4QA 2NN6I 2RCNA 3U9SA 2CWPA 3KBGA 1A2UA 1V43A 1F9SA 1QNKA 2IL8A 1V9PA 3KLWA 4CGYB 3A8JE 4CJ2C 4QUFA 1PHJA 2UUCL 1X3PA 4DNTB 4LF8L 3HOUH 3PO2B 4WJ4A 3VYUA 1BBUA 2DJGC 1NSNS 5IIFA 1UAPA 1EZ8A 3M85A 1EQQA 1CI3M 3O13A 1IKMA 2ZJRA 2K5WA 2NVQH 2N78A 2B2WC 3J7YW 2K5NA 2MHVA 1PFMA 2CH4W 4QIWE 4A3BG 2L15A 2QNCA 4U68A 1S5ED 3TP5A 4C1NK 5M3FH 2LY7A 3MXPA 4UDUC 1NJIC 4BXXH 1WD1A 1CTMA 4QY7A 2F4VL 4IUNA 1NR2A 1PRTF 1CSQA 2KECA 1TS4A 1K83H 3H0GB 1D5MC 3PF5A 4OL7A 3KF8B 2HDLA 2EOTA 2M2LA 4R4IA 4ULLA 2K50A 3JAML 1HNXQ 4GKKL 4HCEA 3N52A 1N34L 1NMGA 1F9PA 4JBWA 1SMXA 3CCLA 1TWAH 2A6ED 2ES2A 2E76C 4K0KL 3QOJA 4NB3A 5CR3A 2PO4A 1WTHA 3MHBA 1ENCA 1I3QH 1IHZA 4PQXA 2MPMA 4A3GB 5LMUQ 2UXDL 5NUCA 3V96A 4IALA 2LD7A 2KCMA 2WB1B 4OHJA 4A3LH 5C3EB 3HOUG 3CMAA 4ZKCB 2K5DA 1CUKA 4CKCA 3NTHA 2E5LQ 2WAQG 5C4XH 1IBLL 3GTLB 2D9UA 5T1IA 1Q82C 3E9IA 3PUXA 4Y7NB 4JI6Q 2VB2X 3CU7A 3CCQA 2L12A 3PMFA 1VQHA 3GV3A 3GTJH 4HSPA 2DN8A 1GOZA 2L1BA 3N6RA 5M3FG 2XRQD 3GO5A 2PZWA 5CYUA 1Y8NB 2UUBQ 3K0YA 5GAGC 3PGZA 1EOTA 3D0FA 4KY7A 4HR7B 4BXXG 2K28A 3JAMi 1W2BA 1FJGL 2ZXPA 4LF5L 4BBRH 1MJCA 1I6VC 4DU9A 3HP3A 2F0SA 3ICEA 5C0XJ 1N8RC 3CQZB 4DK0A 4YWLA 1TWCB 2IHEA 3T53B 2UXCQ 3EA6A 1I4XA 4CDEC 1DONA 4LF6Q 3HOVH 3J7AF 1V66A 3EBEA 2ENBA 3AQQA 1C4QA 1I6HB 4RGTA 3B6YA 3VA5A 1CKNB 3X3MA 3H15A 3SK6A 3S2HB 1WFQA 5EJWA 1EIHA 1S4ZA 4X62Q 1EL0A 5JAVA 4A3LG 1Q1BA 1VCIA 4OO1I 2N55A 1TWFH 1RKNA 4IPCA 5C4XG 3H09A 1BCPD 2SEBD 3KK7A 4ZCKA 3QWNA 2E2DC 3CF5A 1GO3E 2G9HD 1GKHA 3CW2C 4LF9Q 2JA5H 2KBNA 4IJHA 5DEHA 2QGQA 3I8ZA 2A1AA 1C7YA 1VQ6A 3D6CA 4KHVA 1EY4A 2D0PA 2ODCI 3KF8A 1X54A 2HIXA 2EE1A 2VS1A 5I2XA 2NWGA 2CQAA 1CQFA 2M9VA 4B3TQ 4JI5Q 4BBRG 3T1YL 2YTVA 1FD7D 3CXCA 1CA5A 4FF4A 2K33A 4JI4L 4RKLA 2Q8RE 1PA6A 2VB3X 1ICWA 1E2WA 4L5QA 5A2QL 4LFAL 3BU2A 3PO3H 3NUCA 1HUNA 2LXKA 4PMWA 4OELB 1WJJA 1STNA 5JOBA 2ICEC 3HOVG 3T4AC 4HMJA 1YHQA 1GUTA 1PH8A 2B2VC 2R93H 5ELBA 2VNUD 4DV5L 3D3RA 2XTIA 3S9WA 2QA4A 1WOCA 1YEZA 1K0SA 5ELOA 1IZ6A 1LTSD 3L2PA 3NEMA 4GLXA 1QG7A 3J7A5 1ILQA 3RD4A 3CC2A 2NVTH 4DR3Q 5LHY1 3H91A 5IY0A 4JBJA 2PW7A 2JA5G 3OHXC 4DV6Q 2WIIB 1SYFA 2F0NA 3C1EA 1WCMB 1XMQL 3CCSA 4LNQA 3KDFB 4NXMQ 3I55A 2K32A 4A3MB 2HQLA 2RDGA 3GTPH 1O80A 1FNUA 3ZJYC 2AQ3B 2B63B 3ERSX 1G91A 1B53A 2JEAI 4JV5L 1HZBA 2VQEQ 4HJ5A 2B2UA 4DA2A 2K4KA 3PO3G 1CKNA 4OWWB 1PRTB 2AHOB 3TZUA 1PFBA 3TZDA 5M3MB 3PO2H 2Y0SG 3PUYA 5KIXA 1EEFD 3UDIA 3GTQH 1LTID 3VR5A 3HKZE 3S17B 1RCVD 4IPHA 2B8FA 4X65L 2R93G 4DV2Q 4FVMA 3QJYA 2I5LX 2VL6A 4JI2Q 4UAIA 1X56A 4A3FH 3NSWA 2PYKA 3WOEA 1BDOA 4XT1B 1YJNA 3NP8A 4IUUA 4IUPA 3U4VA 1EWHA 3BVZA 5IGCA 1GVPA 1XWEA 2CHBD 4FXKC 3M3YB 1HPCA 5CV6A 3TRZA 2L4NA 3NTKA 3KFUA 1H9KA 2EZVA 1AE2A 4KI0A 3H0GH 1RTNA 2HCCA 3NPPA 3J81E 1PTOB 4A4IA 4X64Q 1YNXA 1L0WA 2F0GA 1KNEA 4R4OA 1TS2A 4HIOA 2KCNA 5TSSA 2KEDA 1VQMA 2V1CC 1DCZA 5LMNW 4HJ9A 3EVQA 1IYVA 3FMCA 2RSOA 3HKSA 2G80A 1JE4A 3I7FA 1HNWL 1SNPA 2FFKB 1ESFA 5IE8A 1B1ZA 2NN6H 3KLSA 2F1MA 3X3NA 2BE5C 2F3IA 1V1OA 4A3GH 5LL6S 1F9QA 3I73A 1U0LA 3A0JA 3PO2G 5C3EH 4FF1A 1DXMA 4IFDI 2RA4A 1VQFA 4OONA 3D6WA 2EYOA 1EWIA 3LX0A 1Q7YC 2A68D 3GTLH 4IQZA 1MSHA 4GNXB 4A3EG 1IBML 2K5HA 2NBFA 1YNJD 2WKDA 4A3FG 1YVCA 2H4OA 2OF1A 1VQKA 1HH2P 1IL2A 4A3JG 1SDFA 2OTJA 2FMMA 1GUNA 5BR8Q 3S16H 2WAQB 3A74A 3CKIB 3P75A 3A5UA 2C5CA 3KDFA 1TQOA 5IYBH 3FPUB 2XN9C 2MJ8A 1YHBA 2NVQB 3SHLA 2HHHL 3BZCA 3KF6B 3Q6SA 5EKKA 1N32L 2KOLA 1PH5A 1TWCH 1A0IA 3IKJA 4KTAA 1W6KA 4JI1Q 2GVAA 3SEBA 2IHFA 1II3A 1H1JS 1J6QA 1BOSA 5EPKA 5M5XH 2OQ0A 4HIMA 1A6XA 1LLRD 2NN6G 2NUCA 2WACA 1IL8A 4A3GG 3WOFA 4LAAA 3S15B 2LFNA 3S2HH 4DR7Q 1LUZA 1L1OB 2WB1G 1EOVA 4HN7A 4JYAL 3C2PA 5C3EG 1AZPA 1KNAA 1STEA 1XJVA 4ZUIA 2E75C 3ITPA 1F9RA 3K5NA 4DV7L 2KJXA 1LT3D 3SK4A 2E2IB 3H6MA 4KLKA 1Q8KA 1KLUD 1X9NA 1PH1A 4OXPA 1S5FD 1HTPA 4LMQD 1LTTD 2MGSA 3K7UC 2Q2TA 1SRUA 5FJ8G 3HZXA 5M5YH 1NCVA 5C4XB 1S40A 1T5EA 1CM9A 4C56C 1SYEA 2O4XA 4FP5D 4DAPA 1UUPA 2ZXOA 2LMCB 4RCNA 1RL2A 1AH9A 1SNMA 3GV6A 1LT5D 1EY6A 4APVA 4LF9L 1HXYD 5CBAE 3TS2A 2J7ZA 2EQSA 4AQYL 1J9OA 4Q5VA 4BBRB 4MN3A 3KBXA 4AYBG 2B29A 1S3OA 4ODGA 3T56B 4CDDC 1I4GA 1SEBD 1B3QA 2Z4IA 4GNXA 2MNAA 1N33L 1AE3A 3SK8A 1DOKA 1OXVA 3I70A 5IGDA 4OO1H 1JWMD 3RLFA 4QGUA 3HOVB 4HTHA 2JA7B 3U58A 1RODA 4K8JA 4A3CH 2VQFL 4GN3B 4L5TA 4FXDA 3I90A 1JB3A 1FNVA 3W3AA 1L2FA 4C3HG 4CDFC 5C5LA 1PH2A 1ILPA 2BCOA 1WCMH 1JR0D 2B2YA 2F0LA 4H44C 4ALPA 3KF6A 2MFIA 1XNRQ 1H9FA 1BCPC 5JEAH 1TWFB 3PSIA 4PMBA 4A3MH 5D14A 3MEFA 3EN2A 2B63H 2EVBA 3JAME 1VQ5A 5ISRA 1YZ6A 4Q0FA 2JA5B 4MIUA 3T16A 1H9MA 2MO0A 5CGKA 4WFN3 1NR4A 3RZOH 4R4CA 4DV0L 4X6AH 1JMCA 1ML0D 1KC8C 5M3MH 5EGTA 4JBKA 1L1OA 1KQSA 3DEPA 1EYCA 2ODGC 1FNWA 1G8ZD 1LABA 3EQLC 4JVZA 2F4IA 4ZAIA 3F2DA 3TMEA 3DMUA 4U673 1KL9A 4EQPA 1ASYA 2NVXB 4FDBA 2ZT9C 4IPGA 4A75A 4EX5A 1J8IA 4OWTB 5JVH3 3PO3B 1E2VA 4L6TB 4K2KA 1Y1WG 1BKBA 3IAYA 4OO1G 2RDFA 3J7AV 1IYJB 1RDPD 1WTOA 3PV0A 2QEXA 3M3YH 1O78A 1QILA 1TS3A 1H95A 2K03A 3PIO3 2R93B 4XDXA 4A3CG 4FF3A 4CKEA 2R61A 1PTOH 2KVMA 5J39A 5JVG3 2Q8IB 1WCMG 3R2IA 3VYTA 4JI2L 5JEAG 1CZWA 4UP8A 2GN5A 4A3MG 3OTOL 1HQRD 3GTKH 1HQMC 3MXNB 1HRJA 2AKWB 4XIGS 4XTCS 3FHWA 1GHJA 3C1FA 2B63G 4BBSB 2C35B 3K7AB 3F2CA 3HOXB 1Y1VB 1HZAA 3CCRA 2A74C 4CHTB 3MVVA 2PI2A 2BE5D 2QNFA 4ID6A 2F0IA 3OMGA 4JCVE 4LF7Q 5M3MG 4LJZC 4DV1Q 1SYGA 1SROA 3QR8A 3GTPB 4YY3Q 4J15A 4DGZA 1QNUA 1KHCA 4C2MB 3F2UA 1HNZL 4XQNA 2ZM6L 1XMOQ 1PZJD 1SJHD 4DR2Q 5DM73 5IT9L 5HGQA 3FDTA 2PMZB 3GTQB 2QCPX 1L0XB 1BO0A 1BXTA 4ZUJA 1XNQL 2OEOA 4GS3A 3OOCA 4A3EB 4G7ZC 2EPBA 4F88A 3SE0A 1F2LA 1FGBD 4A3FB 2B3GA 1VQJA 1EYGA 4XYQA 4A3JB 3M4OB 4KK7A 1A2TA 3CP0A 5JJIA 1B70B 3QOLA 4JPBW 4HIKA 4JI7Q 2ZXRA 3GTGB 2KENA 2B8GA 4BY1B 1ICFB 5A2QE 2KCTA 2X69A 2KHIA 4M1UB 4JG2A 3S15H 4B3SL 4JI8L 1DOLA 3HOYH 2LKVA 2F3VA 1WTRA 3BS1A 1EU3A 2JQOA 3SDZA 4IFDH 1CHPD 2LC3A 5JPNC 2DY8A 2HUGA 2FHTA 2BOSA 4JOIA 4NXNL 2E2IH 5BN4A 1NUCA 2K75A 1ZBHA 5IGFA 1JEIA 3Q22A 4UP7A 1SSOA 5E1FA 4BY7H 2PZUA 1PDQA 5JJKA 4JI3Q 2SNSA 3I4MB 5J1ZA 1PTOF 2A68C 5FLXc 4A3DH 2EYHA 1Y02A 3CMEA 4K14A 1BF4A 4B3RL 1PYSB 4X66Q 1PYWD 3CPWA 3R2TA 1ZYRC 2VXWA 3AFPA 4FYDA 2MUYA 1YNJC 1EYDA 5C4ZA 1LTAD 2F03A 2A73B 1EUJA 1B44D 1NY4A 2K04A 4JI0Q 4IOAA 1F2ZA 3MXNA 1E7LA 2KW9A 1EQRA 1YJ9A 3A8IE 2NTTA 5IYDH 1TT2A 1EQTA 1CSPA 1X6OA 2ZTCA 1ET6A 1D1IA 2F0HA 1SYCA 4FNFA 4DUYL 3S16B 1FYCA 1QJOA 2F0DA 1NMFA 1QUQB 2K6AA 2F0WA 3GTOB 2ZJQA 5CC4A 5G3LF 3DM1A
chains in the Genus database with same CATH topology
2AHOB 1JJGA 1XMQQ 1UEBA 3PO2H 2Y0SG 3PUYA 4P74A 3HOYG 1G291 3KJPA 3GTQH 3UDIA 3STBC 3HKZE 5LMNQ 1VQ8A 3K80C 4IFDG 4IPHA 5GQOA 4X65L 2R93G 4DV2Q 1Q1EA 1Y14B 4PZ8A 5IP7H 4DUYQ 2I5LX 4DKAC 3F8TA 2JA7H 2VL6A 1FGUA 4JI2Q 3M7NA 2UXBL 2KFVA 5EAYA 4X64L 1X56A 5IYCH 4A3FH 4JV5Q 1C0AA 2LSSA 5IWAL 4P75A 1YJNA 4IJLA 1I94L 3U4VA 1X3GA 1E1OA 4DNIA 2UUAL 4BY7G 1W3SA 1JB7A 1LYLA 2CKZB 1GVPA 4GLAC 4BA1I 1H9EA 5IYBG 4IO9A 3CD6A 3IRBA 2OCEA 3TRZA 4GKJL 3AYHB 1VQNA 3KFUA 4A3DG 2A8VA 2AWOA 4YCUA 5C44G 1EIYB 4X65Q 3FKIH 1AE2A 4KI0A 2YV5A 3H0GH 3D31A 1JE5A 3HFZB 3PCOB 3BJUA 2UXBQ 4A4IA 4RMFA 4X64Q 1YNXA 1NBWA 1TWGH 1L0WA 2PI2E 4DUZL 5IWAQ 3M4QA 3PUZA 4R4OA 3PIPA 4HIOA 1M90C 3ULPA 4DR6L 2N49A 5IYDG 1I94Q 2UUAQ 4YHHL 4HIDA 4PG3A 3VDYA 1VQMA 2V1CC 4HJ8A 2OTLA 5LMNW 4HJ9A 4GKJQ 3HKSA 2G80A 4LW1A 3I7FA 4MNOA 1MJEA 1IXRA 1HNWL 2VW9A 3W5OA 1A62A 3F1ZA 5IE8A 3DM3A 4UPAA 4R4QA 1GD7A 3AFQA 2F3IA 3TS0A 4A3GH 1VQ7A 2HIVA 4DR5L 4DR4L 3EIVA 2NVXH 1VQBA 3JAMc 2D62A 4DUZQ 1HR0L 1VQLA 1U0LA 2VY3A 3A0JA 3PO2G 4KHPL 4DR6Q 5C3EH 1UE7A 3UE0A 4IFDI 4GOPA 4YHHQ 1VQFA 5BR8L 3UDGA 4DV3L 2IT1A 4OONA 2E2JH 1PH7A 1EWIA 1Q7YC 1UE6A 4ME3A 3GTLH 2NZOA 3FP9A 2W51A 4YWMA 5IP7G 4GNXB 4PZ7A 1HJPA 2OQKA 3T1HL 2YTYA 4A3EG 1K8AC 2ZTDA 1IBML 2K5HA 1A8VA 3DLLA 1ASZA 2JA7G 2JEBI 1HNWQ 5IYCG 4A3FG 2CFMA 2A19A 1YVCA 4DR1L 3GD7A 1X65A 3K0XA 3Q8DA 1VQKA 1VQIA 4DR5Q 4A93H 1HH2P 1IL2A 4DR4Q 4JI1L 2NVYH 4A3JG 3CCEA 4BA2I 3BZKA 3LGJA 3J81i 1HR0Q 2OTJA 5GAHC 4KHPQ 5BR8Q 3S16H 4DV3Q 3A74A 4B3ML 1IBKQ 3A5UA 2D0OA 4YWKA 4KHZA 3FKIG 3KDFA 3I4OA 5IYBH 2RF4A 1V1QA 4L5SA 1YHBA 2CWAA 2HJQA 4RG1A 2HHHL 2FXQA 3BZCA 1IBMQ 3KF6B 4DR7L 4LF4L 4BBSH 1N32L 3WWVA 4HJ7A 3K7AH 3J81j 3H3VH 3HOXH 2VUMH 1Y1VH 5HY6A 4DR1Q 1PH5A 3I56A 1TWCH 1A0IA 3J7ZC 5GADC 2K14A 2WB1E 1QUQA 2R7FA 4JI1Q 3S17H 3PUWA 3GDEA 1XPRA 3HOWH 1VQDA 2GVAA 3ER0A 1SN8A 1SLJA 2IHFA 2E8GA 1VQPA 1PVOA 4DV4L 1OXTA 2ID0A 4B3MQ 2Y0SE 1J6QA 1PH4A 5M5XH 2OQ0A 4HIMA 1K0RA 4NPSA 2VUMG 2NN6G 1J5EL 2UU9L 2HHHQ 4C2MH 4JOIC 4A3GG 2Q2HA 2R6GA 2JA8H 2IY5B 4LFCL 3AEVA 3S2HH 1LUZA 1L1OB 4DR7Q 1N32Q 1G51A 1OXXK 2WB1G 1EOVA 1GL9B 1LM0A 4JYAL 2NZHA 5C3EG 4JBMA 1KRTA 3RN2A 5K36G 3S1NH 4UP9A 1XJVA 3TEHB 1N36L 1PH9A 3S1MH 4OWXB 4DV7L 1SE8A 2PNHA 4DV4Q 4KLKA 3CAMA 1YIJA 1Q8KA 2ALYB 1O7IA 2VZAA 4A3BH 1VQGA 1X9NA 1PH1A 4OXPA 1J5EQ 3CCMA 4UY8C 2UU9Q 4HJAA 4A3EH 4QQBX 2DUDA 5AJ3L 4A76A 4LFCQ 1I50H 4A93G 3K7UC 2Q2TA 1SRUA 1B7YB 3K81C 4JYAQ 4LFBL 5FJ8G 2PQAB 1K8GA 2EIFA 5IT9c 2RHQB 2RHSB 5M5YH 2AWNA 1E7ZA 4A3JH 1S40A 1N36Q 3M4OH 4DV7Q 2E2HH 4OX9L 3CC7A 4R1JA 4YCWA 1E3PA 1N9WA 3E0EA 1R9TH 4POGA 2Z6KC 1CKMA 3UDXA 1X3FA 4GN4B 4BBSG 4H02A 3GTGH 1Z9FA 1VQAA 2JE6I 1HZCA 2DK4A 1Y1VG 1RL2A 3HOXG 1Q86C 3A5ZB 5AJ3Q 1KD1C 4BY1H 1AH9A 4DK3C 1CKOA 4APVA 2K5VA 1SR3A 1GJJA 2WP8J 3CC4A 1PH6A 1B8AA 2YU9H 4IPDA 3OW2A 4LF9L 1GKUB 5E7NA 2ASBA 3HOWG 4LFBQ 4GLVB 4EQ5A 3TS2A 3RLNA 2EQSA 2PMZE 4O2DA 3SGIA 4LWCA 2NN6I 4AQYL 4A3KH 2RCNA 4OX9Q 2MPHA 4WJ3M 3ULLA 3M4PA 1E22A 4MZ9A 4QL5A 3UDFA 4AYBG 2B29A 1KHIA 2CWPA 1S3OA 4A3IH 1V43A 4TVAB 2JA8G 1V9PA 3KLWA 1KIXA 1PHJA 2UUCL 4GNXA 4LF8L 3HOUH 3PO3G 2MNAA 4JC0A 1ZS9A 4WJ4A 1N33L 1AE3A 1BBUA 4MTNA 2BA0A 1PH3A 1XNRL 1OXVA 1PFSA 4JI7L 3M85A 3RLFA 1EQQA 4QGUA 3I4MH 4DAMA 2ZJRA 2NVQH 2N78A 1OXUA 2I0QA 3U58A 1SFOH 4AQYQ 2K5NA 2Q2UA 2HT1A 4QIWE 2I5HA 1HNXL 4A3BG 4A3CH 2VQFL 2L15A 2QNCA 2I5MX 2Z0SA 4GN3B 4L5TA 1BVSA 5M3FH 1PH2A 1L2FA 3RZDH 4Y52H 2UUCQ 1NJIC 4LF8Q 4BXXH 1WCMH 1N33Q 4ALPA 3KF6A 2MFIA 4QY7A 2F4VL 1XNRQ 1H9FA 4LUVA 4P72A 3PSIA 3RR5A 5GROA 1CSQA 3RNUA 4A3MH 1K83H 5FJ8H 3PF5A 3MEFA 4DPGA 3EN2A 5LMUL 3KF8B 4C3JH 3PIOA 2B63H 1YNSA 4R4IA 1VQ5A 2K50A 3H3VI 1HNXQ 4GKKL 1PYBA 1YZ6A 2YTXA 1N34L 2VQFQ 1D7QA 1HR0W 1NMGA 2MO0A 4JBWA 1SMXA 3T1HQ 2KHJA 3CCLA 3GTOH 3NELA 4BY1G 1TWAH 4R4CA 2E5LL 3RZOH 1I5FA 2ES2A 4DV0L 2MO1A 3G71A 4X6AH 1JMCA 4K0KL 1KC8C 5M3MH 4NB3A 2F4VQ 4GOPC 4AH6A 4JBKA 1L1OA 1KQSA 2LXJA 2ODGC 4JI6L 4POFA 4A3KG 3STBD 2CCZA 1I3QH 3F2DA 5M5WH 1OTCA 4AIMA 2UXDL 5LMUQ 2ZJPA 1ASYA 1KL9A 3OYYA 1A63A 2LD7A 5FLMH 4FDBA 2KCMA 4A3IG 4GKKQ 4IPGA 2UUBL 1X3EA 2R92H 2ZTEA 4EX5A 4A75A 4A3LH 1M1KC 3HOUG 1LTLA 4OWTB 3CMAA 5JEAJ 1FVIA 2N3SA 2WFWA 1CUKA 1U5KA 1Y1WG 1S72A 2E5LQ 5JJLA 1BKBA 2WAQG 5C4XH 3S24A 4DV0Q 1IBLL 4LF4Q 4K0KQ 4OO1G 1IYJB 3I4MG 4DAYB 3PV0A 2QEXA 3M3YH 1Q82C 1YJWA 1Q46A 3E9IA 1H95A 3KYHC 3PUXA 1XPUA 3TREA 4JI6Q 1EIFA 3CCQA 2PQAA 4A3CG 2IX1A 1VQHA 3S1RH 2K52A 3GTJH 2UXDQ 1E1TA 2YYZA 1G6PA 1VQ4A 5M3FG 3GO5A 2UUBQ 2XGTA 5GAGC 2UXCL 3PGZA 1QVFA 1YBYA 3D0FA 4BXXG 1WCMG 4LF7L 4LF6L 1TXYA 3JAMi 5C4JH 4DV1L 4JI2L 4C3HH 1W2BA 5JEAG 1FJGL 1IBLQ 4UP8A 1OXSC 4YY3L 2GN5A 4A3MG 1VQEA 4BBRH 3OTOL 1K73C 1MJCA 4LF5L 3GTKH 3PUVA 3MXNB 3ICEA 2AKWB 4XIGS 4XTCS 3FHWA 1D8LA 5C0XJ 2B63G 3HOZG 2C35B 4X62L 3F2CA 1N8RC 1P8LA 4YWLA 1HZAA 1TWHH 3CCRA 4DR2L 1XMOL 2IHEA 5J3BA 3J81c 4C3IH 2PI2A 2UXCQ 4AYBE 2QNFA 3G6EA 1QZHA 5IP9H 4JCVE 4LF6Q 4LF7Q 3HOVH 5M3MG 3EBEA 2GVBA 4DV1Q 3CCUA 3AQQA 1SROA 1T9HA 1FJGQ 3CCJA 4YY3Q 3B6YA 3E9HA 1CKNB 1P16A 2R7DA 4J15A 3OTOQ 1QZGA 4LF5Q 3J80c 4O0AA 3H15A 3JC66 1XPOA 1QVCA 2DGYA 1HNZL 1MIUA 1K3RA 5FLMG 1WFQA 2ZM6L 4X62Q 1JJCB 2R92G 3HKZG 4PZ6A 5C0XG 1XMOQ 4DR2Q 1VS0A 4L5RC 4A3LG 2BA1A 1Q1BA 4YCVA 5HGQA 1VCIA 2MQHA 4OO1I 1TWFH 3G48A 1YHAA 4IPCA 1HZ9A 5C4XG 4B3TL 4JI5L 5DLQE 4GN5A 1VQOA 1WYDA 3NBHB 2ATWA 1Y1WH 3S14H 3KJOA 3CF5A 1GO3E 1KRSA 1GKHA 2Q2IA 3L7ZC 4GS3A 3CW2C 4QJFA 1XNQL 3I4NH 4LF9Q 1DGSA 2BH8A 2JJQA 2JA5H 2KBNA 4IJHA 2QGQA 1HNZQ 2CQOA 2A1AA 1C7YA 1VQ6A 2ZM6Q 5H1SE 2N8NA 2B3GA 2JA9A 2D0PA 1VQCA 2ODCI 1YI2A 1X54A 2HIXA 1VQJA 1EYGA 3S2DH 2VS1A 4TQUS 1K9MC 3W1GA 1BBWA 4B3TQ 4JI5Q 4BBRG 3T1YL 3CP0A 2YTVA 1B70B 5JJIA 1JT8A 1MKHA 1E7DA 3CXCA 4JI4L 3L0OA 4HIKA 4JI7Q 1XNQQ 2JA6H 1PA6A 2R7ZH 2KENA 4L5QA 4LUOA 3BU2A 4LFAL 3PO3H 2KCTA 2KHIA 2LXKA 4PMWA 1IBKL 1Z47A 4JG2A 5GAEC 1WJJA 4B3SL 4JI3L 3S15H 3HOZH 4JI8L 3UE1A 4GNXC 4DR3L 1GM5A 3HOYH 1UE1A 5IP9G 1UE5A 3HOVG 2JQOA 1YHQA 4Y7NH 2H5XA 1PH8A 1EN7A 2LC3A 3M9BA 4R4TA 4X66L 2R93H 2F52A 2VNUD 4DV5L 3T1YQ 2XTIA 1Q12A 2WAQE 3CCVA 1XTDA 2EXDA 1YITA 4JOIA 3G4SA 1WOCA 2QA4A 4NXNL 3U4ZA 3U50C 4DV6L 1UWVA 2E2IH 4JI4Q 1KXLA 3NENA 5C0XI 4GOPB 1YEZA 5ELOA 1IZ6A 2AMCB 3L2PA 2JK8A 2K75A 3NEMA 1JEIA 4GLXA 1EFWA 4JI0L 4UP7A 3J7A5 4P71A 4LFAQ 4BY7H 3I2ZA 4LUZA 4NXML 5JJKA 3CC2A 4B3SQ 4JI3Q 2NVTH 3KOJA 4JI8Q 4DR3Q 1N34Q 3H0GG 1E24A 4A3DH 5FLXc 2OWOA 5IY0A 1Y02A 3ULJA 2IX0A 3J80i 5C44H 1PYSB 3CMEA 4X66Q 4JBJA 1X55A 3CPWA 4B3RL 3I4NG 3AFPA 1NTGA 4DV5Q 1RIPA 3CQZH 3RLOA 2JA5G 2VQEL 3RN5A 1KAWA 4NXNQ 4DV6Q 1EUJA 3W1BA 1NY4A 3GTMH 4JI0Q 4IOAA 1YJ9A 1FL0A 1E7LA 1XMQL 1EQRA 3CCSA 1VQ9A 4LNQA 4IFDJ 5IYDH 3KDFB 3CPFA 1WI5A 3I55A 4NXMQ 5LMNL 1CSPA 1X6OA 3K8AA 2ZTCA 2HQLA 3GTPH 1I6HH 1NE3A 4DK6C 4DV2L 4P73A 3ZJYC 4DUYL 1QVGA 3F2BA 1L1OC 3S1QH 4B3RQ 3ERSX 2Z6KA 3PF4A 4JV5L 1Q81C 2JEAI 4IOCA 1PV4A 1NMFA 1QUQB 1HZBA 2JA6G 2R7ZG 2VQEQ 4HJ5A 2ZJQA 1C9OA 3TQYA 2K4KA 5ELNA 1JJ2A 1CKNA 2BH2A 4OWWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHO B;  1JJG A;  1XMQ Q;  1UEB A;  3PO2 H;  2Y0S G;  3PUY A;  4P74 A;  3HOY G;  1G29 1;  3KJP A;  3GTQ H;  3UDI A;  3STB C;  3HKZ E;  5LMN Q;  1VQ8 A;  3K80 C;  4IFD G;  4IPH A;  5GQO A;  4X65 L;  2R93 G;  4DV2 Q;  1Q1E A;  1Y14 B;  4PZ8 A;  5IP7 H;  4DUY Q;  2I5L X;  4DKA C;  3F8T A;  2JA7 H;  2VL6 A;  1FGU A;  4JI2 Q;  3M7N A;  2UXB L;  5EAY A;  4X64 L;  1X56 A;  5IYC H;  4A3F H;  4JV5 Q;  1C0A A;  2LSS A;  5IWA L;  4P75 A;  1YJN A;  4IJL A;  1I94 L;  3U4V A;  1X3G A;  1E1O A;  4DNI A;  2UUA L;  4BY7 G;  1W3S A;  1JB7 A;  1LYL A;  2CKZ B;  1GVP A;  4GLA C;  4BA1 I;  5IYB G;  4IO9 A;  3CD6 A;  3IRB A;  2OCE A;  3TRZ A;  4GKJ L;  3AYH B;  1VQN A;  3KFU A;  4A3D G;  2A8V A;  2AWO A;  4YCU A;  5C44 G;  1EIY B;  4X65 Q;  3FKI H;  1AE2 A;  4KI0 A;  2YV5 A;  3H0G H;  3D31 A;  1JE5 A;  3HFZ B;  3PCO B;  3BJU A;  2UXB Q;  4A4I A;  4RMF A;  4X64 Q;  1YNX A;  1NBW A;  1TWG H;  1L0W A;  2PI2 E;  4DUZ L;  5IWA Q;  3M4Q A;  3PUZ A;  4R4O A;  3PIP A;  4HIO A;  1M90 C;  3ULP A;  4DR6 L;  2N49 A;  5IYD G;  1I94 Q;  2UUA Q;  4YHH L;  4HID A;  4PG3 A;  3VDY A;  1VQM A;  2V1C C;  4HJ8 A;  2OTL A;  5LMN W;  4HJ9 A;  4GKJ Q;  3HKS A;  4LW1 A;  3I7F A;  4MNO A;  1MJE A;  1IXR A;  1HNW L;  2VW9 A;  3W5O A;  1A62 A;  3F1Z A;  5IE8 A;  3DM3 A;  4UPA A;  4R4Q A;  1GD7 A;  3AFQ A;  2F3I A;  3TS0 A;  4A3G H;  1VQ7 A;  2HIV A;  4DR5 L;  4DR4 L;  3EIV A;  2NVX H;  1VQB A;  3JAM c;  2D62 A;  4DUZ Q;  1HR0 L;  1VQL A;  1U0L A;  2VY3 A;  3A0J A;  3PO2 G;  4KHP L;  4DR6 Q;  5C3E H;  1UE7 A;  3UE0 A;  4IFD I;  4GOP A;  4YHH Q;  1VQF A;  5BR8 L;  3UDG A;  4DV3 L;  2IT1 A;  4OON A;  2E2J H;  1PH7 A;  1EWI A;  1Q7Y C;  1UE6 A;  4ME3 A;  3GTL H;  2NZO A;  3FP9 A;  4YWM A;  5IP7 G;  4GNX B;  3T1H L;  4PZ7 A;  1HJP A;  2OQK A;  4A3E G;  2YTY A;  1K8A C;  1IBM L;  2ZTD A;  1ASZ A;  2K5H A;  1A8V A;  3DLL A;  2JA7 G;  1HNW Q;  2JEB I;  5IYC G;  4A3F G;  2CFM A;  2A19 A;  1YVC A;  4DR1 L;  3GD7 A;  1X65 A;  3K0X A;  3Q8D A;  1VQK A;  1VQI A;  4DR5 Q;  4A93 H;  1HH2 P;  1IL2 A;  4DR4 Q;  4JI1 L;  2NVY H;  4A3J G;  3CCE A;  4BA2 I;  3BZK A;  3LGJ A;  3J81 i;  1HR0 Q;  2OTJ A;  5GAH C;  4KHP Q;  5BR8 Q;  3S16 H;  4DV3 Q;  3A74 A;  4B3M L;  1IBK Q;  3A5U A;  2D0O A;  4YWK A;  4KHZ A;  3FKI G;  3KDF A;  3I4O A;  5IYB H;  2RF4 A;  1V1Q A;  4L5S A;  1YHB A;  2CWA A;  2HJQ A;  4RG1 A;  2HHH L;  2FXQ A;  3BZC A;  1IBM Q;  3KF6 B;  4DR7 L;  4LF4 L;  4BBS H;  1N32 L;  3WWV A;  4HJ7 A;  3K7A H;  3J81 j;  3H3V H;  3HOX H;  2VUM H;  1Y1V H;  5HY6 A;  4DR1 Q;  1PH5 A;  3I56 A;  1TWC H;  1A0I A;  3J7Z C;  5GAD C;  2K14 A;  2WB1 E;  1QUQ A;  2R7F A;  4JI1 Q;  3S17 H;  3PUW A;  3GDE A;  1XPR A;  3HOW H;  1VQD A;  2GVA A;  3ER0 A;  1SN8 A;  1SLJ A;  2IHF A;  2E8G A;  1VQP A;  1PVO A;  4DV4 L;  1OXT A;  2ID0 A;  4B3M Q;  2Y0S E;  1J6Q A;  1PH4 A;  5M5X H;  2OQ0 A;  4HIM A;  1K0R A;  4NPS A;  2VUM G;  2NN6 G;  1J5E L;  2UU9 L;  2HHH Q;  4C2M H;  4JOI C;  4A3G G;  2Q2H A;  2R6G A;  2JA8 H;  2IY5 B;  4LFC L;  3AEV A;  3S2H H;  1LUZ A;  1L1O B;  4DR7 Q;  1N32 Q;  1G51 A;  1OXX K;  2WB1 G;  1EOV A;  1LM0 A;  4JYA L;  2NZH A;  5C3E G;  4JBM A;  1KRT A;  3RN2 A;  5K36 G;  3S1N H;  4UP9 A;  1XJV A;  3TEH B;  1N36 L;  1PH9 A;  3S1M H;  4OWX B;  4DV7 L;  1SE8 A;  2PNH A;  4DV4 Q;  4KLK A;  3CAM A;  1YIJ A;  1Q8K A;  2ALY B;  1O7I A;  2VZA A;  4A3B H;  1VQG A;  1X9N A;  1PH1 A;  4OXP A;  1J5E Q;  3CCM A;  4UY8 C;  2UU9 Q;  4HJA A;  4A3E H;  4QQB X;  2DUD A;  5AJ3 L;  4A76 A;  4LFC Q;  1I50 H;  4A93 G;  3K7U C;  2Q2T A;  1SRU A;  1B7Y B;  3K81 C;  4JYA Q;  4LFB L;  5FJ8 G;  2PQA B;  1K8G A;  2EIF A;  5IT9 c;  2RHQ B;  2RHS B;  5M5Y H;  2AWN A;  1E7Z A;  4A3J H;  1S40 A;  1N36 Q;  3M4O H;  4DV7 Q;  2E2H H;  4OX9 L;  3CC7 A;  4R1J A;  4YCW A;  1E3P A;  1N9W A;  3E0E A;  1R9T H;  4POG A;  2Z6K C;  1CKM A;  3UDX A;  1X3F A;  4GN4 B;  4BBS G;  4H02 A;  3GTG H;  1Z9F A;  1VQA A;  2JE6 I;  1HZC A;  1Y1V G;  3HOX G;  1RL2 A;  1Q86 C;  1KD1 C;  3A5Z B;  5AJ3 Q;  1AH9 A;  4BY1 H;  4DK3 C;  1CKO A;  4APV A;  2K5V A;  1SR3 A;  2WP8 J;  3CC4 A;  1PH6 A;  1B8A A;  2YU9 H;  4IPD A;  3OW2 A;  4LF9 L;  5E7N A;  2ASB A;  3HOW G;  4LFB Q;  4GLV B;  4EQ5 A;  3TS2 A;  3RLN A;  2EQS A;  2PMZ E;  4O2D A;  3SGI A;  4LWC A;  2NN6 I;  4AQY L;  4A3K H;  2RCN A;  4OX9 Q;  4WJ3 M;  3ULL A;  3M4P A;  1E22 A;  4MZ9 A;  4QL5 A;  3UDF A;  4AYB G;  2B29 A;  1KHI A;  2CWP A;  1S3O A;  4A3I H;  1V43 A;  4TVA B;  2JA8 G;  1V9P A;  3KLW A;  1KIX A;  1PHJ A;  2UUC L;  4GNX A;  4LF8 L;  3HOU H;  3PO3 G;  2MNA A;  4JC0 A;  4WJ4 A;  1N33 L;  1AE3 A;  1BBU A;  4MTN A;  2BA0 A;  1PH3 A;  1XNR L;  1OXV A;  1PFS A;  4JI7 L;  3M85 A;  3RLF A;  1EQQ A;  4QGU A;  3I4M H;  4DAM A;  2ZJR A;  2NVQ H;  2N78 A;  1OXU A;  2I0Q A;  3U58 A;  1SFO H;  4AQY Q;  2K5N A;  2Q2U A;  2HT1 A;  4QIW E;  2I5H A;  1HNX L;  4A3B G;  4A3C H;  2VQF L;  2L15 A;  2QNC A;  2I5M X;  2Z0S A;  4GN3 B;  4L5T A;  1BVS A;  5M3F H;  1PH2 A;  1L2F A;  3RZD H;  4Y52 H;  2UUC Q;  1NJI C;  4LF8 Q;  4BXX H;  1WCM H;  1N33 Q;  4ALP A;  3KF6 A;  2MFI A;  4QY7 A;  2F4V L;  1XNR Q;  4LUV A;  4P72 A;  3PSI A;  3RR5 A;  5GRO A;  1CSQ A;  3RNU A;  4A3M H;  1K83 H;  5FJ8 H;  3PF5 A;  3MEF A;  4DPG A;  3EN2 A;  5LMU L;  3KF8 B;  4C3J H;  3PIO A;  2B63 H;  4R4I A;  1VQ5 A;  2K50 A;  3H3V I;  1HNX Q;  4GKK L;  1PYB A;  1YZ6 A;  2YTX A;  1N34 L;  2VQF Q;  1D7Q A;  1HR0 W;  1NMG A;  2MO0 A;  4JBW A;  1SMX A;  3T1H Q;  2KHJ A;  3CCL A;  3GTO H;  3NEL A;  4BY1 G;  1TWA H;  4R4C A;  2E5L L;  3RZO H;  1I5F A;  2ES2 A;  4DV0 L;  2MO1 A;  3G71 A;  4X6A H;  1JMC A;  4K0K L;  1KC8 C;  5M3M H;  4NB3 A;  2F4V Q;  4GOP C;  4AH6 A;  4JBK A;  1L1O A;  1KQS A;  2LXJ A;  4JI6 L;  4POF A;  4A3K G;  3STB D;  2CCZ A;  1I3Q H;  3F2D A;  5M5W H;  1OTC A;  4AIM A;  2UXD L;  5LMU Q;  2ZJP A;  1ASY A;  1KL9 A;  3OYY A;  1A63 A;  5FLM H;  4FDB A;  2KCM A;  4A3I G;  4GKK Q;  4IPG A;  2UUB L;  1X3E A;  2R92 H;  2ZTE A;  4EX5 A;  4A75 A;  4A3L H;  1M1K C;  3HOU G;  1LTL A;  4OWT B;  3CMA A;  5JEA J;  1FVI A;  2N3S A;  2WFW A;  1CUK A;  1U5K A;  1Y1W G;  1S72 A;  2E5L Q;  5JJL A;  1BKB A;  2WAQ G;  5C4X H;  3S24 A;  4DV0 Q;  1IBL L;  4LF4 Q;  4K0K Q;  4OO1 G;  1IYJ B;  3I4M G;  4DAY B;  3PV0 A;  2QEX A;  3M3Y H;  1Q82 C;  1YJW A;  1Q46 A;  3E9I A;  1H95 A;  3KYH C;  3PUX A;  1XPU A;  3TRE A;  4JI6 Q;  1EIF A;  3CCQ A;  2PQA A;  4A3C G;  2IX1 A;  1VQH A;  3S1R H;  2K52 A;  3GTJ H;  2UXD Q;  1E1T A;  2YYZ A;  1G6P A;  1VQ4 A;  5M3F G;  3GO5 A;  2UUB Q;  2XGT A;  5GAG C;  2UXC L;  3PGZ A;  1QVF A;  1YBY A;  3D0F A;  4BXX G;  1WCM G;  4LF7 L;  4LF6 L;  1TXY A;  3JAM i;  5C4J H;  4DV1 L;  4JI2 L;  4C3H H;  1W2B A;  5JEA G;  1FJG L;  1IBL Q;  4UP8 A;  1OXS C;  4YY3 L;  2GN5 A;  4A3M G;  1VQE A;  4BBR H;  3OTO L;  1K73 C;  1MJC A;  4LF5 L;  3GTK H;  3PUV A;  3MXN B;  3ICE A;  2AKW B;  4XIG S;  4XTC S;  3FHW A;  1D8L A;  5C0X J;  2B63 G;  3HOZ G;  2C35 B;  4X62 L;  3F2C A;  1N8R C;  1P8L A;  4YWL A;  1HZA A;  1TWH H;  3CCR A;  4DR2 L;  1XMO L;  2IHE A;  5J3B A;  3J81 c;  4C3I H;  2PI2 A;  2UXC Q;  4AYB E;  2QNF A;  3G6E A;  1QZH A;  5IP9 H;  4JCV E;  4LF6 Q;  4LF7 Q;  3HOV H;  5M3M G;  3EBE A;  2GVB A;  4DV1 Q;  3CCU A;  3AQQ A;  1SRO A;  1T9H A;  1FJG Q;  3CCJ A;  4YY3 Q;  3B6Y A;  3E9H A;  1CKN B;  1P16 A;  2R7D A;  4J15 A;  3OTO Q;  1QZG A;  4LF5 Q;  3J80 c;  4O0A A;  3H15 A;  3JC6 6;  1XPO A;  1QVC A;  2DGY A;  1HNZ L;  1MIU A;  1K3R A;  5FLM G;  1WFQ A;  2ZM6 L;  4X62 Q;  1JJC B;  2R92 G;  3HKZ G;  4PZ6 A;  5C0X G;  1XMO Q;  4DR2 Q;  1VS0 A;  4L5R C;  4A3L G;  2BA1 A;  1Q1B A;  4YCV A;  5HGQ A;  1VCI A;  2MQH A;  4OO1 I;  1TWF H;  3G48 A;  1YHA A;  4IPC A;  1HZ9 A;  5C4X G;  4B3T L;  4JI5 L;  5DLQ E;  4GN5 A;  1VQO A;  1WYD A;  3NBH B;  2ATW A;  1Y1W H;  3S14 H;  3KJO A;  3CF5 A;  1GO3 E;  1KRS A;  1GKH A;  2Q2I A;  3L7Z C;  4GS3 A;  3CW2 C;  4QJF A;  1XNQ L;  3I4N H;  4LF9 Q;  1DGS A;  2BH8 A;  2JJQ A;  2JA5 H;  2KBN A;  4IJH A;  2QGQ A;  1HNZ Q;  2CQO A;  2A1A A;  1C7Y A;  1VQ6 A;  2ZM6 Q;  5H1S E;  2N8N A;  2B3G A;  2JA9 A;  2D0P A;  1VQC A;  1YI2 A;  1X54 A;  2HIX A;  1VQJ A;  1EYG A;  3S2D H;  2VS1 A;  4TQU S;  1K9M C;  3W1G A;  1BBW A;  4B3T Q;  4JI5 Q;  4BBR G;  3T1Y L;  3CP0 A;  2YTV A;  1B70 B;  5JJI A;  1JT8 A;  1MKH A;  1E7D A;  3CXC A;  4JI4 L;  3L0O A;  4HIK A;  4JI7 Q;  1XNQ Q;  2JA6 H;  1PA6 A;  2R7Z H;  2KEN A;  4L5Q A;  4LUO A;  3BU2 A;  4LFA L;  3PO3 H;  2KCT A;  2KHI A;  2LXK A;  4PMW A;  1IBK L;  1Z47 A;  4JG2 A;  5GAE C;  1WJJ A;  4B3S L;  4JI3 L;  3S15 H;  3HOZ H;  4JI8 L;  3UE1 A;  4GNX C;  4DR3 L;  1GM5 A;  3HOY H;  1UE1 A;  5IP9 G;  1UE5 A;  3HOV G;  2JQO A;  1YHQ A;  4Y7N H;  2H5X A;  1PH8 A;  1EN7 A;  4X66 L;  3M9B A;  4R4T A;  2R93 H;  2F52 A;  2VNU D;  4DV5 L;  3T1Y Q;  2XTI A;  1Q12 A;  2WAQ E;  3CCV A;  1XTD A;  2EXD A;  1YIT A;  4JOI A;  3G4S A;  1WOC A;  2QA4 A;  4NXN L;  3U4Z A;  3U50 C;  4DV6 L;  1UWV A;  2E2I H;  4JI4 Q;  1KXL A;  3NEN A;  5C0X I;  4GOP B;  1YEZ A;  5ELO A;  1IZ6 A;  2AMC B;  3L2P A;  2JK8 A;  2K75 A;  3NEM A;  4GLX A;  1EFW A;  4JI0 L;  4UP7 A;  3J7A 5;  4P71 A;  4LFA Q;  4BY7 H;  3I2Z A;  4LUZ A;  4NXM L;  5JJK A;  3CC2 A;  4B3S Q;  4JI3 Q;  2NVT H;  3KOJ A;  4JI8 Q;  4DR3 Q;  1N34 Q;  3H0G G;  1E24 A;  4A3D H;  5FLX c;  2OWO A;  5IY0 A;  3CME A;  3ULJ A;  2IX0 A;  3J80 i;  5C44 H;  1PYS B;  4B3R L;  4X66 Q;  4JBJ A;  1X55 A;  3CPW A;  3I4N G;  3AFP A;  1NTG A;  4DV5 Q;  1RIP A;  3CQZ H;  3RLO A;  2JA5 G;  2VQE L;  3RN5 A;  1KAW A;  4NXN Q;  4DV6 Q;  1EUJ A;  3W1B A;  1NY4 A;  3GTM H;  4JI0 Q;  4IOA A;  1YJ9 A;  1FL0 A;  1E7L A;  1XMQ L;  1EQR A;  3CCS A;  1VQ9 A;  4LNQ A;  4IFD J;  5IYD H;  3KDF B;  3CPF A;  1WI5 A;  3I55 A;  4NXM Q;  5LMN L;  1CSP A;  1X6O A;  3K8A A;  2ZTC A;  2HQL A;  3GTP H;  1I6H H;  1NE3 A;  4DK6 C;  4DV2 L;  4P73 A;  3ZJY C;  4DUY L;  1QVG A;  3F2B A;  1L1O C;  3S1Q H;  4B3R Q;  3ERS X;  2Z6K A;  3PF4 A;  4JV5 L;  1Q81 C;  2JEA I;  4IOC A;  1PV4 A;  1NMF A;  1QUQ B;  1HZB A;  2JA6 G;  2R7Z G;  2VQE Q;  4HJ5 A;  2ZJQ A;  1C9O A;  3TQY A;  2K4K A;  5ELN A;  1JJ2 A;  1CKN A;  2BH2 A;  4OWW B; 
#chains in the Genus database with same CATH topology
 4WOR A;  1B9N A;  1BQQ T;  2RNN A;  1UEB A;  3HOY G;  2FMC A;  1KDA A;  3P7J A;  5LMN Q;  1CQV A;  4IFD G;  5KND A;  2KVE A;  1Y14 B;  4PZ8 A;  3C3L A;  5IP7 H;  4LK1 C;  3F8T A;  2JA7 H;  1FGU A;  2UXB L;  3M7N A;  2EDG A;  5M5X B;  3T51 B;  2R92 B;  5IYC H;  2LSS A;  1CHQ D;  5IWA L;  4AYB B;  3TP6 A;  5T1G A;  1VF5 C;  2SDF A;  2H1E A;  1I94 L;  1X3G A;  4BY7 G;  1IW7 C;  2CKZ B;  1U4P A;  2QDB A;  2EYL A;  2PQE A;  1X3Q A;  4GKJ L;  4Z9C B;  1VQN A;  4A3D G;  1KLG D;  2AWO A;  4YCU A;  2B2W A;  2RDH A;  5HGT A;  1EIY B;  4K8I A;  1QWY A;  3S1R B;  1DM0 B;  1JE5 A;  1DZ1 A;  3PCO B;  1NBW A;  4RA8 A;  3M4Q A;  2F0O A;  1M90 C;  1AZQ A;  1BUV T;  4RAU C;  3ULP A;  4C3H B;  5IYD G;  2UUA Q;  4YHH L;  4HID A;  2K5Q A;  3J80 E;  4HJ8 A;  3QO2 A;  2XVS A;  5M5Y B;  2XNA C;  1IXR A;  2KHS A;  3W5O A;  2Z9H A;  3VR2 A;  3A56 A;  1O7L A;  4UPA A;  1SYB A;  4R4Q A;  2RQX A;  1XXG A;  2HIV A;  4DR5 L;  2NVX H;  5KEE A;  4DUZ Q;  1STG A;  4M8A A;  4DR6 Q;  2XWJ B;  1UE7 A;  3UE0 A;  5K36 H;  1DD2 A;  3R3O A;  2F0V A;  3UDG A;  4DV3 L;  1W6J A;  2IT1 A;  3OWF A;  2NZO A;  2W51 A;  5IP7 G;  4PZ7 A;  1ASZ A;  2JA7 G;  2ZTD A;  4N9T A;  2JEB I;  1F77 A;  5FKA C;  5IYC G;  2CFM A;  2DJF C;  4DR1 L;  3GD7 A;  1X65 A;  3Q8D A;  2R3Z A;  1VQI A;  3IFT A;  4KKT A;  4DR4 Q;  1SE2 A;  1G6P A;  2NVY H;  1HR0 Q;  1LV9 A;  4KHP Q;  1JJR A;  1Y1W B;  3S14 B;  4B3M L;  3NHH A;  5EBC A;  3I4O A;  2RF4 A;  5C6A A;  2K1B A;  4BBS H;  3K7A H;  3HOX H;  4ZRZ A;  1Y1V H;  5HY6 A;  3I56 A;  3BVG A;  3J7Z C;  2WB1 E;  1ENA A;  1QUQ A;  2MP1 A;  1JOQ A;  3PUW A;  3HOW H;  5AFW A;  1PVO A;  2E8G A;  2WIN B;  1B50 A;  2R7Z B;  1K0R A;  3GQB A;  4NPS A;  5DAU A;  1J5E L;  1NAP A;  1VF7 A;  4C2M H;  4IUT A;  4S3S A;  3Q24 A;  2IY5 B;  4LFC L;  1EFI D;  2G9D A;  5BN3 A;  1G51 A;  4IUR A;  4ZKB B;  2K01 A;  3MXG A;  4O1N A;  5K36 G;  3RN2 A;  3RZO B;  5KYL A;  3QKJ A;  1PH9 A;  4OWX B;  1LTG D;  1ZXT A;  4EQN A;  2F0E A;  4DV4 Q;  1HCZ A;  1V8Q A;  3CAM A;  3HGB A;  3P1H A;  2ALY B;  4L63 B;  1O7I A;  1VQG A;  3BDC A;  2UU9 Q;  4A3E H;  2AUK A;  5AJ3 L;  2F0T A;  2PZT A;  1BCP F;  1CZG A;  1JC7 A;  5EKL A;  3K81 C;  4LFB L;  2PQA B;  4O42 A;  3H3V C;  4A3J H;  2I07 B;  4H0L C;  1N36 Q;  5CV4 A;  5IOC A;  3M4O H;  1Y8P B;  3CC7 A;  1E3P A;  3E0E A;  4POG A;  2Z6K C;  3GTM B;  2JP1 A;  3UDX A;  1MSG A;  1X3F A;  4BBS G;  1JEQ A;  3GTG H;  1OO9 B;  3HOX G;  1Q86 C;  1HZC A;  1Y1V G;  2Z4H A;  4BY1 H;  4DK3 C;  1CKO A;  4EVO A;  2Z1C A;  3ND9 A;  2YU9 H;  1QOH A;  5EPL A;  4IPD A;  5I9P A;  3OW2 A;  3HOW G;  4H13 C;  4I65 A;  1PZI D;  2F0F A;  1TS5 A;  3OIP A;  4OX9 Q;  2MPH A;  4PV1 C;  3GTK B;  3M4P A;  1E22 A;  3UDF A;  1BBX C;  1KHI A;  3FEW X;  3M4Y A;  1HA5 A;  4DFA A;  1KIX A;  1ZS9 A;  3DXJ C;  2RBM A;  4MTN A;  2BA0 A;  3I91 A;  4N9P A;  2CVR A;  4JI7 L;  2B2V A;  3A55 A;  1SMY D;  2JN4 A;  3I4M H;  3LNN A;  1QB5 D;  1XTC D;  4DAM A;  1DJR D;  1SE3 A;  3MC0 B;  3SVM A;  2L55 A;  4FF2 A;  2I5H A;  1HNX L;  4IUV A;  4KY5 A;  2I5M X;  2Z0S A;  1ZYR D;  4TSS A;  4Y52 H;  2UUC Q;  4LF8 Q;  1VMP A;  3MXU A;  4LUV A;  4XT3 B;  4P72 A;  5GRO A;  2NZ1 D;  2LS0 1;  3RNU A;  4KV6 A;  2JYO A;  1NNX A;  5FJ8 H;  3K57 A;  1LT4 D;  1K28 A;  4QB4 A;  5LMU L;  3PIO A;  4PNY A;  1GUG A;  4C3I G;  1YNS A;  2AQ1 B;  4G7H C;  1VMC A;  1GUW A;  1HFN A;  2L0C A;  2E74 C;  2B2T A;  3GTO H;  3T1H Q;  3NQT A;  1YNN C;  4BY1 G;  1I4H A;  2E5L L;  1I5F A;  3G71 A;  1WTV A;  1JIC A;  2F4V Q;  3ERO A;  4GOP C;  1EY7 A;  4TRD A;  4JI6 L;  4P2C B;  2QEJ C;  2CCZ A;  2O2L D;  1OTC A;  4AIM A;  1A63 A;  2P5Z X;  3E5S A;  2NTS A;  2QF7 A;  4GKK Q;  2UUB L;  1B3A A;  2R92 H;  1MHW C;  3L3O C;  4G57 A;  1M1K C;  1LTL A;  5JEA J;  2E2J B;  1S72 A;  1PZK D;  3S24 A;  4LF4 Q;  4K0K Q;  4CJ1 B;  3HOY B;  3I4M G;  4DAY B;  1TII D;  2A69 D;  1IW7 D;  1YJW A;  2DNC A;  3K5M A;  3TRE A;  1EIF A;  2KEE A;  2HQE A;  2PQA A;  2X6G A;  3S1R H;  2K52 A;  2UXD Q;  1E1T A;  4ZK9 B;  4QCL A;  1VQ4 A;  2XGT A;  5CV7 A;  2UXC L;  1SJE D;  5E4X A;  4LF6 L;  1TXY A;  4BY7 B;  1WTX A;  5C4J H;  4C3H H;  1MGS A;  4QF4 A;  4YIJ A;  1IBL Q;  1F2Y A;  1OXS C;  1K73 C;  2B39 A;  3OSO A;  3OPO A;  4A3D B;  3Q23 A;  1D8L A;  3HOZ G;  4X62 L;  2VUM B;  1P8L A;  3TDQ A;  3J81 c;  1BNZ A;  3G6E A;  1Y69 U;  4NMZ A;  1QZH A;  5IP9 H;  3GP7 A;  3CCU A;  1EY9 A;  1RHP A;  1FJG Q;  4CJ0 B;  3E9H A;  4LF5 Q;  2R7D A;  1QZG A;  3NWT A;  4O0A A;  1QVC A;  2DGY A;  1MIU A;  1K3R A;  5FOB B;  2R92 G;  3HKZ G;  3HS0 C;  4XYO A;  5IT9 E;  5JPM C;  2L5T A;  3S1M B;  1YHA A;  1HZ9 A;  4CKB A;  4B3T L;  4JI5 L;  4G7O C;  5DLQ E;  4GN5 A;  2PW5 A;  3NBH B;  2ATW A;  1Y1W H;  3S14 H;  3KJO A;  1KRS A;  1S5D D;  2BDN A;  2BH8 A;  4OIK A;  4RGN A;  1CT1 D;  2CQO A;  5ELF A;  1SBB B;  2N8N A;  1HUM A;  3V05 A;  4V19 0;  1VQC A;  1WTQ A;  4K6D A;  1EIG A;  4TQU S;  3W1G A;  2E2H B;  4QIW B;  4HMI A;  1R9T B;  3BVM A;  3E3X A;  3RUZ A;  1U4L A;  1BCP B;  2R7Z H;  3Q0A A;  4LUO A;  1A3U A;  1D5Z C;  2F0K A;  1Z47 A;  5GAE C;  5C5M A;  1GM5 A;  4DR3 L;  1UE1 A;  1RD9 D;  5IP9 G;  2G5D A;  2H5X A;  3M9B A;  5HUR A;  2F52 A;  1R4Q B;  3T1Y Q;  3OIQ A;  2WAQ E;  2D2C C;  1XTD A;  2EXD A;  1YIT A;  4X3K A;  1KXL A;  4JI4 Q;  3VA7 A;  4DV6 L;  3VR4 A;  3NEN A;  1D6E C;  5C0X I;  4DAY A;  3NQI A;  2JK8 A;  3SK5 A;  3VR6 A;  3MWY W;  4LFA Q;  1SNO A;  3BYT B;  2EY6 A;  4NXM L;  5DM6 3;  1GXD C;  3KOJ A;  3TP7 A;  5EQ0 A;  3CHB D;  1STB A;  1E24 A;  3K5O A;  3ERQ A;  1SFO B;  1ZEQ X;  3ULJ A;  5C44 H;  1X55 A;  1PRT D;  1NTG A;  4KD3 A;  4DV5 Q;  1RIP A;  2VQE L;  2QIL A;  1KAW A;  3G6J B;  5D65 A;  3RZD B;  2EYP A;  2RCF A;  3GTM H;  2QW7 A;  4IFD J;  4RGO S;  2NVY B;  3K8A A;  3R93 A;  1O7Y A;  3W2D A;  3FLG A;  3TP8 A;  3MFG A;  1EY0 A;  1NE3 A;  2A5H A;  4DV2 L;  4P73 A;  3F2B A;  3S1Q H;  1CK1 A;  2L9H A;  5CV9 A;  3PF4 A;  1PV4 A;  2R7Z G;  1ET9 A;  3A8K E;  1K8M A;  1ONL A;  2M00 A;  1XMQ Q;  2XRS D;  1TR5 A;  4P74 A;  2QDL A;  3KJP A;  2EYM A;  3STB C;  2EY5 A;  4RH6 A;  4J6H A;  3HOW B;  5M5W B;  1B9M A;  4DKA C;  2CW0 C;  5KNB A;  5EAY A;  4X64 L;  5COY A;  4JV5 Q;  1SNC A;  3DHQ A;  2PCF B;  3H94 A;  3MTS A;  3NBH A;  1E1O A;  1W3S A;  1JB7 A;  1CFM A;  1H9S B;  2N88 A;  1LYL A;  3TN2 A;  1LT6 D;  4IO9 A;  3CD6 A;  1SAP A;  3AYH B;  1GJX A;  5FK9 C;  1I4R A;  4B9W A;  5C44 G;  5J22 A;  4X65 Q;  3MA2 B;  3FKI H;  2RSN A;  4N8X 1;  3D31 A;  4RMF A;  1UEA B;  1TWG H;  2PI2 E;  4DXG A;  1UNS A;  3PUZ A;  2N49 A;  3VDY A;  1PXU A;  4WRD A;  1KDC A;  1YNN D;  1S5C D;  1SND A;  1HHV A;  4MNO A;  2KQ3 A;  1RTO A;  4KD4 A;  1MJE A;  1SXT A;  4HSV A;  1A62 A;  3F1Z A;  1TWH B;  2Z6B A;  2TSS A;  1F2M A;  1GUS A;  1XX8 A;  5CIU A;  1GD7 A;  3AFQ A;  2HCI A;  4C3I B;  1TU2 B;  1VQ7 A;  3E0J A;  4WJW A;  3EIV A;  2V4D A;  1VQB A;  3JAM c;  1VQL A;  3D4R A;  3MFY A;  1D2B A;  5IGE A;  5BR8 L;  3QIA A;  2E2J H;  2YU9 B;  4ME3 A;  1WD0 A;  2EY1 A;  3FP9 A;  4YWM A;  3T1H L;  1K8A C;  3IFD A;  1HNW Q;  1A8V A;  2J4X A;  1SYD A;  3PIP 3;  2A19 A;  5EBD A;  2QKI C;  2RNO A;  4DK1 A;  4JI1 L;  2IJ0 A;  3BZK A;  3LGJ A;  1SMY C;  2GA4 B;  1IBK Q;  3I4N B;  2D0O A;  4R8I A;  3FKI G;  1Q8I A;  1ZKO A;  4L5S A;  2CWA A;  1IBM Q;  1AW7 A;  4DR7 L;  4LF4 L;  3WWV A;  4HJ7 A;  3J81 j;  1KAB A;  2VUM H;  1H9J A;  4ZYS A;  3S2D B;  2K14 A;  2R7F A;  1VQD A;  1STH A;  1SLJ A;  1VQP A;  4BIT A;  3OW7 A;  1OXT A;  2ID0 A;  4KMU C;  1WTW A;  2Y0S E;  1PH4 A;  2JA6 B;  1V1P B;  1U4R A;  2ICI A;  2HHH Q;  2R6G A;  3FVQ A;  2JA8 H;  3HOZ B;  3AEV A;  1N32 Q;  2JVW A;  1JOR A;  1OXX K;  1GL9 B;  1LM0 A;  5FLX L;  2NZH A;  4JBM A;  1KRT A;  3S1N H;  4QUC A;  3S1M H;  1SE8 A;  3NBI A;  1H9S A;  3VYS A;  3BZD B;  2DUD A;  5JJZ A;  4A76 A;  1I50 H;  1VDZ A;  3DUZ A;  3HKZ B;  4N8F A;  1MI2 A;  1B7Y B;  4JYA Q;  3I4L A;  2EIF A;  2RHQ B;  2A69 C;  1E7Z A;  4DV7 Q;  2E2H H;  4R1J A;  3HEJ A;  1N9W A;  1R9T H;  3BG3 A;  1CKM A;  1STA A;  4GN4 B;  1U9R A;  2VUM G;  2JE6 I;  1KD1 C;  2B2U C;  3LWU A;  1AP0 A;  1BR9 A;  2K5V A;  1SR3 A;  1GJJ A;  2WP8 J;  5DNF A;  3CC4 A;  2ASB A;  2DY7 A;  5E7N A;  5I6Y A;  3C46 A;  1AN8 A;  4GLV B;  5C4J B;  3WDN A;  1EY5 A;  2PMZ E;  4O2D A;  3SGI A;  4HED A;  4A3K H;  5CV5 A;  4WJ3 M;  1EEI D;  3ULL A;  4MZ9 A;  4QL5 A;  1Y8O B;  4B9X A;  1PLF A;  3D4W A;  4A3I H;  4TVA B;  2JA8 G;  4OEM B;  4IZ8 A;  4EGV A;  4JC0 A;  1M8A A;  1C8C A;  3URY A;  1PH3 A;  1XNR L;  4UHV A;  1PFS A;  5BN5 A;  1WTP A;  3FRP B;  3NXW A;  1OXU A;  2I0Q A;  3DEO A;  2AUJ D;  1SFO H;  4AQY Q;  4NP5 A;  5A35 A;  2Q2U A;  2HT1 A;  2KA7 A;  2XWB B;  3P20 A;  5FO7 B;  3BDL A;  1JOO A;  3V2T A;  1BVS A;  4F7X A;  3RZD H;  2RKS A;  2WQG A;  2IPK D;  3CRL C;  4DN4 M;  1N33 Q;  5ELC A;  4DNR B;  2RVL A;  2F0P A;  2K05 A;  3RR5 A;  2NYZ D;  5CV8 A;  4XQJ A;  1EU4 A;  4DPG A;  4C3J H;  4HAE A;  1L0Y B;  3H3V I;  4KKS A;  4J8Q A;  1PYB A;  2YTX A;  1D7Q A;  2VQF Q;  3MAQ A;  2KHJ A;  4RWS C;  3NEL A;  1V1P A;  4CDC C;  2MO1 A;  2C9O A;  4X3T A;  1JOK A;  4AH6 A;  2F0M A;  3LLR A;  2LXJ A;  2L11 A;  5F2D A;  1G2S A;  2EJF C;  4POF A;  4A3K G;  3STB D;  5M5W H;  1D1K A;  2ZJP A;  3BDO A;  3OYY A;  1HTL D;  5FLM H;  1E0B A;  1LAC A;  1LO5 D;  4A3I G;  1X3E A;  2ZTE A;  5C0X H;  2CW0 D;  1R4P B;  1FVI A;  2N3S A;  2WFW A;  1U5K A;  3MZ5 A;  5JJL A;  4DV0 Q;  2WV6 D;  3OMC A;  3T13 A;  1Q46 A;  3KYH C;  1XPU A;  5EPJ A;  4ME5 A;  2IX1 A;  2B2T C;  2YYZ A;  3R8B A;  3HG9 A;  4A93 B;  2D5D A;  1QVF A;  1YBY A;  4LF7 L;  2FIN B;  3ONA B;  1K8O A;  4DV1 L;  1A3V A;  4FXG C;  4YY3 L;  1VQE A;  4K5W A;  3PUV A;  1PRT C;  1PFN A;  4RHR A;  4C3J G;  5C44 B;  3UI2 A;  4K5V A;  3K59 A;  1JWU D;  3AB9 A;  3K5L A;  1XMO L;  1EWC A;  1TWH H;  4DR2 L;  5J3B A;  1O7Z A;  4NW2 A;  4C3I H;  5IGB A;  4AYB E;  1EQV A;  4EQO A;  3ZYY X;  2GVB A;  3RMH A;  2EY2 A;  1T9H A;  3D8G A;  3CCJ A;  1P16 A;  2DNE A;  3OTO Q;  3J80 c;  1AFP A;  1XPO A;  3JC6 6;  3S1Q B;  5FLM G;  3SXH A;  1JJC B;  3E6Z X;  4OIJ A;  4PZ6 A;  4PMC A;  5C0X G;  4L5R C;  1VS0 A;  1RJT A;  2BA1 A;  4YCV A;  2MQH A;  3G48 A;  2OT2 A;  5C4H A;  1PTO C;  5FO8 B;  1X32 A;  1VQO A;  1IKL A;  1WYD A;  4F8M A;  4A3B B;  4QJF A;  2Q2I A;  4ZQ3 A;  3I4N H;  3L7Z C;  1G6Z A;  1DGS A;  2JJQ A;  1HNZ Q;  1AEX A;  1KTK A;  2ZM6 Q;  5H1S E;  2IW3 A;  2JA9 A;  1M4V A;  3J80 L;  1YI2 A;  3EFX D;  1SNQ A;  3S2D H;  1K9M C;  2JXM B;  2NB0 A;  3CRK C;  1BBW A;  1I4P A;  1FR3 A;  3M7G A;  1JT8 A;  4DAV A;  1MKH A;  1E7D A;  4XQQ A;  3L0O A;  1XNQ Q;  3FKI B;  2JA6 H;  5FO9 B;  2A6H C;  1Z6H A;  3VR3 A;  1IBK L;  1TWG B;  1K3B C;  3HOZ H;  4JI3 L;  2KVD A;  3UE1 A;  4GNX C;  1GHK A;  1UE5 A;  4V0B A;  2X6L A;  4Y7N H;  1EN7 A;  1TKW B;  4X66 L;  4R4T A;  5D3I B;  4ZLT F;  1Z7T A;  3TBI B;  1D5X C;  1Q12 A;  3CCV A;  1IYU A;  3G4S A;  3U4Z A;  3U50 C;  1UWV A;  3K6O A;  2KUM A;  4GOP B;  2KCC A;  3HOU B;  1ENF A;  2AMC B;  4JI0 L;  3A7L A;  1EFW A;  4P71 A;  3I2Z A;  4LUZ A;  1G2T A;  3I3C A;  4B3S Q;  4RGM A;  4JI8 Q;  1N34 Q;  3H0G G;  2B2Y C;  5D3D A;  4IN3 A;  5CMD A;  2TMP A;  2OWO A;  4NDX A;  4OGQ C;  2IX0 A;  3J80 i;  2Q8T A;  3I4N G;  3CQZ H;  3RLO A;  1XYI A;  3RN5 A;  2EYF A;  2HDM A;  1MBY A;  5M3F B;  4NXN Q;  3FPP A;  3W1B A;  4JK1 C;  1FL0 A;  1VQ9 A;  3EJI A;  3ND8 A;  5I4D A;  3CPF A;  4ABN A;  1WI5 A;  5KRU A;  5LMN L;  4X3U A;  2KVU A;  3HRZ C;  1K83 B;  1I6H H;  4DK6 C;  5CBE E;  3NTI A;  4R8N A;  1QVG A;  1L1O C;  4B3R Q;  4CBV A;  2Z6K A;  1Q81 C;  4IOC A;  2JA6 G;  1JCK B;  2A6E C;  1C9O A;  1TWA B;  1B4O A;  3TQY A;  5ELN A;  1A15 A;  1JJ2 A;  1HR0 W;  4NKL A;  2BH2 A;  5K5P A;  1A3T A;  4L8J A;  5ELD A;  1JJG A;  4G4K A;  1RF2 D;  1G29 1;  4ILW A;  1VQ8 A;  3K80 C;  5GQO A;  2F0J A;  1DYQ A;  1I3Q B;  1Q1E A;  4J1M A;  4C1N I;  4DUY Q;  1QE6 A;  5M9O A;  3NE5 B;  2EXZ A;  3AU7 A;  2KFV A;  3LWE A;  5ELE A;  1C0A A;  4RKB A;  4P75 A;  1LTB D;  4KKU A;  1CA6 A;  3D4D A;  4B08 A;  4IJL A;  2UUA L;  4DNI A;  2JA8 B;  2BDO A;  1JWS D;  4GLA C;  4BA1 I;  1H9E A;  4KJN A;  5IYB G;  3IRB A;  2OCE A;  3BYY B;  2A8V A;  3S1N B;  4R9W A;  2YV5 A;  3GTJ B;  4TKO B;  1Q90 A;  3J81 L;  2O5J C;  3HFZ B;  4X3S A;  3BJU A;  2UXB Q;  4BWG B;  5I2Y A;  1ESR A;  4DUZ L;  5IWA Q;  3PIP A;  4DR6 L;  4I7A A;  1I94 Q;  5KNC A;  5L37 A;  1I50 B;  4PG3 A;  5KYI A;  5COR A;  2OTL A;  4GKJ Q;  4LW1 A;  3IL8 A;  2O5I C;  1U4M A;  2IX3 A;  4K2L A;  2VW9 A;  3A54 A;  3I72 A;  3DM3 A;  4H7B A;  5C3X A;  4RHS A;  3TS0 A;  2I46 A;  2F3W A;  4DR4 L;  3DWA A;  2D62 A;  1HR0 L;  2EYJ A;  2VY3 A;  4KHP L;  1HA6 A;  4F87 A;  4GOP A;  4YHH Q;  1B2T A;  1TY2 A;  4K5X A;  2XSC A;  3QG1 A;  1PH7 A;  3L9A X;  1UE6 A;  3KLR A;  4RFB A;  3KUP A;  1JQY D;  1HJP A;  2OQK A;  3G7L A;  2YTY A;  3DLL A;  4A3K B;  1Q3L A;  3PQI A;  1EZ6 A;  3K0X A;  4DR5 Q;  4A3I B;  4A93 H;  3CCE A;  4BA2 I;  4MHE A;  3J81 i;  1HFG A;  4HCS A;  5GAH C;  1KDB A;  4DV3 Q;  1C48 A;  4YWK A;  1T5X D;  5I6W A;  4KHZ A;  1V1Q A;  4RG1 A;  2HJQ A;  1LTR D;  2FXQ A;  2J0T D;  1EYA A;  2F0Q A;  2SNM A;  3A7A B;  3H3V H;  2XIW A;  4DR1 Q;  2CH4 A;  5GAD C;  4XXE A;  1KAA A;  3S17 H;  4JW0 A;  4KN7 C;  1XPR A;  3GDE A;  2Z8L A;  1DOM A;  2SOB A;  3DWP A;  1SN8 A;  3ER0 A;  1TVX A;  5IGG A;  5IOD A;  4DV4 L;  1QCB D;  4B3M Q;  5EKI A;  4K6L A;  2IWH A;  3SR1 A;  4KN4 C;  4DXF A;  2UU9 L;  3QB3 A;  5E3F A;  2JSO A;  4BS9 A;  4C3J B;  2F0U A;  4JOI C;  3TSS A;  2Q2H A;  4QMG A;  3NK9 A;  2WKC A;  2Y0S B;  1SE4 A;  5LL6 X;  4KY6 A;  5FLX E;  1GUO A;  3NWS A;  2AQ2 B;  2EJM A;  4UP9 A;  2FJ2 A;  3TEH B;  1N36 L;  4I7Z C;  2PNR C;  2PNH A;  3DWQ A;  1H9R A;  2HD3 A;  4FO2 A;  4MTK A;  1PTO D;  1YIJ A;  2VZA A;  4RCO A;  4A3B H;  1J5E Q;  3CCM A;  4UY8 C;  4HJA A;  4DF7 A;  4QQB X;  4IUQ A;  1STY A;  5I9O A;  2K7V A;  4UZW A;  4LFC Q;  4A93 G;  2NVT B;  3OWE B;  1WVL A;  1K8G A;  4E6I A;  5IT9 c;  2RHS B;  3AMU A;  3MEH A;  2AWN A;  3KLS X;  3VYR A;  2PPB C;  4OX9 L;  1MD2 D;  4YCW A;  1TY0 A;  4H02 A;  1Z9F A;  1VQA A;  3U9O A;  2DK4 A;  3A5Z B;  5AJ3 Q;  5C3W A;  1S5B D;  1EY8 A;  2A6H D;  5E4W C;  5G3L D;  2OXP A;  3K58 A;  1PMR A;  4KJO A;  1B8A A;  5KGU A;  1PH6 A;  4LFB Q;  1GKU B;  1E2Z A;  4GZY C;  4EQ5 A;  2EJG C;  3RLN A;  4LWC A;  1I4Q A;  2NN6 I;  2RCN A;  3U9S A;  2CWP A;  3KBG A;  1A2U A;  1V43 A;  1F9S A;  1QNK A;  2IL8 A;  1V9P A;  3KLW A;  4CGY B;  3A8J E;  4CJ2 C;  4QUF A;  1PHJ A;  2UUC L;  1X3P A;  4DNT B;  4LF8 L;  3HOU H;  3PO2 B;  4WJ4 A;  3VYU A;  1BBU A;  2DJG C;  1NSN S;  5IIF A;  1UAP A;  1EZ8 A;  3M85 A;  1EQQ A;  1CI3 M;  3O13 A;  1IKM A;  2ZJR A;  2K5W A;  2NVQ H;  2N78 A;  2B2W C;  3J7Y W;  2K5N A;  2MHV A;  1PFM A;  2CH4 W;  4QIW E;  4A3B G;  2L15 A;  2QNC A;  4U68 A;  1S5E D;  3TP5 A;  4C1N K;  5M3F H;  2LY7 A;  3MXP A;  4UDU C;  1NJI C;  4BXX H;  1WD1 A;  1CTM A;  4QY7 A;  2F4V L;  4IUN A;  1NR2 A;  1PRT F;  1CSQ A;  2KEC A;  1TS4 A;  1K83 H;  3H0G B;  1D5M C;  3PF5 A;  4OL7 A;  3KF8 B;  2HDL A;  2EOT A;  2M2L A;  4R4I A;  4ULL A;  2K50 A;  3JAM L;  1HNX Q;  4GKK L;  4HCE A;  3N52 A;  1N34 L;  1NMG A;  1F9P A;  4JBW A;  1SMX A;  3CCL A;  1TWA H;  2A6E D;  2ES2 A;  2E76 C;  4K0K L;  3QOJ A;  4NB3 A;  5CR3 A;  2PO4 A;  1WTH A;  3MHB A;  1ENC A;  1I3Q H;  1IHZ A;  4PQX A;  2MPM A;  4A3G B;  5LMU Q;  2UXD L;  5NUC A;  3V96 A;  4IAL A;  2LD7 A;  2KCM A;  2WB1 B;  4OHJ A;  4A3L H;  5C3E B;  3HOU G;  3CMA A;  4ZKC B;  2K5D A;  1CUK A;  4CKC A;  3NTH A;  2E5L Q;  2WAQ G;  5C4X H;  1IBL L;  3GTL B;  2D9U A;  5T1I A;  1Q82 C;  3E9I A;  3PUX A;  4Y7N B;  4JI6 Q;  2VB2 X;  3CU7 A;  3CCQ A;  2L12 A;  3PMF A;  1VQH A;  3GV3 A;  3GTJ H;  4HSP A;  2DN8 A;  1GOZ A;  2L1B A;  3N6R A;  5M3F G;  2XRQ D;  3GO5 A;  2PZW A;  5CYU A;  1Y8N B;  2UUB Q;  3K0Y A;  5GAG C;  3PGZ A;  1EOT A;  3D0F A;  4KY7 A;  4HR7 B;  4BXX G;  2K28 A;  3JAM i;  1W2B A;  1FJG L;  2ZXP A;  4LF5 L;  4BBR H;  1MJC A;  1I6V C;  4DU9 A;  3HP3 A;  2F0S A;  3ICE A;  5C0X J;  1N8R C;  3CQZ B;  4DK0 A;  4YWL A;  1TWC B;  2IHE A;  3T53 B;  2UXC Q;  3EA6 A;  1I4X A;  4CDE C;  1DON A;  4LF6 Q;  3HOV H;  3J7A F;  1V66 A;  3EBE A;  2ENB A;  3AQQ A;  1C4Q A;  1I6H B;  4RGT A;  3B6Y A;  3VA5 A;  1CKN B;  3X3M A;  3H15 A;  3SK6 A;  3S2H B;  1WFQ A;  5EJW A;  1EIH A;  1S4Z A;  4X62 Q;  1EL0 A;  5JAV A;  4A3L G;  1Q1B A;  1VCI A;  4OO1 I;  2N55 A;  1TWF H;  1RKN A;  4IPC A;  5C4X G;  3H09 A;  1BCP D;  2SEB D;  3KK7 A;  4ZCK A;  3QWN A;  2E2D C;  3CF5 A;  1GO3 E;  2G9H D;  1GKH A;  3CW2 C;  4LF9 Q;  2JA5 H;  2KBN A;  4IJH A;  5DEH A;  2QGQ A;  3I8Z A;  2A1A A;  1C7Y A;  1VQ6 A;  3D6C A;  4KHV A;  1EY4 A;  2D0P A;  2ODC I;  3KF8 A;  1X54 A;  2HIX A;  2EE1 A;  2VS1 A;  5I2X A;  2NWG A;  2CQA A;  1CQF A;  2M9V A;  4B3T Q;  4JI5 Q;  4BBR G;  3T1Y L;  2YTV A;  1FD7 D;  3CXC A;  1CA5 A;  4FF4 A;  2K33 A;  4JI4 L;  4RKL A;  2Q8R E;  1PA6 A;  2VB3 X;  1ICW A;  1E2W A;  4L5Q A;  5A2Q L;  4LFA L;  3BU2 A;  3PO3 H;  3NUC A;  1HUN A;  2LXK A;  4PMW A;  4OEL B;  1WJJ A;  1STN A;  5JOB A;  2ICE C;  3HOV G;  3T4A C;  4HMJ A;  1YHQ A;  1GUT A;  1PH8 A;  2B2V C;  2R93 H;  5ELB A;  2VNU D;  4DV5 L;  3D3R A;  2XTI A;  3S9W A;  2QA4 A;  1WOC A;  1YEZ A;  1K0S A;  5ELO A;  1IZ6 A;  1LTS D;  3L2P A;  3NEM A;  4GLX A;  1QG7 A;  3J7A 5;  1ILQ A;  3RD4 A;  3CC2 A;  2NVT H;  4DR3 Q;  5LHY 1;  3H91 A;  5IY0 A;  4JBJ A;  2PW7 A;  2JA5 G;  3OHX C;  4DV6 Q;  2WII B;  1SYF A;  2F0N A;  3C1E A;  1WCM B;  1XMQ L;  3CCS A;  4LNQ A;  3KDF B;  4NXM Q;  3I55 A;  2K32 A;  4A3M B;  2HQL A;  2RDG A;  3GTP H;  1O80 A;  1FNU A;  3ZJY C;  2AQ3 B;  2B63 B;  3ERS X;  1G91 A;  1B53 A;  2JEA I;  4JV5 L;  1HZB A;  2VQE Q;  4HJ5 A;  2B2U A;  4DA2 A;  2K4K A;  3PO3 G;  1CKN A;  4OWW B;  1PRT B;  2AHO B;  3TZU A;  1PFB A;  3TZD A;  5M3M B;  3PO2 H;  2Y0S G;  3PUY A;  5KIX A;  1EEF D;  3UDI A;  3GTQ H;  1LTI D;  3VR5 A;  3HKZ E;  3S17 B;  1RCV D;  4IPH A;  2B8F A;  4X65 L;  2R93 G;  4DV2 Q;  4FVM A;  3QJY A;  2I5L X;  2VL6 A;  4JI2 Q;  4UAI A;  1X56 A;  4A3F H;  3NSW A;  2PYK A;  3WOE A;  1BDO A;  4XT1 B;  1YJN A;  3NP8 A;  4IUU A;  4IUP A;  3U4V A;  1EWH A;  3BVZ A;  5IGC A;  1GVP A;  1XWE A;  2CHB D;  4FXK C;  3M3Y B;  1HPC A;  5CV6 A;  3TRZ A;  2L4N A;  3NTK A;  3KFU A;  1H9K A;  2EZV A;  1AE2 A;  4KI0 A;  3H0G H;  1RTN A;  2HCC A;  3NPP A;  3J81 E;  1PTO B;  4A4I A;  4X64 Q;  1YNX A;  1L0W A;  2F0G A;  1KNE A;  4R4O A;  1TS2 A;  4HIO A;  2KCN A;  5TSS A;  2KED A;  1VQM A;  2V1C C;  1DCZ A;  5LMN W;  4HJ9 A;  3EVQ A;  1IYV A;  3FMC A;  2RSO A;  3HKS A;  2G80 A;  1JE4 A;  3I7F A;  1HNW L;  1SNP A;  2FFK B;  1ESF A;  5IE8 A;  1B1Z A;  2NN6 H;  3KLS A;  2F1M A;  3X3N A;  2BE5 C;  2F3I A;  1V1O A;  4A3G H;  5LL6 S;  1F9Q A;  3I73 A;  1U0L A;  3A0J A;  3PO2 G;  5C3E H;  4FF1 A;  1DXM A;  4IFD I;  2RA4 A;  1VQF A;  4OON A;  3D6W A;  2EYO A;  1EWI A;  3LX0 A;  1Q7Y C;  2A68 D;  3GTL H;  4IQZ A;  1MSH A;  4GNX B;  4A3E G;  1IBM L;  2K5H A;  2NBF A;  1YNJ D;  2WKD A;  4A3F G;  1YVC A;  2H4O A;  2OF1 A;  1VQK A;  1HH2 P;  1IL2 A;  4A3J G;  1SDF A;  2OTJ A;  2FMM A;  1GUN A;  5BR8 Q;  3S16 H;  2WAQ B;  3A74 A;  3CKI B;  3P75 A;  3A5U A;  2C5C A;  3KDF A;  1TQO A;  5IYB H;  3FPU B;  2XN9 C;  2MJ8 A;  1YHB A;  2NVQ B;  3SHL A;  2HHH L;  3BZC A;  3KF6 B;  3Q6S A;  5EKK A;  1N32 L;  2KOL A;  1PH5 A;  1TWC H;  1A0I A;  3IKJ A;  4KTA A;  1W6K A;  4JI1 Q;  2GVA A;  3SEB A;  2IHF A;  1II3 A;  1H1J S;  1J6Q A;  1BOS A;  5EPK A;  5M5X H;  2OQ0 A;  4HIM A;  1A6X A;  1LLR D;  2NN6 G;  2NUC A;  2WAC A;  1IL8 A;  4A3G G;  3WOF A;  4LAA A;  3S15 B;  2LFN A;  3S2H H;  4DR7 Q;  1LUZ A;  1L1O B;  2WB1 G;  1EOV A;  4HN7 A;  4JYA L;  3C2P A;  5C3E G;  1AZP A;  1KNA A;  1STE A;  1XJV A;  4ZUI A;  2E75 C;  3ITP A;  1F9R A;  3K5N A;  4DV7 L;  2KJX A;  1LT3 D;  3SK4 A;  2E2I B;  3H6M A;  4KLK A;  1Q8K A;  1KLU D;  1X9N A;  1PH1 A;  4OXP A;  1S5F D;  1HTP A;  4LMQ D;  1LTT D;  2MGS A;  3K7U C;  2Q2T A;  1SRU A;  5FJ8 G;  3HZX A;  5M5Y H;  1NCV A;  5C4X B;  1S40 A;  1T5E A;  1CM9 A;  4C56 C;  1SYE A;  2O4X A;  4FP5 D;  4DAP A;  1UUP A;  2ZXO A;  2LMC B;  4RCN A;  1RL2 A;  1AH9 A;  1SNM A;  3GV6 A;  1LT5 D;  1EY6 A;  4APV A;  4LF9 L;  1HXY D;  5CBA E;  3TS2 A;  2J7Z A;  2EQS A;  4AQY L;  1J9O A;  4Q5V A;  4BBR B;  4MN3 A;  3KBX A;  4AYB G;  2B29 A;  1S3O A;  4ODG A;  3T56 B;  4CDD C;  1I4G A;  1SEB D;  1B3Q A;  2Z4I A;  4GNX A;  2MNA A;  1N33 L;  1AE3 A;  3SK8 A;  1DOK A;  1OXV A;  3I70 A;  5IGD A;  4OO1 H;  1JWM D;  3RLF A;  4QGU A;  3HOV B;  4HTH A;  2JA7 B;  3U58 A;  1ROD A;  4K8J A;  4A3C H;  2VQF L;  4GN3 B;  4L5T A;  4FXD A;  3I90 A;  1JB3 A;  1FNV A;  3W3A A;  1L2F A;  4C3H G;  4CDF C;  5C5L A;  1PH2 A;  1ILP A;  2BCO A;  1WCM H;  1JR0 D;  2B2Y A;  2F0L A;  4H44 C;  4ALP A;  3KF6 A;  2MFI A;  1XNR Q;  1H9F A;  1BCP C;  5JEA H;  1TWF B;  3PSI A;  4PMB A;  4A3M H;  5D14 A;  3MEF A;  3EN2 A;  2B63 H;  2EVB A;  3JAM E;  1VQ5 A;  5ISR A;  1YZ6 A;  4Q0F A;  2JA5 B;  4MIU A;  3T16 A;  1H9M A;  2MO0 A;  5CGK A;  4WFN 3;  1NR4 A;  3RZO H;  4R4C A;  4DV0 L;  4X6A H;  1JMC A;  1ML0 D;  1KC8 C;  5M3M H;  5EGT A;  4JBK A;  1L1O A;  1KQS A;  3DEP A;  1EYC A;  2ODG C;  1FNW A;  1G8Z D;  1LAB A;  3EQL C;  4JVZ A;  2F4I A;  4ZAI A;  3F2D A;  3TME A;  3DMU A;  4U67 3;  1KL9 A;  4EQP A;  1ASY A;  2NVX B;  4FDB A;  2ZT9 C;  4IPG A;  4A75 A;  4EX5 A;  1J8I A;  4OWT B;  5JVH 3;  3PO3 B;  1E2V A;  4L6T B;  4K2K A;  1Y1W G;  1BKB A;  3IAY A;  4OO1 G;  2RDF A;  3J7A V;  1IYJ B;  1RDP D;  1WTO A;  3PV0 A;  2QEX A;  3M3Y H;  1O78 A;  1QIL A;  1TS3 A;  1H95 A;  2K03 A;  3PIO 3;  2R93 B;  4XDX A;  4A3C G;  4FF3 A;  4CKE A;  2R61 A;  1PTO H;  2KVM A;  5J39 A;  5JVG 3;  2Q8I B;  1WCM G;  3R2I A;  3VYT A;  4JI2 L;  5JEA G;  1CZW A;  4UP8 A;  2GN5 A;  4A3M G;  3OTO L;  1HQR D;  3GTK H;  1HQM C;  3MXN B;  1HRJ A;  2AKW B;  4XIG S;  4XTC S;  3FHW A;  1GHJ A;  3C1F A;  2B63 G;  4BBS B;  2C35 B;  3K7A B;  3F2C A;  3HOX B;  1Y1V B;  1HZA A;  3CCR A;  2A74 C;  4CHT B;  3MVV A;  2PI2 A;  2BE5 D;  2QNF A;  4ID6 A;  2F0I A;  3OMG A;  4JCV E;  4LF7 Q;  5M3M G;  4LJZ C;  4DV1 Q;  1SYG A;  1SRO A;  3QR8 A;  3GTP B;  4YY3 Q;  4J15 A;  4DGZ A;  1QNU A;  1KHC A;  4C2M B;  3F2U A;  1HNZ L;  4XQN A;  2ZM6 L;  1XMO Q;  1PZJ D;  1SJH D;  4DR2 Q;  5DM7 3;  5IT9 L;  5HGQ A;  3FDT A;  2PMZ B;  3GTQ B;  2QCP X;  1L0X B;  1BO0 A;  1BXT A;  4ZUJ A;  1XNQ L;  2OEO A;  4GS3 A;  3OOC A;  4A3E B;  4G7Z C;  2EPB A;  4F88 A;  3SE0 A;  1F2L A;  1FGB D;  4A3F B;  2B3G A;  1VQJ A;  1EYG A;  4XYQ A;  4A3J B;  3M4O B;  4KK7 A;  1A2T A;  3CP0 A;  5JJI A;  1B70 B;  3QOL A;  4JPB W;  4HIK A;  4JI7 Q;  2ZXR A;  3GTG B;  2KEN A;  2B8G A;  4BY1 B;  1ICF B;  5A2Q E;  2KCT A;  2X69 A;  2KHI A;  4M1U B;  4JG2 A;  3S15 H;  4B3S L;  4JI8 L;  1DOL A;  3HOY H;  2LKV A;  2F3V A;  1WTR A;  3BS1 A;  1EU3 A;  2JQO A;  3SDZ A;  4IFD H;  1CHP D;  2LC3 A;  5JPN C;  2DY8 A;  2HUG A;  2FHT A;  2BOS A;  4JOI A;  4NXN L;  2E2I H;  5BN4 A;  1NUC A;  2K75 A;  1ZBH A;  5IGF A;  1JEI A;  3Q22 A;  4UP7 A;  1SSO A;  5E1F A;  4BY7 H;  2PZU A;  1PDQ A;  5JJK A;  4JI3 Q;  2SNS A;  3I4M B;  5J1Z A;  1PTO F;  2A68 C;  5FLX c;  4A3D H;  2EYH A;  1Y02 A;  3CME A;  4K14 A;  1BF4 A;  4B3R L;  1PYS B;  4X66 Q;  1PYW D;  3CPW A;  3R2T A;  1ZYR C;  2VXW A;  3AFP A;  4FYD A;  2MUY A;  1YNJ C;  1EYD A;  5C4Z A;  1LTA D;  2F03 A;  2A73 B;  1EUJ A;  1B44 D;  1NY4 A;  2K04 A;  4JI0 Q;  4IOA A;  1F2Z A;  3MXN A;  1E7L A;  2KW9 A;  1EQR A;  1YJ9 A;  3A8I E;  2NTT A;  5IYD H;  1TT2 A;  1EQT A;  1CSP A;  1X6O A;  2ZTC A;  1ET6 A;  1D1I A;  2F0H A;  1SYC A;  4FNF A;  4DUY L;  3S16 B;  1FYC A;  1QJO A;  2F0D A;  1NMF A;  1QUQ B;  2K6A A;  2F0W A;  3GTO B;  2ZJQ A;  5CC4 A;  5G3L F;  3DM1 A; 
#chains in the Genus database with same CATH homology
 2AHO B;  1JJG A;  1XMQ Q;  1UEB A;  3PO2 H;  2Y0S G;  3PUY A;  4P74 A;  3HOY G;  1G29 1;  3KJP A;  3GTQ H;  3UDI A;  3STB C;  3HKZ E;  5LMN Q;  1VQ8 A;  3K80 C;  4IFD G;  4IPH A;  5GQO A;  4X65 L;  2R93 G;  4DV2 Q;  1Q1E A;  1Y14 B;  4PZ8 A;  5IP7 H;  4DUY Q;  2I5L X;  4DKA C;  3F8T A;  2JA7 H;  2VL6 A;  1FGU A;  4JI2 Q;  3M7N A;  2UXB L;  2KFV A;  5EAY A;  4X64 L;  1X56 A;  5IYC H;  4A3F H;  4JV5 Q;  1C0A A;  2LSS A;  5IWA L;  4P75 A;  1YJN A;  4IJL A;  1I94 L;  3U4V A;  1X3G A;  1E1O A;  4DNI A;  2UUA L;  4BY7 G;  1W3S A;  1JB7 A;  1LYL A;  2CKZ B;  1GVP A;  4GLA C;  4BA1 I;  1H9E A;  5IYB G;  4IO9 A;  3CD6 A;  3IRB A;  2OCE A;  3TRZ A;  4GKJ L;  3AYH B;  1VQN A;  3KFU A;  4A3D G;  2A8V A;  2AWO A;  4YCU A;  5C44 G;  1EIY B;  4X65 Q;  3FKI H;  1AE2 A;  4KI0 A;  2YV5 A;  3H0G H;  3D31 A;  1JE5 A;  3HFZ B;  3PCO B;  3BJU A;  2UXB Q;  4A4I A;  4RMF A;  4X64 Q;  1YNX A;  1NBW A;  1TWG H;  1L0W A;  2PI2 E;  4DUZ L;  5IWA Q;  3M4Q A;  3PUZ A;  4R4O A;  3PIP A;  4HIO A;  1M90 C;  3ULP A;  4DR6 L;  2N49 A;  5IYD G;  1I94 Q;  2UUA Q;  4YHH L;  4HID A;  4PG3 A;  3VDY A;  1VQM A;  2V1C C;  4HJ8 A;  2OTL A;  5LMN W;  4HJ9 A;  4GKJ Q;  3HKS A;  2G80 A;  4LW1 A;  3I7F A;  4MNO A;  1MJE A;  1IXR A;  1HNW L;  2VW9 A;  3W5O A;  1A62 A;  3F1Z A;  5IE8 A;  3DM3 A;  4UPA A;  4R4Q A;  1GD7 A;  3AFQ A;  2F3I A;  3TS0 A;  4A3G H;  1VQ7 A;  2HIV A;  4DR5 L;  4DR4 L;  3EIV A;  2NVX H;  1VQB A;  3JAM c;  2D62 A;  4DUZ Q;  1HR0 L;  1VQL A;  1U0L A;  2VY3 A;  3A0J A;  3PO2 G;  4KHP L;  4DR6 Q;  5C3E H;  1UE7 A;  3UE0 A;  4IFD I;  4GOP A;  4YHH Q;  1VQF A;  5BR8 L;  3UDG A;  4DV3 L;  2IT1 A;  4OON A;  2E2J H;  1PH7 A;  1EWI A;  1Q7Y C;  1UE6 A;  4ME3 A;  3GTL H;  2NZO A;  3FP9 A;  2W51 A;  4YWM A;  5IP7 G;  4GNX B;  4PZ7 A;  1HJP A;  2OQK A;  3T1H L;  2YTY A;  4A3E G;  1K8A C;  2ZTD A;  1IBM L;  2K5H A;  1A8V A;  3DLL A;  1ASZ A;  2JA7 G;  2JEB I;  1HNW Q;  5IYC G;  4A3F G;  2CFM A;  2A19 A;  1YVC A;  4DR1 L;  3GD7 A;  1X65 A;  3K0X A;  3Q8D A;  1VQK A;  1VQI A;  4DR5 Q;  4A93 H;  1HH2 P;  1IL2 A;  4DR4 Q;  4JI1 L;  2NVY H;  4A3J G;  3CCE A;  4BA2 I;  3BZK A;  3LGJ A;  3J81 i;  1HR0 Q;  2OTJ A;  5GAH C;  4KHP Q;  5BR8 Q;  3S16 H;  4DV3 Q;  3A74 A;  4B3M L;  1IBK Q;  3A5U A;  2D0O A;  4YWK A;  4KHZ A;  3FKI G;  3KDF A;  3I4O A;  5IYB H;  2RF4 A;  1V1Q A;  4L5S A;  1YHB A;  2CWA A;  2HJQ A;  4RG1 A;  2HHH L;  2FXQ A;  3BZC A;  1IBM Q;  3KF6 B;  4DR7 L;  4LF4 L;  4BBS H;  1N32 L;  3WWV A;  4HJ7 A;  3K7A H;  3J81 j;  3H3V H;  3HOX H;  2VUM H;  1Y1V H;  5HY6 A;  4DR1 Q;  1PH5 A;  3I56 A;  1TWC H;  1A0I A;  3J7Z C;  5GAD C;  2K14 A;  2WB1 E;  1QUQ A;  2R7F A;  4JI1 Q;  3S17 H;  3PUW A;  3GDE A;  1XPR A;  3HOW H;  1VQD A;  2GVA A;  3ER0 A;  1SN8 A;  1SLJ A;  2IHF A;  2E8G A;  1VQP A;  1PVO A;  4DV4 L;  1OXT A;  2ID0 A;  4B3M Q;  2Y0S E;  1J6Q A;  1PH4 A;  5M5X H;  2OQ0 A;  4HIM A;  1K0R A;  4NPS A;  2VUM G;  2NN6 G;  1J5E L;  2UU9 L;  2HHH Q;  4C2M H;  4JOI C;  4A3G G;  2Q2H A;  2R6G A;  2JA8 H;  2IY5 B;  4LFC L;  3AEV A;  3S2H H;  1LUZ A;  1L1O B;  4DR7 Q;  1N32 Q;  1G51 A;  1OXX K;  2WB1 G;  1EOV A;  1GL9 B;  1LM0 A;  4JYA L;  2NZH A;  5C3E G;  4JBM A;  1KRT A;  3RN2 A;  5K36 G;  3S1N H;  4UP9 A;  1XJV A;  3TEH B;  1N36 L;  1PH9 A;  3S1M H;  4OWX B;  4DV7 L;  1SE8 A;  2PNH A;  4DV4 Q;  4KLK A;  3CAM A;  1YIJ A;  1Q8K A;  2ALY B;  1O7I A;  2VZA A;  4A3B H;  1VQG A;  1X9N A;  1PH1 A;  4OXP A;  1J5E Q;  3CCM A;  4UY8 C;  2UU9 Q;  4HJA A;  4A3E H;  4QQB X;  2DUD A;  5AJ3 L;  4A76 A;  4LFC Q;  1I50 H;  4A93 G;  3K7U C;  2Q2T A;  1SRU A;  1B7Y B;  3K81 C;  4JYA Q;  4LFB L;  5FJ8 G;  2PQA B;  1K8G A;  2EIF A;  5IT9 c;  2RHQ B;  2RHS B;  5M5Y H;  2AWN A;  1E7Z A;  4A3J H;  1S40 A;  1N36 Q;  3M4O H;  4DV7 Q;  2E2H H;  4OX9 L;  3CC7 A;  4R1J A;  4YCW A;  1E3P A;  1N9W A;  3E0E A;  1R9T H;  4POG A;  2Z6K C;  1CKM A;  3UDX A;  1X3F A;  4GN4 B;  4BBS G;  4H02 A;  3GTG H;  1Z9F A;  1VQA A;  2JE6 I;  1HZC A;  2DK4 A;  1Y1V G;  1RL2 A;  3HOX G;  1Q86 C;  3A5Z B;  5AJ3 Q;  1KD1 C;  4BY1 H;  1AH9 A;  4DK3 C;  1CKO A;  4APV A;  2K5V A;  1SR3 A;  1GJJ A;  2WP8 J;  3CC4 A;  1PH6 A;  1B8A A;  2YU9 H;  4IPD A;  3OW2 A;  4LF9 L;  1GKU B;  5E7N A;  2ASB A;  3HOW G;  4LFB Q;  4GLV B;  4EQ5 A;  3TS2 A;  3RLN A;  2EQS A;  2PMZ E;  4O2D A;  3SGI A;  4LWC A;  2NN6 I;  4AQY L;  4A3K H;  2RCN A;  4OX9 Q;  2MPH A;  4WJ3 M;  3ULL A;  3M4P A;  1E22 A;  4MZ9 A;  4QL5 A;  3UDF A;  4AYB G;  2B29 A;  1KHI A;  2CWP A;  1S3O A;  4A3I H;  1V43 A;  4TVA B;  2JA8 G;  1V9P A;  3KLW A;  1KIX A;  1PHJ A;  2UUC L;  4GNX A;  4LF8 L;  3HOU H;  3PO3 G;  2MNA A;  4JC0 A;  1ZS9 A;  4WJ4 A;  1N33 L;  1AE3 A;  1BBU A;  4MTN A;  2BA0 A;  1PH3 A;  1XNR L;  1OXV A;  1PFS A;  4JI7 L;  3M85 A;  3RLF A;  1EQQ A;  4QGU A;  3I4M H;  4DAM A;  2ZJR A;  2NVQ H;  2N78 A;  1OXU A;  2I0Q A;  3U58 A;  1SFO H;  4AQY Q;  2K5N A;  2Q2U A;  2HT1 A;  4QIW E;  2I5H A;  1HNX L;  4A3B G;  4A3C H;  2VQF L;  2L15 A;  2QNC A;  2I5M X;  2Z0S A;  4GN3 B;  4L5T A;  1BVS A;  5M3F H;  1PH2 A;  1L2F A;  3RZD H;  4Y52 H;  2UUC Q;  1NJI C;  4LF8 Q;  4BXX H;  1WCM H;  1N33 Q;  4ALP A;  3KF6 A;  2MFI A;  4QY7 A;  2F4V L;  1XNR Q;  1H9F A;  4LUV A;  4P72 A;  3PSI A;  3RR5 A;  5GRO A;  1CSQ A;  3RNU A;  4A3M H;  1K83 H;  5FJ8 H;  3PF5 A;  3MEF A;  4DPG A;  3EN2 A;  5LMU L;  3KF8 B;  4C3J H;  3PIO A;  2B63 H;  1YNS A;  4R4I A;  1VQ5 A;  2K50 A;  3H3V I;  1HNX Q;  4GKK L;  1PYB A;  1YZ6 A;  2YTX A;  1N34 L;  2VQF Q;  1D7Q A;  1HR0 W;  1NMG A;  2MO0 A;  4JBW A;  1SMX A;  3T1H Q;  2KHJ A;  3CCL A;  3GTO H;  3NEL A;  4BY1 G;  1TWA H;  4R4C A;  2E5L L;  3RZO H;  1I5F A;  2ES2 A;  4DV0 L;  2MO1 A;  3G71 A;  4X6A H;  1JMC A;  4K0K L;  1KC8 C;  5M3M H;  4NB3 A;  2F4V Q;  4GOP C;  4AH6 A;  4JBK A;  1L1O A;  1KQS A;  2LXJ A;  2ODG C;  4JI6 L;  4POF A;  4A3K G;  3STB D;  2CCZ A;  1I3Q H;  3F2D A;  5M5W H;  1OTC A;  4AIM A;  2UXD L;  5LMU Q;  2ZJP A;  1ASY A;  1KL9 A;  3OYY A;  1A63 A;  2LD7 A;  5FLM H;  4FDB A;  2KCM A;  4A3I G;  4GKK Q;  4IPG A;  2UUB L;  1X3E A;  2R92 H;  2ZTE A;  4EX5 A;  4A75 A;  4A3L H;  1M1K C;  3HOU G;  1LTL A;  4OWT B;  3CMA A;  5JEA J;  1FVI A;  2N3S A;  2WFW A;  1CUK A;  1U5K A;  1Y1W G;  1S72 A;  2E5L Q;  5JJL A;  1BKB A;  2WAQ G;  5C4X H;  3S24 A;  4DV0 Q;  1IBL L;  4LF4 Q;  4K0K Q;  4OO1 G;  1IYJ B;  3I4M G;  4DAY B;  3PV0 A;  2QEX A;  3M3Y H;  1Q82 C;  1YJW A;  1Q46 A;  3E9I A;  1H95 A;  3KYH C;  3PUX A;  1XPU A;  3TRE A;  4JI6 Q;  1EIF A;  3CCQ A;  2PQA A;  4A3C G;  2IX1 A;  1VQH A;  3S1R H;  2K52 A;  3GTJ H;  2UXD Q;  1E1T A;  2YYZ A;  1G6P A;  1VQ4 A;  5M3F G;  3GO5 A;  2UUB Q;  2XGT A;  5GAG C;  2UXC L;  3PGZ A;  1QVF A;  1YBY A;  3D0F A;  4BXX G;  1WCM G;  4LF7 L;  4LF6 L;  1TXY A;  3JAM i;  5C4J H;  4DV1 L;  4JI2 L;  4C3H H;  1W2B A;  5JEA G;  1FJG L;  1IBL Q;  4UP8 A;  1OXS C;  4YY3 L;  2GN5 A;  4A3M G;  1VQE A;  4BBR H;  3OTO L;  1K73 C;  1MJC A;  4LF5 L;  3GTK H;  3PUV A;  3MXN B;  3ICE A;  2AKW B;  4XIG S;  4XTC S;  3FHW A;  1D8L A;  5C0X J;  2B63 G;  3HOZ G;  2C35 B;  4X62 L;  3F2C A;  1N8R C;  1P8L A;  4YWL A;  1HZA A;  1TWH H;  3CCR A;  4DR2 L;  1XMO L;  2IHE A;  5J3B A;  3J81 c;  4C3I H;  2PI2 A;  2UXC Q;  4AYB E;  2QNF A;  3G6E A;  1QZH A;  5IP9 H;  4JCV E;  4LF6 Q;  4LF7 Q;  3HOV H;  5M3M G;  3EBE A;  2GVB A;  4DV1 Q;  3CCU A;  3AQQ A;  1SRO A;  1T9H A;  1FJG Q;  3CCJ A;  4YY3 Q;  3B6Y A;  3E9H A;  1CKN B;  1P16 A;  2R7D A;  4J15 A;  3OTO Q;  1QZG A;  4LF5 Q;  3J80 c;  4O0A A;  3H15 A;  3JC6 6;  1XPO A;  1QVC A;  2DGY A;  1HNZ L;  1MIU A;  1K3R A;  5FLM G;  1WFQ A;  2ZM6 L;  4X62 Q;  1JJC B;  2R92 G;  3HKZ G;  4PZ6 A;  5C0X G;  1XMO Q;  4DR2 Q;  1VS0 A;  4L5R C;  4A3L G;  2BA1 A;  1Q1B A;  4YCV A;  5HGQ A;  1VCI A;  2MQH A;  4OO1 I;  1TWF H;  3G48 A;  1YHA A;  4IPC A;  1HZ9 A;  5C4X G;  4B3T L;  4JI5 L;  5DLQ E;  4GN5 A;  1VQO A;  1WYD A;  3NBH B;  2ATW A;  1Y1W H;  3S14 H;  3KJO A;  3CF5 A;  1GO3 E;  1KRS A;  1GKH A;  2Q2I A;  3L7Z C;  4GS3 A;  3CW2 C;  4QJF A;  1XNQ L;  3I4N H;  4LF9 Q;  1DGS A;  2BH8 A;  2JJQ A;  2JA5 H;  2KBN A;  4IJH A;  2QGQ A;  1HNZ Q;  2CQO A;  2A1A A;  1C7Y A;  1VQ6 A;  2ZM6 Q;  5H1S E;  2N8N A;  2B3G A;  2JA9 A;  2D0P A;  1VQC A;  2ODC I;  1YI2 A;  1X54 A;  2HIX A;  1VQJ A;  1EYG A;  3S2D H;  2VS1 A;  4TQU S;  1K9M C;  3W1G A;  1BBW A;  4B3T Q;  4JI5 Q;  4BBR G;  3T1Y L;  3CP0 A;  2YTV A;  1B70 B;  5JJI A;  1JT8 A;  1MKH A;  1E7D A;  3CXC A;  4JI4 L;  3L0O A;  4HIK A;  4JI7 Q;  1XNQ Q;  2JA6 H;  1PA6 A;  2R7Z H;  2KEN A;  4L5Q A;  4LUO A;  3BU2 A;  4LFA L;  3PO3 H;  2KCT A;  2KHI A;  2LXK A;  4PMW A;  1IBK L;  1Z47 A;  4JG2 A;  5GAE C;  1WJJ A;  4B3S L;  4JI3 L;  3S15 H;  3HOZ H;  4JI8 L;  3UE1 A;  4GNX C;  4DR3 L;  1GM5 A;  3HOY H;  1UE1 A;  5IP9 G;  1UE5 A;  3HOV G;  2JQO A;  1YHQ A;  4Y7N H;  2H5X A;  1PH8 A;  1EN7 A;  2LC3 A;  3M9B A;  4R4T A;  4X66 L;  2R93 H;  2F52 A;  2VNU D;  4DV5 L;  3T1Y Q;  2XTI A;  1Q12 A;  2WAQ E;  3CCV A;  1XTD A;  2EXD A;  1YIT A;  4JOI A;  3G4S A;  1WOC A;  2QA4 A;  4NXN L;  3U4Z A;  3U50 C;  4DV6 L;  1UWV A;  2E2I H;  4JI4 Q;  1KXL A;  3NEN A;  5C0X I;  4GOP B;  1YEZ A;  5ELO A;  1IZ6 A;  2AMC B;  3L2P A;  2JK8 A;  2K75 A;  3NEM A;  1JEI A;  4GLX A;  1EFW A;  4JI0 L;  4UP7 A;  3J7A 5;  4P71 A;  4LFA Q;  4BY7 H;  3I2Z A;  4LUZ A;  4NXM L;  5JJK A;  3CC2 A;  4B3S Q;  4JI3 Q;  2NVT H;  3KOJ A;  4JI8 Q;  4DR3 Q;  1N34 Q;  3H0G G;  1E24 A;  4A3D H;  5FLX c;  2OWO A;  5IY0 A;  1Y02 A;  3ULJ A;  2IX0 A;  3J80 i;  5C44 H;  1PYS B;  3CME A;  4X66 Q;  4JBJ A;  1X55 A;  3CPW A;  4B3R L;  3I4N G;  3AFP A;  1NTG A;  4DV5 Q;  1RIP A;  3CQZ H;  3RLO A;  2JA5 G;  2VQE L;  3RN5 A;  1KAW A;  4NXN Q;  4DV6 Q;  1EUJ A;  3W1B A;  1NY4 A;  3GTM H;  4JI0 Q;  4IOA A;  1YJ9 A;  1FL0 A;  1E7L A;  1XMQ L;  1EQR A;  3CCS A;  1VQ9 A;  4LNQ A;  4IFD J;  5IYD H;  3KDF B;  3CPF A;  1WI5 A;  3I55 A;  4NXM Q;  5LMN L;  1CSP A;  1X6O A;  3K8A A;  2ZTC A;  2HQL A;  3GTP H;  1I6H H;  1NE3 A;  4DK6 C;  4DV2 L;  4P73 A;  3ZJY C;  4DUY L;  1QVG A;  3F2B A;  1L1O C;  3S1Q H;  4B3R Q;  3ERS X;  2Z6K A;  3PF4 A;  4JV5 L;  1Q81 C;  2JEA I;  4IOC A;  1PV4 A;  1NMF A;  1QUQ B;  1HZB A;  2JA6 G;  2R7Z G;  2VQE Q;  4HJ5 A;  2ZJQ A;  1C9O A;  3TQY A;  2K4K A;  5ELN A;  1JJ2 A;  1CKN A;  2BH2 A;  4OWW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...