1A62A

Crystal structure of the rna-binding domain of the transcriptional terminator protein rho
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO
publication title Crystal structure of the RNA-binding domain from transcription termination factor rho.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transcription termination
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07497 Rho_RNA_bind Rho termination factor, RNA-binding domain
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a62A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a62A02
4DV5Q 2OTLA 1PYBA 4DR2L 1MJEA 3PO3H 1Q1BA 3AYHB 4POFA 3KOJA 1N34L 1WFQA 4A3BH 3D31A 4LF8Q 2IT1A 1BBWA 1TWCH 3EBEA 1B7YB 2CQOA 1X3EA 4JCVE 4C2MH 2BH8A 3CCQA 4GOPA 2VW9A 1WCMH 2E2IH 2NVQH 3T1HL 1N33L 4OWWB 4OO1I 2MO1A 4A3EH 4JI2L 1IYJB 2R92G 1KRSA 2K50A 2CCZA 3L2PA 2MO0A 2MFIA 1IBMQ 2YTXA 5GAGC 5IE8A 4DV1Q 3CF5A 2VUMG 1LUZA 4A93G 3DM3A 4OX9L 3GTJH 1X6OA 2F3IA 3OTOL 3F2BA 2Z0SA 1HZCA 1UE1A 2ASBA 2D62A 2JA6H 2VQFQ 1E22A 1SN8A 3GTQH 1AE2A 4B3TQ 2HHHQ 2CWAA 1PH3A 2NN6I 3BZCA 2C35B 4EX5A 4K0KQ 2RHSB 4DAMA 3T1YQ 3HOVH 3KF8B 3FKIG 4HJ5A 4GLAC 3CC2A 2F4VL 3HOWH 1G291 2K5VA 3UDGA 4LF6Q 1WYDA 2HIVA 1PHJA 1HNWL 4L5SA 5M3MG 4X6AH 2ZJRA 1HH2P 1VQ7A 3CPWA 2UUAQ 1PH1A 4PZ6A 1N32L 5HGQA 3CQZH 1UE7A 5ELNA 1ASZA 2VZAA 2JA7G 2QNCA 3A0JA 2OQKA 1Y1VH 3ERSX 4IPDA 4DAYB 1XMOL 3BZKA 3HOXH 4DV0L 1U5KA 3HOUG 1VQCA 4DV2L 4IPCA 1P8LA 5M5WH 4BA1I 4DR6L 1M90C 4YHHL 2QEXA 1GKHA 4GS3A 4AH6A 4BY1G 4QGUA 2PQAB 3I56A 4GN3B 3I4NG 4JV5L 4JOIA 3AFQA 4JI5L 3J80i 1KQSA 1VQHA 4IPGA 3W1BA 4B3SL 4BBSG 3U4VA 3PGZA 5C4XH 4GNXA 4X66L 3HKZG 2OCEA 4A3MH 2Y0SE 4LUVA 3D0FA 5IP9H 2PI2E 2VS1A 1E24A 3H3VH 2ID0A 2JK8A 3PUWA 4R4IA 4DV6Q 1Y1WH 4B3MQ 1I94Q 1YNXA 5BR8Q 1WI5A 3KF6A 5LMNW 4LF4Q 4HJ9A 1PH2A 1N9WA 3CAMA 5IYBH 3ULPA 3L0OA 2WAQE 1XNRL 4Y52H 4A3FH 2CWPA 4J15A 1TWAH 3H0GG 4POGA 3W1GA 3CMAA 5J3BA 2R93G 1VQAA 2VY3A 3GO5A 2XTIA 3ULJA 4HJAA 4A3GG 1SE8A 1E7DA 1CUKA 2E8GA 1FJGL 3SGIA 2ZM6L 1QZGA 2K75A 4LF9Q 1I6HH 4DR7Q 3KF6B 1QZHA 5GQOA 1PA6A 2UU9Q 1FVIA 3CPFA 2BA0A 3HOYH 4AQYL 5AJ3L 2AMCB 2OQ0A 2R6GA 1OXVA 4MNOA 5IWAQ 1VQMA 3A5UA 2UUCQ 2I5MX 2UUBL 2I5LX 1VQ8A 4L5QA 3G6EA 2RF4A 4A4IA 4FDBA 3STBD 2QGQA 3K7UC 4A3CH 2BA1A 1Q7YC 1VQJA 5LMNQ 4YCWA 2UXCL 4JI4L 4JG2A 1PH4A 4KLKA 1XJVA 2JEBI 4OONA 4X64L 4DKAC 4R4CA 3CCJA 2YTVA 3S16H 1W2BA 2KCTA 1JJGA 4JI1Q 4LFAQ 2N3SA 3VDYA 1X56A 4OO1G 2XGTA 1EQRA 3PCOB 3G4SA 2HHHL 2BH2A 3PSIA 4BY7H 4GKKL 1JE5A 4LWCA 2YTYA 2HIXA 1YZ6A 3J81c 1JJCB 3J81j 3HOZG 1J5EQ 5C0XJ 4JI3Q 3S14H 3PUYA 4DUYQ 1UEBA 2YU9H 1A0IA 4JYAL 1TXYA 4UPAA 4YCUA 5ELOA 3JC66 2JEAI 3OW2A 2NN6G 1K73C 4JI6L 3NEMA 5GAHC 3GTOH 4DV7Q 4A3IH 3UDFA 2IHEA 1C7YA 4HIDA 1AH9A 4JI0L 4YY3L 4P72A 2B63G 4DV3Q 3EIVA 4UY8C 1IBLQ 4JI8L 2UXBQ 3UE0A 1NTGA 4DV4Q 2IY5B 1E7LA 1VQPA 1XPRA 4A3LG 2EIFA 2R7DA 2JA8G 2EXDA 4NXNL 4XTCS 4QJFA 5M5YH 5JJLA 4LF5Q 1VS0A 3KJPA 5C3EH 4UP8A 4IOCA 1NBWA 2R7FA 4X62L 5C0XI 4QQBX 3RLFA 4HIKA 1HR0L 4BXXG 4X65L 2DUDA 1YIJA 1GD7A 3PO3G 2AWOA 2JE6I 3K7AH 1EYGA 2WAQG 4LUZA 4DUZL 1YHBA 3TRZA 4A3BG 3KFUA 1K8GA 4LF7Q 1J6QA 2B3GA 1SROA 4JBWA 4YCVA 2NVTH 4LUOA 2OWOA 4LFBQ 4R4OA 1HNZL 4O2DA 1X9NA 1IBKQ 4IJHA 1EIYB 2NZOA 1PV4A 4WJ3M 4NXMQ 3RNUA 1X65A 3LGJA 4C3JH 3E9HA 1N36Q 1KD1C 5C4JH 1PH8A 3STBC 3GD7A 2PQAA 3JAMi 4JBJA 4HIMA 4DR5L 4A3KG 4GKJL 4YWLA 2N8NA 3ZJYC 4JI7L 1Q81C 3PUXA 2QNFA 3GDEA 1YVCA 1HNXL 1N8RC 2JA7H 1S3OA 1XMQL 1I50H 3FP9A 3M4OH 4DR1Q 3HOUH 3S1RH 2UUCL 2RHQB 5LMUQ 1VQDA 4DR3L 2JA6G 3M3YH 2JA5H 2PNHA 4DR4Q 4BY1H 3RZDH 3CCRA 1TWHH 2H5XA 4OWTB 2UXDL 3HOVG 1JMCA 1LM0A 5FLMH 4A3JH 1T9HA 4AYBE 1G51A 5IYCG 3TQYA 4B3RL 4BBRG 1O7IA 2HT1A 1QUQA 2K5HA 4LW1A 4R1JA 4JI1L 1VQIA 3KLWA 1CSPA 3EN2A 1L0WA 3I2ZA 3RR5A 1E1TA 1OXXK 1KAWA 3KJOA 4DR2Q 1L1OC 2B29A 1WOCA 4YWKA 4EQ5A 2VQEL 2PMZE 1M1KC 1N34Q 5JJIA 1UE6A 2ALYB 3HOXG 3CCSA 4KHPL 4P71A 1SR3A 3H0GH 3Q8DA 2ZJPA 3ICEA 4HIOA 1YJNA 1K3RA 2R93H 1Q46A 4WJ4A 1UWVA 3T1HQ 1N33Q 1KHIA 4NB3A 1QUQB 4JI2Q 4DV5L 1KC8C 1JJ2A 1A63A 1I5FA 1HJPA 3TREA 1E3PA 3L7ZC 2R7ZG 1IXRA 2A1AA 4YWMA 5C4XG 5FJ8H 3RZOH 4A3MG 3B6YA 1S40A 1CKMA 3I55A 4LF8L 2NVXH 3GTPH 1YHAA 4OX9Q 4DV3L 3I4MH 4A3DH 3OTOQ 1L2FA 3KDFB 3F2DA 1RIPA 2KBNA 5IYDG 1XPUA 4GN5A 2FXQA 5C44H 2I0QA 3A5ZB 4Y7NH 2AWNA 2DGYA 3CP0A 1VQNA 2RCNA 3NBHB 3U4ZA 3UDIA 1Y14B 5E7NA 4LF5L 2LXJA 1EN7A 1NY4A 3UE1A 4A3FG 1CKNB 1IBML 2F4VQ 4GLVB 1L1OB 2E5LQ 4DV1L 3AFPA 3PO2G 4LFCQ 1HNWQ 1FL0A 4JC0A 3I4OA 4MZ9A 1S72A 4KHZA 4XIGS 4HJ7A 3CMEA 1VQKA 2ES2A 2LSSA 2VQFL 3F1ZA 3J80c 4B3TL 1XPOA 3RLNA 1B8AA 3HOZH 4K0KL 3T1YL 4IJLA 2CKZB 2JJQA 4R4QA 5IT9c 1XMOQ 4DV0Q 1IBKL 1XNQQ 5M5XH 4DV2Q 4NXML 4LF6L 5IP7H 1PH6A 3GTKH 4OWXB 5C0XG 1V43A 3TEHB 3H3VI 4YHHQ 5JJKA 2V1CC 2YYZA 2UUAL 3AEVA 2D0OA 4JV5Q 2PI2A 4JBKA 1LTLA 1KL9A 3F2CA 1R9TH 4B3SQ 4JI5Q 1VQ5A 1NMFA 3TS0A 2E2JH 3RLOA 4X66Q 4C3IH 5JEAJ 1EQQA 1KRTA 2CFMA 2ZTEA 4IPHA 4P74A 5JEAG 5GAEC 5LMUL 2B63H 3S17H 2GN5A 2EQSA 1SMXA 5K36G 1EWIA 3CW2C 5M3FG 1HZBA 4AYBG 3I7FA 1JT8A 5GROA 1VCIA 4A3LH 4L5TA 3E0EA 2JA8H 1YI2A 2R92H 3MEFA 3CCUA 1XNRQ 2Y0SG 3M85A 1P16A 4TQUS 3NELA 4IFDJ 1G6PA 3TS2A 3CC4A 4IFDG 4KI0A 1A62A 1RL2A 3AQQA 2VUMH 4A93H 1VQ9A 3K8AA 4DV6L 4BXXH 1LYLA 4UP7A 1UE5A 3E9IA 1GO3E 5FLXc 4B3ML 2Q2TA 3A74A 1KXLA 1I94L 5BR8L 1XTDA 4A3IG 4RG1A 4LF4L 1FJGQ 1GVPA 2GVBA 3IRBA 1C9OA 2I5HA 4GN4B 2ZM6Q 1H95A 2HJQA 1OTCA 1YJWA 3PIPA 1VQLA 1EFWA 1K83H 1VQGA 4DK3C 3FKIH 4AQYQ 4A76A 1BKBA 5AJ3Q 4BA2I 1VQFA 1YBYA 1MJCA 1WCMG 3DLLA 3RN2A 1YEZA 3J7ZC 2UUBQ 5M3MH 4A3KH 3J7A5 2ZTCA 4MTNA 1QVFA 5EAYA 3HFZB 4C3HH 1K0RA 2A19A 4A3EG 3PIOA 4NPSA 4QIWE 1YJ9A 1QVGA 1EUJA 1SLJA 1X3FA 2K4KA 5C3EG 1NJIC 2WB1E 3S2HH 2JA9A 4JI4Q 1VQEA 4TVAB 1VQ4A 3S1MH 2UXCQ 3ER0A 4P75A 3M4PA 3PV0A 1Q8KA 4P73A 4X64Q 2KHIA 4LF9L 4DR7L 2UU9L 2YV5A 3CCLA 4RMFA 4IFDI 5IWAL 3NENA 2WP8J 3K81C 3F8TA 2F52A 2HQLA 3CCVA 1CSQA 4GOPB 3K80C 3CCMA 1SFOH 1KIXA 2IX1A 3GTGH 4GKKQ 4PZ8A 3S1NH 3MXNB 3I4NH 2E5LL 4DK6C 5IYCH 5LMNL 3HOWG 4BBSH 4BBRH 4LFCL 2NVYH 1HR0W 1JB7A 1Z47A 2K5NA 2Q2IA 4JYAQ 3H15A 2QA4A 3RN5A 1PFSA 1MIUA 1E1OA 2A8VA 5DLQE 2AHOB 3UDXA 4APVA 4LFAL 4JOIC 1Z9FA 4JI6Q 1B70B 1PYSB 1NE3A 4R4TA 1OXTA 4L5RC 1X54A 1Q1EA 1IZ6A 2Z6KC 4GNXC 1V1QA 3BU2A 1OXSC 4PG3A 1XNQL 3KDFA 1Y1VG 1J5EL 3GTLH 4JI3L 1SRUA 3HKSA 1YITA 4YY3Q 4DUYL 1BBUA 4JI0Q 4DNIA 4HJ8A 1Q12A 4JI8Q 2JA5G 4JBMA 2GVAA 1BVSA 1CKOA 1Q82C 3FHWA 1D7QA 1EIFA 5FLMG 4A3JG 1CKNA 4A3GH 4NXNQ 4ME3A 2R7ZH 1L1OA 1C0AA 2AKWB 2Z6KA 2IHFA 4DV7L 3J81i 1E7ZA 3U50C 1QVCA 3OYYA 2KENA 1GM5A 1W3SA 5IP9G 4X62Q 3W5OA 3JAMc 2VNUD 5IYDH 1HR0Q 2VL6A 1IBLL 4X65Q 1Y1WG 2UXBL 5GADC 2KCMA 1VQOA 3G48A 3KYHC 4DV4L 2Q2HA 4DUZQ 5IYBG 3K0XA 2KHJA 5IY0A 3U58A 3S2DH 1TWGH 4QY7A 1NMGA 3PO2H 2ZTDA 1HNZQ 3CC7A 4GLXA 3S1QH 1AE3A 4GNXB 2E2HH 4DR5Q 1HZAA 3WWVA 4GKJQ 2ATWA 4UP9A 4JI7Q 2K52A 2LXKA 1I3QH 5FJ8G 1N32Q 2N78A 4PZ7A 1YHQA 1HNXQ 4QL5A 3G71A 1Q86C 3PUVA 1K8AC 1XMQQ 4LF7L 3I4MG 4A3DG 3ULLA 4LFBL 1PVOA 3PUZA 4AIMA 4DPGA 1D8LA 4PMWA 3HOYG 4O0AA 4IOAA 5C44G 1N36L 4DR3Q 1HZ9A 2L15A 1MKHA 4A75A 4DR6Q 2WB1G 2MQHA 2Q2UA 5H1SE 1VQ6A 1OXUA 1X3GA 2UXDQ 4A3CG 2D0PA 1K9MC 3PF4A 1DGSA 3GTMH 4B3RQ 4ALPA 1U0LA 4LNQA 1WJJA 2K14A 4DR1L 2IX0A 1PH5A 3M7NA 3CCEA 3PF5A 3S15H 4H02A 3M4QA 1VQBA 1TWFH 3HKZE 2ZJQA 2N49A 5M3FH 4DR4L 1PH7A 4OXPA 3S24A 5HY6A 2VQEQ 4BY7G 3CXCA 1V9PA 1A8VA 2WFWA 1ASYA 3BJUA 1X55A 4KHPQ 1FGUA 2MNAA 5IP7G 1EOVA 2NZHA 4IO9A 3CD6A 1IL2A 3M9BA 2JQOA 4GOPC 2OTJA 1PH9A
chains in the Genus database with same CATH superfamily
1LTGD 4K8IA 1BF4A 2F4IA 3T4AC 1K8MA 1PYBA 4RKLA 1MJEA 1Q1BA 1O7YA 3GTOB 4A3BH 1M4VA 3QWNA 1PLFA 2BDNA 1B7YB 2CQOA 1X3EA 3NSWA 2E2IH 2VW9A 1WCMH 2NVQH 1KHCA 4KJNA 4OWWB 1QG7A 4OO1I 2M2LA 2K50A 3L2PA 3HP3A 2MO0A 5M5YB 2CW0C 1BCPB 1W6JA 4A93G 4HCSA 3OTOL 2F3IA 3F2BA 2Z0SA 1HZCA 3T16A 3HEJA 2VQFQ 1OO9B 1E22A 3GTQH 3RUZA 2NN6I 1ZS9A 1LTTD 2C35B 3FKIG 3HOWH 2DJFC 4LF6Q 1KNAA 1HNWL 4NKLA 4C3JB 3DMUA 2SDFA 2RKSA 5C4JB 2ZJRA 1HH2P 5CGKA 1VQ7A 5KGUA 4LMQD 4ZLTF 5HGQA 2F0NA 4ULLA 2JA7G 2JA7B 3AU7A 4DAYB 4DV0L 3M4OB 3K5OA 1VQCA 2QILA 4DV2L 2DK4A 1W6KA 4BA1I 4DR6L 3M3YB 1HPCA 4GS3A 5JOBA 1TU2B 1TWHB 3I56A 4GN3B 1KQSA 1H9EA 2TMPA 1SJED 3U4VA 2NBFA 1PTOD 4GNXA 4X66L 5IIFA 3DHQA 1ZYRD 2O2LD 2VS1A 3H3VH 2KW9A 3PUWA 4ZAIA 4DV6Q 2LC3A 1Y1WH 4B3MQ 4ZQ3A 4M1UB 2PCFB 1YNXA 2H4OA 3KF6A 1BXTA 1PH2A 1QNUA 1ICWA 3A7AB 3BVMA 4N8X1 4TSSA 1HXYD 3VR6A 4DAVA 4HCEA 2F03A 3CMAA 5J3BA 2R93G 1PRTC 2R93B 3GO5A 4WFN3 4H44C 2F0KA 3L9AX 2KHSA 5CC4A 3RZOB 4LF9Q 4DR7Q 3KF6B 3O13A 1QZHA 3HOYH 5IWAQ 4UZWA 2BOSA 4Y7NB 1C4QA 2MUYA 4NMZA 2BA1A 5HGTA 2UXCL 4KN7C 4JI4L 4KLKA 2JEBI 4X64L 5I6YA 2YTVA 5DM73 4HMIA 5J22A 5C5MA 4O1NA 5CMDA 3G4SA 2EY2A 3PSIA 4BY7H 5E3FA 4S3SA 1SYBA 4FVMA 3QR8A 3J81j 3HOZG 3ITPA 3HOZB 5IODA 1NCVA 2Z1CA 1FD7D 4JI3Q 3PUYA 3EJIA 3MFYA 1KNEA 4IFDH 1DONA 4UPAA 1GHKA 2B2VA 3MHBA 2KUMA 2A6HC 1U4MA 3I70A 3NEMA 5GAHC 3GTOH 2AQ3B 2IHEA 4C3IB 3BDLA 1H9KA 1KLUD 4JI0L 4DV3Q 2UXBQ 1NTGA 4DV4Q 1B3QA 1VQPA 1H1JS 4A3LG 1DCZA 3KF8A 4KKUA 2JA8G 2JA8B 1F9RA 3G7LA 4XTCS 3OWFA 2B2WC 5M5YH 3KJPA 2IW3A 4RA8A 2D2CC 3DEOA 1RCVD 1STNA 2R7FA 4X62L 1V1PA 2VUMB 4WJWA 2K6AA 3RLFA 3SE0A 3ND8A 4X65L 1YIJA 4G57A 3VA5A 5FK9C 1JC7A 1J9OA 1SNDA 2F0UA 1S5FD 5CV5A 4LF7Q 3MWYW 4XQNA 1K83B 1PTOB 1H9FA 4XXEA 1DOMA 1IBKQ 1HNZL 1I4QA 1YNNC 4KKSA 2Z6BA 3LGJA 4C3JH 2OT2A 1BDOA 5C4JH 3STBC 3GD7A 2PQAA 1GJXA 3H09A 2RNNA 4JI7L 4RGTA 3S2HB 1QCBD 3GDEA 5CR3A 2JA7H 1EIHA 1J8IA 3RMHA 3FP9A 3M4OH 4DR1Q 3MA2B 4ID6A 5LMUQ 3G6JB 3U9OA 5I2XA 2JA6G 3M3YH 2JA5H 5JAVA 1TWHH 2FINB 2H5XA 3HOVG 3HOVB 1EQTA 3F2UA 5IYCG 3TQYA 4B3RL 4BBRG 4BBRB 2KCNA 3HS0C 1SNCA 5EBDA 4ODGA 4DR2Q 4OGQC 1WOCA 2L1BA 3T56B 5FO8B 1JWUD 1UE6A 3HOXG 3GTLB 1Z6HA 4FXGC 3V05A 2ZJPA 1YJNA 2R93H 1HFGA 3T1HQ 1N33Q 4UDUC 4DAPA 4JI2Q 4KTAA 5CBEE 3P20A 1KC8C 1I5FA 1JJ2A 2Z4HA 1Q3LA 5C4XG 3RZOH 1GUOA 3QB3A 2XRQD 3FVQA 4FNFA 4DV3L 3SXHA 3KDFB 1RIPA 5IYDG 4DXGA 4O42A 4GN5A 2FXQA 3A5ZB 4Y7NH 2AWNA 2PNRC 1Y14B 2F0SA 3C3LA 4DF7A 1TWGB 3FPUB 4GLVB 1L1OB 1WVLA 4B08A 2E5LQ 3BZDB 1MI2A 3VYRA 3S1QB 4X3KA 1S72A 3P75A 4XIGS 4HJ7A 1UUPA 2LSSA 1WTVA 2L55A 1JWMD 1B8AA 2F0PA 2JP1A 5DM63 2QDLA 4DXFA 1ML0D 1H9SA 2JJQA 2K5DA 4R4QA 3TZUA 1IBKL 4WJ3M 3H3VI 4YHHQ 1ZBHA 2B2YC 1KDAA 4JV5Q 2PI2A 3F2CA 3A56A 3CRLC 5IT9L 2A6ED 3TS0A 4C3IH 4MHEA 2E74C 1GUTA 1EQQA 5JEAG 5LMUL 2EXZA 3S15B 2GN5A 2MP1A 5K36G 1LTBD 3I4LA 4N9TA 2QW7A 4A3LH 2M9VA 4KJOA 3E0EA 2JA8H 4RGOS 1PXUA 3MEFA 3CCUA 1RTOA 3M85A 2ODGC 3NELA 4IFDJ 3K5MA 1PFMA 2VUMH 1VQ9A 3I90A 4KD3A 3NWSA 1EYDA 1I94L 4LAAA 4IUVA 1XTDA 4A3IG 1FJGQ 4X3TA 2ZM6Q 1YNJC 2HJQA 5NUCA 1VQLA 1G6ZA 1K83H 1PTOH 1XWEA 1TWCB 4AQYQ 5JPMC 5AJ3Q 2O4XA 5FLXL 3IFTA 1YEZA 3J7ZC 2F3WA 3ZYYX 2L4NA 4NPSA 1YJ9A 4Y52H 1X3FA 2F0FA 2BE5D 4G4KA 3GV6A 4IQZA 5C3EG 3S2HH 2XVSA 5E4XA 1B9NA 2MPHA 1G8ZD 5I4DA 1ET9A 4RMFA 4IFDI 1WTPA 3K7AB 3DM1A 3P1HA 1VMCA 3CCVA 3KLRA 2NZ1D 4GOPB 3K80C 4N8FA 4K5XA 3I4NH 2E5LL 1LT6D 4RHRA 5IYCH 5LMNL 4KN4C 3OIQA 4BBRH 2RA4A 1Y02A 1JB7A 2N88A 5BN4A 2K5NA 3TP5A 1E1OA 1TY2A 4U673 2J7ZA 1NE3A 3CQZB 1IZ6A 1GXDC 2Z6KC 4GNXC 1V1QA 3BU2A 3MXGA 5EPKA 1F9QA 2RSOA 1J5EL 5E4WC 4ZYSA 3GTLH 1F9SA 1SRUA 1CA6A 1ILPA 4HJ8A 1Q12A 4JBMA 1KTKA 1V66A 5KRUA 1CKNA 4BWGB 4NXNQ 4ME3A 2A6HD 5IGDA 2IHFA 4CDFC 4A3MB 3W5OA 3JAMc 5IYDH 3M7GA 5K5PA 5GADC 3G48A 2L5TA 2RQXA 4KHVA 1KDCA 2OXPA 1TWGH 3UI2A 1CK1A 2B2UA 4A3FB 3K5NA 2L0CA 3S1QH 3M4YA 4GKJQ 4LJZC 2VB2X 2K52A 2LXKA 1N32Q 2QF7A 1YHQA 4QL5A 2IX3A 3G71A 1Q86C 2F0IA 4A3DG 4A3DB 3ULLA 4LFBL 4X3UA 3MVVA 4RGNA 5C44G 5C44B 4HSPA 1N36L 1YNND 1HZ9A 4J6HA 2WB1G 1WTRA 2UXDQ 1K9MC 1A2TA 3PF4A 1DGSA 4BS9A 1GKUB 4ALPA 4C56C 1JE4A 3S16B 1WJJA 1LO5D 3AB9A 3S15H 1I4GA 5C3XA 1D5XC 4RCNA 4ABNA 2N49A 4QCLA 4DR4L 1PH7A 4H13C 1TR5A 3S24A 5HY6A 5IT9E 2IJ0A 4AYBB 1V9PA 1Y8PB 4PMCA 4EQNA 1FGUA 3S14B 5IP7G 1BBXC 3K58A 2NZHA 3EA6A 5CORA 1PH9A 2B2TC 1O80A 2IWHA 3KOJA 1WFQA 4LF8Q 3H91A 2F0OA 1TWCH 2HD3A 4OEMB 3VA7A 1PRTF 3OMCA 3A54A 2MO1A 3H6MA 1VMPA 2CCZA 2WKDA 2YTXA 1JWSD 5IE8A 4DV1Q 1TS2A 5LL6S 3CF5A 1LUZA 1KDBA 3DM3A 4OX9L 3VR4A 1B1ZA 4KY5A 1PZJD 3MZ5A 5KNDA 1SN8A 1AE2A 3TSSA 2CWAA 4CHTB 4EX5A 1PFBA 4HJ5A 4GLAC 1ZXTA 1G291 2RDHA 1WYDA 2HIVA 1IL8A 1PHJA 1BNZA 4XYQA 5M3MG 1ENCA 3AMUA 2UUAQ 3CPWA 1PH1A 1SYFA 1N32L 3U9SA 1MBYA 3CQZH 1VDZA 3NPPA 2EE1A 2VZAA 1UAPA 1XMOL 3BZKA 1JICA 3OIPA 4OIJA 3J7AV 4IPCA 3S1RB 1HUMA 2QEXA 1GKHA 5I6WA 1SFOB 4AH6A 1CHPD 4BY1G 4BY1B 2F0HA 2DY8A 2K28A 3VR3A 5BN5A 3J80i 1SNPA 4A3JB 3SK6A 4BBSG 4DNRB 4HSVA 4U68A 3HKZG 4A3MH 4HTHA 1ILQA 2PI2E 3OWEB 2JK8A 2B8GA 3MEHA 3X3MA 5BR8Q 1SYGA 3QG1A 3SDZA 3L0OA 3N52A 1XNRL 2KEDA 4A3FH 2CWPA 2EJGC 5IGEA 1ESRA 1SNOA 4A3GG 1ICFB 2LS01 4G7OC 1E2WA 4PV1C 1SE8A 1CI3M 1CUKA 2EYOA 3I72A 4WORA 2G9HD 1TY0A 1IYVA 4L8JA 1WTOA 1EOTA 1FVIA 3CPFA 3I4MB 2R6GA 4MNOA 2D5DA 1JORA 3A5UA 2UUBL 2I5LX 3OMGA 4L5QA 4A4IA 4HN7A 2EYFA 1Q7YC 2EYMA 1PH4A 5IGGA 3HGBA 4OONA 4IUNA 4DKAC 3S16H 3I73A 3SR1A 1W2BA 1LTRD 4LFAQ 4DK1A 4I65A 2K01A 2PZTA 5DNFA 4LWCA 2YTYA 1RODA 3J81c 5ELDA 2ICIA 1B9MA 3S14H 2P5ZX 5IOCA 3Q0AA 3T13A 1LT4D 4KV6A 1KABA 3JC66 5COYA 1K8OA 5CYUA 1QJOA 4K5VA 2EYJA 1K73C 4FYDA 2F0JA 4DV7Q 2E2JB 5C3WA 1C7YA 2B63G 2B63B 4P72A 1X3QA 2K5WA 5DAUA 4XQQA 1IBLQ 4JI8L 2WV6D 1RDPD 2EIFA 1PZID 1FNUA 2EXDA 5EKIA 1EU3A 1VS0A 3BS1A 5JVH3 2AQ2B 3C1FA 3TN2A 4UP8A 4IOCA 1NBWA 2KEEA 4A93B 4QQBX 4HIKA 1HR0L 2DUDA 1GD7A 3PO3G 2WAQG 1SE3A 1YHBA 3KFUA 4DAYA 4JBWA 1EY7A 3FKIB 1X9NA 1PV4A 1X65A 1B44D 3W2DA 2ES2A 3SHLA 4JBJA 4PNYA 5EJWA 1XMQL 2RVLA 3S1RH 5G3LF 4G7ZC 2OEOA 1VQDA 3J7YW 4BY1H 3RZDH 4H0LC 2DNCA 4A3JH 1T9HA 4AYBE 1G51A 2R61A 4HEDA 1I4PA 2F0VA 1CQFA 4R1JA 4V190 3EN2A 2NWGA 3RR5A 1E1TA 1STYA 3KJOA 4DNTB 1D1KA 1N34Q 3NXWA 2ALYB 2CH4W 1CTMA 4NDXA 3CCSA 1JR0D 4P2CB 4KHPL 4WRDA 1WTHA 1SR3A 1Q46A 1KHIA 5I9OA 1QNKA 4J1MA 3HRZC 1A63A 1E3PA 2ODCI 4CBVA 2A1AA 5FJ8H 2B2UC 4UAIA 1CKMA 3S9WA 1YHAA 3I4MH 1L2FA 3PMFA 2SNSA 4OHJA 5KIXA 2WQGA 4V0BA 2I0QA 3CP0A 3NBHB 2A68C 3U4ZA 3FDTA 1HRJA 2I07B 3E0JA 3UE1A 2F4VQ 4PMBA 3S2DB 3AFPA 1SXTA 2E2HB 1K0SA 4KHZA 2K7VA 1SBBB 2ZXPA 2VQFL 1EY4A 1XPOA 1BQQT 3R8BA 3RLNA 4IJLA 4LF6L 1PH6A 3ERQA 5C0XG 3BYYB 3J80L 3KBXA 1A2UA 5FO7B 2D0OA 4JBKA 1KL9A 4B3SQ 1SE2A 4JI5Q 2E2JH 3RLOA 3WOEA 2DN8A 4OELB 1KRTA 2JYOA 5GAEC 2B63H 1GOZA 3A8JE 1FGBD 1SNQA 1U9RA 1EWIA 3VR2A 5M3FG 5M3FB 1HFNA 4L5TA 3MC0B 4QF4A 2Y0SG 2Y0SB 2AUJD 4TQUS 2SNMA 1HQMC 3CC4A 2F0EA 4FO2A 2D9UA 4A93H 3K8AA 4DV6L 1IHZA 1LYLA 4UP7A 3E9IA 1GO3E 4B3ML 1O7ZA 1ZEQX 2GVBA 1LABA 3IRBA 3MXPA 1OTCA 2KECA 3PIPA 1EFWA 2LFNA 2NTTA 3FKIH 5T1IA 2K5QA 1LTAD 4BA2I 1MJCA 2A69C 4ME5A 5EPJA 3T51B 3NK9A 1K0RA 3PIOA 1QE6A 4GZYC 1NJIC 3KLSX 4FF2A 1LACA 1VQ4A 4LF9L 3M4PA 3PV0A 4DR7L 4P73A 3GTJB 1X3PA 4TKOB 5IWAL 3NENA 3K81C 1Y69U 3NQIA 5CV6A 1JOOA 1LTID 1JJRA 2IX1A 2JA6B 2J0TD 2PW5A 4GKKQ 3NBIA 3EROA 4DK6C 3H3VC 1SNMA 1R4PB 4JYAQ 2QA4A 1PFSA 4JW0A 2PPBC 1Z9FA 4JI6Q 2K03A 4L5RC 2Z4IA 4R4TA 2ICEC 3CRKC 3KDFA 5CV9A 4JI3L 1D1IA 2H1EA 3HKSA 3HOXB 4G7HC 4YY3Q 4FP5D 5M5WB 1D6EC 1EZ8A 2GVAA 4IUUA 2F3VA 1NR4A 1D7QA 5FLMG 2A74C 2VXWA 1L1OA 2ZT9C 5C4XB 1SMYC 2VNUD 2QDBA 5D14A 4KKTA 2UXBL 3T53B 1VQOA 4DV4L 2Q2HA 4XT1B 4DUZQ 1MSHA 5IYBG 1BUVT 2KVDA 1SYCA 4DN4M 2KHJA 5CBAE 5IY0A 2CHBD 3S2DH 1NMGA 2ZTDA 1AW7A 4GLXA 2CW0D 1PZKD 1AE3A 1S5DD 2TSSA 4EQPA 2E2HH 1EL0A 3TMEA 4DR5Q 4K0KL 2ATWA 4KY7A 1HNXQ 4J8QA 4LF7L 1K8AC 3PUVA 1I6HB 3PUZA 4O0AA 1PYWD 5C0XH 4DR3Q 2E2DC 2F0MA 3WDNA 1CA5A 2EOTA 3DEPA 4ZCKA 2ZXOA 2XWBB 1SYDA 3DXJC 1NAPA 2K14A 4DR1L 3M7NA 3J80E 3CCEA 5M3FH 4OXPA 3QIAA 2VQEQ 1BCPC 2KA7A 5C4HA 1MHWC 1CT1D 2L9HA 3CD6A 2NTSA 1D5MC 5HURA 2YU9B 1TVXA 5KNBA 5A2QL 4ZKCB 3K6OA 4DV5Q 2DNEA 1FNVA 2OTLA 4DR2L 2RNOA 5ISRA 3K59A 4A3IB 1TT2A 3D31A 2IT1A 1BBWA 1B4OA 4Z9CB 1CQVA 4UHVA 4ZUJA 3CCQA 4GOPA 2JVWA 3T1HL 1N33L 2K04A 2RBMA 4JI2L 1TQOA 2OF1A 1PRTD 1GUNA 1KRSA 4QMGA 2R92G 2R92B 1A3UA 4KK7A 3LWUA 1IBMQ 5C3EB 3MFGA 3GTJH 1X6OA 1JQYD 1UE1A 2B39A 2D62A 4HAEA 2L11A 3VYSA 3DUZA 1U4PA 2JA6H 1QB5D 4XDXA 4B3TQ 2HHHQ 2KVMA 3BZCA 2RHSB 3D6CA 3T1YQ 3HOVH 1DOKA 4EGVA 3CC2A 2K5VA 2EJMA 4L5SA 4X6AH 3LWEA 1RKNA 3QJYA 4C3HG 4PZ6A 2EPBA 2DJGC 3E5SA 1ASZA 5AFWA 2F0TA 2QNCA 3A0JA 2OQKA 3ERSX 4IPDA 3HOXH 4B9WA 1EY9A 1RF2D 5M5WH 1M90C 1CZGA 5EBCA 4YHHL 4QGUA 1WTWA 1GHJA 4I7ZC 1IKLA 4JV5L 3BG3A 4JOIA 3AFQA 1VQHA 4IPGA 4CJ2C 1D5ZC 3PGZA 5C4XH 1RTNA 2Y0SE 5FOBB 2GA4B 3C2PA 1E24A 1K28A 3K5LA 4LF4Q 4HJ9A 1ONLA 1N9WA 3CAMA 5IYBH 3BVGA 5CV8A 5CV7A 1MGSA 3W1GA 2HCCA 2VY3A 2XTIA 3ULJA 4HJAA 1Z7TA 1GUGA 2XSCA 2K33A 1QWYA 4ZRZA 2EJFC 1E7DA 4FF3A 1FJGL 1F9PA 2EVBA 2ZM6L 1I6HH 1XTCD 5IGBA 3TP6A 5GQOA 2NVXB 2UU9Q 4AQYL 5AJ3L 5J1ZA 2OQ0A 2UUCQ 1OXVA 1VQ8A 2RF4A 2WB1B 3STBD 1FNWA 2ZXRA 4YCWA 4JG2A 3R93A 1H9JA 2EY6A 3DWQA 3NP8A 4R4CA 3CCJA 2KCTA 1JJGA 5JEAH 1EY0A 2N3SA 1I3QB 1STHA 2B2VC 2HHHL 3PCOB 5K36H 1IYUA 2FHTA 1PRTB 3VYUA 1ESFA 1JE5A 2B8FA 4ILWA 2HIXA 1YZ6A 2E76C 4CKBA 4FF1A 5ELCA 5C0XJ 5M5XB 3Q22A 4DUYQ 4F8MA 3GTKB 1G2TA 1JEIA 1SSOA 2YU9H 1A0IA 1ENAA 1Q90A 4YCUA 1QOHA 4MN3A 5ELOA 1SYEA 2JEAI 4XYOA 5EGTA 4BITA 1PTOC 3E3XA 2EY5A 1R9TB 4A3IH 1F2ZA 2QEJC 4IURA 1B53A 5A2QE 3EIVA 4UY8C 4CKCA 1H9MA 3SEBA 3UE0A 4RFBA 1IW7C 3I3CA 2IY5B 1HUNA 4FXDA 1XPRA 2R7DA 3D3RA 4HMJA 4NXNL 4QJFA 1F2LA 4F7XA 5C3EH 3Q23A 3IL8A 1STBA 1JB3A 2ENBA 5FLXE 5C0XI 4BXXG 1DXMA 3GV3A 3K7AH 2IL8A 5LHY1 4DGZA 2Z9HA 4A3BG 4A3BB 5E1FA 3A8IE 1K8GA 1J6QA 5IGFA 4YCVA 3C46A 4LUOA 2OWOA 2W51A 1EIYB 4O2DA 4IJHA 4NXMQ 1S4ZA 1R4QB 3E9HA 1KD1C 1PH8A 3JAMi 5M3MB 4A3KG 4A3KB 2NYZD 2N8NA 5FO9B 4GKJL 5JJZA 3PUXA 2QNFA 1YVCA 1N8RC 4H7BA 5EKKA 2DY7A 2UUCL 1LLRD 3D4RA 2PNHA 5G3LD 2UXDL 1JMCA 4BBSB 2NVYB 1O7IA 2X6LA 2MHVA 4N9PA 4LW1A 3QKJA 3HKZB 3KLWA 1CSPA 4KD4A 3VYTA 1L0WA 2OTJA 2QKIC 1L1OC 2B29A 4EQ5A 5JJIA 1B2TA 1MSGA 2C9OA 4P71A 3GP7A 3ICEA 5L37A 1K3RA 1HTLD 3E6ZX 4M8AA 4DU9A 4NB3A 4E6IA 3LLRA 5EKLA 4A3GB 2R7ZG 2R7ZB 4YWMA 1XYIA 1S40A 5EPLA 2XWJB 2NVXH 4LF8L 4A3DH 3OTOQ 1YNJD 3F2DA 2KBNA 2Q8TA 1XPUA 5I9PA 5C44H 1C8CA 2AUKA 5JVG3 5DEHA 2Q8IB 2RCNA 1CZWA 1AZPA 2N55A 3L3OC 4IUPA 1LV9A 4R8IA 5E7NA 4TRDA 1I6VC 1EN7A 4I7AA 4DV1L 5D3IB 4LFCQ 1C48A 1DYQA 1FL0A 3I4OA 4JC0A 1HNWQ 1AFPA 3R2TA 2SEBD 2X6GA 2WINB 3RD4A 3CMEA 1VQKA 4ZKBB 2VB3X 2CKZB 5IT9c 4DV0Q 2BDOA 5M5XH 1EQVA 4DV2Q 4NXML 2JXMB 5IP7H 3GTKH 2FJ2A 1V43A 2EYPA 5JJKA 2YYZA 2UUAL 1VF7A 3AEVA 3NQTA 1LTLA 1R9TH 1ZKOA 2KOLA 1NMFA 4X66Q 2AQ1B 3BDOA 5JEAJ 1WD0A 2CFMA 2FMMA 4P74A 3URYA 2PZWA 1Q8IA 2EQSA 2C5CA 4KY6A 1TWFB 1WD1A 2O5JC 3CW2C 5CIUA 3I7FA 1JT8A 1VCIA 1ET6A 2PO4A 1I4RA 3ONAB 3WOFA 3OOCA 4IFDG 3D8GA 4KI0A 1PDQA 1DD2A 3IAYA 4BXXH 2MJ8A 4CJ0B 5TSSA 5FLXc 2Q2TA 3A74A 1KXLA 5BR8L 2RSNA 3PO3B 2I5HA 2WAQB 4OL7A 1A15A 3SK8A 4A76A 1BKBA 1VQFA 4C2MB 1EY8A 1AP0A 3RN2A 4CDEC 5M3MH 4A3KH 2ZTCA 3C1EA 4A3EG 4A3EB 4JVZA 1EEID 2RDFA 2FMCA 1EWHA 2K4KA 2KJXA 2WB1E 2UXCQ 2JA9A 4JI4Q 1VQEA 3LNNA 1Q8KA 4X64Q 2KHIA 2WP8J 1BR9A 1PFNA 3F8TA 2F52A 2HQLA 1SFOH 1CSQA 4PZ8A 1RD9D 3X3NA 3NHHA 5CV4A 4BBSH 4LFCL 2NVYH 4C3JG 4RH6A 1Z47A 5M9OA 3FLGA 1MIUA 4RWSC 3UDXA 5DLQE 4LFAL 2A6EC 1BCPF 3TP8A 4JOIC 1PYSB 1OXTA 1Q1EA 4PG3A 1FR3A 1EZ6A 5IGCA 5KYLA 1A3TA 1Y1VG 1Y1VB 1YITA 4JI0Q 1BBUA 2JA5G 2JA5B 3NBHA 3TZDA 3OSOA 4F87A 3GQBA 1LT5D 3FHWA 4ZUIA 3V96A 4DFAA 4A3GH 2R7ZH 3EQLC 2CVRA 4XQJA 1C0AA 2Z6KA 4DV7L 3J81i 1E7ZA 3OYYA 2KENA 2HCIA 1GM5A 1W3SA 5IP9G 4X62Q 2VL6A 1IBLL 4X65Q 3KYHC 1IW7D 3K0XA 3U58A 4QY7A 1HNZQ 3JAML 1EFID 3CC7A 1TWAB 2LMCB 4GNXB 2CH4A 2WACA 2LKVA 4K8JA 2BE5C 3EVQA 4UP9A 4JI7Q 2N78A 4PZ7A 3J7AF 4FF4A 2F1MA 1PVOA 4AIMA 1D8LA 4PMWA 1G91A 2L15A 1MKHA 4A75A 2MQHA 1VQ6A 2L12A 3LX0A 4A3CG 5KEEA 3Q6SA 1D2BA 1HCZA 4B3RQ 3A8KE 2MPMA 1TS4A 1U0LA 1BO0A 2KFVA 1PH5A 1AEXA 3PF5A 1TWFH 1XXGA 3HKZE 2M00A 1TKWB 4L63B 3MXUA 2G5DA 1ASYA 1X55A 2MNAA 1EOVA 1VF5C 4K6LA 2G9DA 1JOKA 1IL2A 4RKBA 1BOSA 2JQOA 1ENFA 1STEA 2PMZB 4JK1C 3PO3H 2NB0A 1II3A 3AYHB 4POFA 4C3IG 1N34L 4KMUC 4C1NK 1STAA 1NNXA 3EBEA 1M8AA 4JCVE 4C2MH 2BH8A 3VR5A 3HG9A 2B2TA 2Q8RE 5ELEA 4MTKA 4A3EH 1IYJB 4F88A 3OW7A 1PMRA 1UEAB 2MFIA 5GAGC 1A3VA 4CJ1B 2VUMG 3NTIA 1Y8NB 2ASBA 1O7LA 4QB4A 3FPPA 2F0QA 3D4WA 3CU7A 4K6DA 4Q5VA 3CKIB 1PH3A 3K0YA 4K0KQ 4DAMA 2NVTB 3KF8B 3P7JA 2F4VL 1FYCA 1LTSD 3BDCA 1DM0B 3UDGA 5LL6X 1E2VA 2HDMA 1T5XD 1V1PB 1NSNS 3H94A 1EY6A 1UE7A 5ELNA 1I50B 1Y1VH 4ZK9B 1EU4A 1U5KA 3HOUG 3HOUB 1P8LA 1PTOF 2PQAB 3QO2A 3I4NG 3I4NB 1S5ED 4JI5L 4B3SL 1CHQD 3W1BA 1EYAA 4K2KA 4NW2A 2OCEA 4LUVA 3D0FA 5IP9H 1NUCA 2ID0A 5C4ZA 4R4IA 1AN8A 1I94Q 1WI5A 2V4DA 5LMNW 3ULPA 2RCFA 3Q24A 2WKCA 2WAQE 4J15A 2EY1A 1TWAH 3SK4A 3H0GG 3H0GB 4POGA 2IPKD 2SOBA 1TS3A 1VQAA 4CKEA 5JPNC 2E8GA 3SGIA 3JAME 1QZGA 2K75A 1PA6A 4QUFA 3GTPB 1I4HA 2BA0A 1E0BA 2AMCB 1VQMA 2JSOA 2I5MX 4QIWB 3G6EA 4FDBA 4A3CH 2QGQA 2X69A 3K7UC 1GUWA 1VQJA 4R8NA 5LMNQ 2PZUA 2Z8LA 1XJVA 4JI1Q 1F2YA 1SDFA 3VDYA 1WTQA 1X56A 1SEBD 5D3DA 4OO1G 3BYTB 2XGTA 1EQRA 4C1NI 2BH2A 2NUCA 3N6RA 4GKKL 3PIP3 1JJCB 1IKMA 1J5EQ 1GUSA 1UEBA 4JYAL 1HQRD 1TXYA 3PIO3 3J81L 3OW2A 4IN3A 2E75C 2NN6G 4JI6L 3FRPB 3UDFA 5KNCA 4EQOA 5D65A 2FFKB 3A7LA 4HIDA 1AH9A 3S17B 1H9SB 4YY3L 3DWPA 3KK7A 3I8ZA 1E7LA 1EIGA 1WTXA 5JJLA 4LF5Q 1GJJA 4EVOA 2F0LA 1L0XB 2AWOA 2JE6I 3QOJA 2PYKA 1EYGA 3QOLA 4LUZA 4DUZL 3TRZA 2B3GA 1SROA 2NVTH 2A68D 4LFBQ 2EZVA 4R4OA 2XNAC 2NZOA 3OPOA 3RNUA 1N36Q 2KVEA 4DR5L 2K05A 4HIMA 4PQXA 2O5IC 4YWLA 3ZJYC 4C3HB 1Q81C 4JPBW 3W3AA 1HNXL 3CHBD 1S3OA 3TDQA 3S1MB 1I50H 1L0YB 3HOUH 1Y8OB 3HZXA 2RHQB 5EQ0A 1NR2A 4DR3L 4DR4Q 3CCRA 3V2TA 3GTGB 4OWTB 3K57A 4CDCC 1LM0A 3S1NB 5FLMH 4K5WA 2F0WA 1A6XA 1HA6A 2HT1A 1QUQA 2A73B 1I4XA 2K5HA 4JI1L 1VQIA 4DK0A 3I2ZA 1OXXK 1KAWA 3NE5B 1RHPA 4YWKA 2VQEL 2PMZE 1M1KC 1S5BD 4MIUA 3H0GH 3Q8DA 4HIOA 4WJ4A 1UWVA 1QUQB 4QUCA 4DV5L 1HJPA 3TREA 3L7ZC 1DOLA 4CDDC 1IXRA 2QCPX 4K2LA 3B6YA 4A3MG 1STGA 3I55A 3GTPH 4B9XA 4OX9Q 5T1GA 1EEFD 1O78A 3IFDA 3OHXC 3FMCA 1JCKB 2DGYA 2XRSD 1VQNA 2A69D 2I46A 3UDIA 4LF5L 2LXJA 1EY5A 1NY4A 4A3FG 1CKNB 4CGYB 1IBML 3PO2G 1X32A 3DWAA 3PO2B 4MZ9A 5I2YA 3IKJA 4FXKC 3SVMA 2RDGA 4OO1H 1B50A 3F1ZA 3J80c 2WIIB 4B3TL 5KYIA 4IALA 3T1YL 1K3BC 1XMOQ 1XNQQ 2HDLA 3SK5A 4OWXB 3TEHB 2KVUA 2XN9C 1HA5A 2V1CC 3R2IA 2HUGA 2NN6H 3EFXD 5FKAC 3NTHA 1CFMA 3GTMB 5ELFA 3MTSA 1F77A 2K1BA 3ND9A 1EWCA 1ZYRC 2ZTEA 4IPHA 3S17H 2KQ3A 2EYLA 2J4XA 3PQIA 4RHSA 3J81E 1SMXA 1HZBA 4AYBG 4OIKA 2CQAA 3D6WA 5GROA 3NTKA 1YI2A 2R92H 1EYCA 1XNRQ 1JEQA 1P16A 1G6PA 1U4LA 3TS2A 1A62A 1RL2A 3AQQA 3BVZA 1V1OA 1F2MA 1SMYD 1UE5A 1H9RA 4YIJA 2EDGA 4NP5A 4LF4L 4RG1A 5C5LA 5J39A 1GVPA 1C9OA 4GN4B 4XT3B 1H95A 1U4RA 2A5HA 2B2WA 1YJWA 1VQGA 1KAAA 3FEWX 4DK3C 4Q0FA 2KCCA 1YBYA 2E2IB 1WCMG 1WCMB 2BCOA 3MXNA 3DLLA 2UUBQ 2NVQB 3J7A5 4MTNA 1QVFA 5EAYA 3HFZB 4C3HH 1VQ5A 2A19A 1QVGA 3NWTA 1RJTA 4QIWE 1EUJA 2PQEA 1SLJA 3R3OA 4TVAB 3S1MH 3ER0A 4P75A 2UU9L 2YV5A 3CCLA 2F0GA 4L6TB 2LD7A 2R3ZA 3GTGH 3GTQB 3CCMA 1KIXA 1TIID 3S1NH 3MXNB 1MD2D 1HTPA 2PW7A 4RAUC 3HOWG 3HOWB 1HR0W 2Q2IA 3MAQA 4X3SA 3H15A 2MGSA 1SAPA 3KUPA 4APVA 3RN5A 2A8VA 2AHOB 4IUQA 4R9WA 2JN4A 4RGMA 1B70B 1X54A 3NUCA 1XNQL 1OXSC 1BCPD 1TS5A 4DUYL 4DNIA 3KBGA 4JI8Q 3TBIB 3RZDB 1BVSA 1CKOA 1Q82C 3D4DA 4RCOA 1GL9B 1EIFA 1XX8A 4A3JG 1QILA 2AKWB 2F0DA 1CM9A 3U50C 1QVCA 1UNSA 3TP7A 5ELBA 1HR0Q 1AZQA 1Y1WG 1Y1WB 2G80A 2KCMA 5BN3A 1JOQA 1SE4A 3PO2H 2EYHA 1T5EA 3KLSA 3HOZH 1V8QA 1HZAA 3WWVA 1DZ1A 1I3QH 5FJ8G 5F2DA 1XMQQ 3I4MG 4DPGA 3HOYG 3HOYB 4IOAA 4DR6Q 2Q2UA 5H1SE 1OXUA 1X3GA 3A55A 4DA2A 2D0PA 3GTMH 1YNSA 3I91A 4LNQA 4IZ8A 1LT3D 5A35A 2IX0A 4K14A 1SJHD 4H02A 3M4QA 1VQBA 1E2ZA 2ZJQA 5C6AA 2B2YA 1KLGD 1HHVA 4BY7G 4BY7B 1S5CD 4IUTA 2HQEA 3CXCA 1A8VA 2K32A 2WFWA 2XIWA 1DJRD 3BJUA 4KHPQ 2LY7A 4LK1C 4HR7B 4IO9A 3M9BA 4GOPC 1G2SA 1B3AA
chains in the Genus database with same CATH topology
4DV5Q 2OTLA 1PYBA 4DR2L 1MJEA 3PO3H 1Q1BA 3AYHB 4POFA 3KOJA 1N34L 1WFQA 4A3BH 3D31A 4LF8Q 2IT1A 1BBWA 1TWCH 3EBEA 1B7YB 2CQOA 1X3EA 4JCVE 4C2MH 2BH8A 3CCQA 4GOPA 2VW9A 1WCMH 2E2IH 2NVQH 3T1HL 1N33L 4OWWB 4OO1I 2MO1A 4A3EH 4JI2L 1IYJB 2R92G 1KRSA 2K50A 2CCZA 3L2PA 2MO0A 2MFIA 1IBMQ 2YTXA 5GAGC 5IE8A 4DV1Q 3CF5A 2VUMG 1LUZA 4A93G 3DM3A 4OX9L 3GTJH 1X6OA 2F3IA 3OTOL 3F2BA 2Z0SA 1HZCA 1UE1A 2ASBA 2D62A 2JA6H 2VQFQ 1E22A 1SN8A 3GTQH 1AE2A 4B3TQ 2HHHQ 2CWAA 1PH3A 2NN6I 1ZS9A 3BZCA 2C35B 4EX5A 4K0KQ 2RHSB 4DAMA 3T1YQ 3HOVH 3KF8B 3FKIG 4HJ5A 4GLAC 3CC2A 2F4VL 3HOWH 1G291 2K5VA 3UDGA 4LF6Q 1WYDA 2HIVA 1PHJA 1HNWL 4L5SA 5M3MG 4X6AH 2ZJRA 1HH2P 1VQ7A 3CPWA 2UUAQ 1PH1A 4PZ6A 1N32L 5HGQA 3CQZH 1UE7A 5ELNA 1ASZA 2VZAA 2JA7G 2QNCA 3A0JA 2OQKA 1Y1VH 3ERSX 4IPDA 4DAYB 1XMOL 3BZKA 3HOXH 4DV0L 1U5KA 3HOUG 1VQCA 4DV2L 4IPCA 2DK4A 1P8LA 5M5WH 4BA1I 4DR6L 1M90C 4YHHL 2QEXA 1GKHA 4GS3A 4AH6A 4BY1G 4QGUA 2PQAB 3I56A 4GN3B 3I4NG 4JV5L 4JOIA 3AFQA 1H9EA 3J80i 4JI5L 1VQHA 4IPGA 3W1BA 1KQSA 4B3SL 3U4VA 4BBSG 3PGZA 5C4XH 4GNXA 4X66L 3HKZG 2OCEA 4A3MH 2Y0SE 4LUVA 3D0FA 5IP9H 2PI2E 2VS1A 1E24A 3H3VH 2ID0A 2JK8A 3PUWA 4R4IA 4DV6Q 2LC3A 1Y1WH 4B3MQ 1I94Q 1YNXA 5BR8Q 1WI5A 3KF6A 5LMNW 4LF4Q 4HJ9A 1PH2A 1N9WA 3CAMA 5IYBH 3ULPA 3L0OA 2WAQE 1XNRL 4Y52H 4A3FH 2CWPA 4J15A 1TWAH 3H0GG 4POGA 3W1GA 3CMAA 5J3BA 2R93G 1VQAA 2VY3A 3GO5A 2XTIA 3ULJA 4HJAA 4A3GG 1SE8A 1E7DA 1CUKA 2E8GA 1FJGL 3SGIA 2ZM6L 1QZGA 2K75A 4LF9Q 1I6HH 4DR7Q 3KF6B 1QZHA 5GQOA 1PA6A 2UU9Q 1FVIA 3CPFA 2BA0A 3HOYH 4AQYL 5AJ3L 2AMCB 2OQ0A 2R6GA 1OXVA 4MNOA 5IWAQ 1VQMA 3A5UA 2UUCQ 2I5MX 2UUBL 2I5LX 1VQ8A 4L5QA 3G6EA 2RF4A 4A4IA 4FDBA 3STBD 2QGQA 3K7UC 4A3CH 2BA1A 1Q7YC 1VQJA 5LMNQ 4YCWA 2UXCL 4JI4L 4JG2A 1PH4A 4KLKA 1XJVA 2JEBI 4OONA 4X64L 4DKAC 4R4CA 3CCJA 2YTVA 3S16H 1W2BA 2KCTA 1JJGA 4JI1Q 4LFAQ 2N3SA 3VDYA 1X56A 4OO1G 2XGTA 1EQRA 3PCOB 3G4SA 2HHHL 2BH2A 3PSIA 4BY7H 4GKKL 1JE5A 4LWCA 2YTYA 2HIXA 1YZ6A 3J81c 1JJCB 3J81j 3HOZG 1J5EQ 5C0XJ 4JI3Q 3S14H 3PUYA 4DUYQ 1UEBA 1JEIA 2YU9H 1A0IA 4JYAL 1TXYA 4UPAA 4YCUA 5ELOA 3JC66 2JEAI 3OW2A 2NN6G 1K73C 4JI6L 3NEMA 5GAHC 3GTOH 4DV7Q 4A3IH 3UDFA 2IHEA 1C7YA 4HIDA 1AH9A 4JI0L 4YY3L 4P72A 2B63G 4DV3Q 3EIVA 4UY8C 1IBLQ 4JI8L 2UXBQ 3UE0A 1NTGA 4DV4Q 2IY5B 1E7LA 1VQPA 1XPRA 4A3LG 2EIFA 2R7DA 2JA8G 2EXDA 4NXNL 4XTCS 4QJFA 5M5YH 5JJLA 4LF5Q 1VS0A 3KJPA 5C3EH 1GJJA 4UP8A 4IOCA 1NBWA 2R7FA 4X62L 5C0XI 4QQBX 3RLFA 4HIKA 1HR0L 4BXXG 4X65L 2DUDA 1YIJA 1GD7A 3PO3G 2AWOA 2JE6I 3K7AH 1EYGA 2WAQG 4LUZA 4DUZL 1YHBA 3TRZA 4A3BG 3KFUA 1K8GA 4LF7Q 1J6QA 2B3GA 1SROA 4JBWA 4YCVA 2NVTH 4LUOA 2OWOA 2W51A 4LFBQ 1H9FA 4R4OA 1HNZL 4O2DA 1X9NA 1IBKQ 4IJHA 1EIYB 2NZOA 1PV4A 4WJ3M 4NXMQ 3RNUA 1X65A 3LGJA 4C3JH 3E9HA 1N36Q 1KD1C 5C4JH 1PH8A 3STBC 3GD7A 2PQAA 3JAMi 4JBJA 4HIMA 4DR5L 4A3KG 4GKJL 4YWLA 2N8NA 3ZJYC 4JI7L 1Q81C 3PUXA 2QNFA 3GDEA 1YVCA 1HNXL 1N8RC 2JA7H 1S3OA 1XMQL 1I50H 3FP9A 3M4OH 4DR1Q 3HOUH 3S1RH 2UUCL 2RHQB 5LMUQ 1VQDA 4DR3L 2JA6G 3M3YH 2JA5H 2PNHA 4DR4Q 4BY1H 3RZDH 3CCRA 1TWHH 2H5XA 4OWTB 2UXDL 3HOVG 1JMCA 1LM0A 5FLMH 4A3JH 1T9HA 4AYBE 1G51A 5IYCG 3TQYA 4B3RL 4BBRG 1O7IA 2HT1A 1QUQA 2K5HA 4LW1A 4R1JA 4JI1L 1VQIA 3KLWA 1CSPA 3EN2A 1L0WA 3I2ZA 3RR5A 1E1TA 1OXXK 1KAWA 3KJOA 4DR2Q 1L1OC 2B29A 1WOCA 4YWKA 4EQ5A 2VQEL 2PMZE 1M1KC 1N34Q 5JJIA 1UE6A 2ALYB 3HOXG 3CCSA 4KHPL 4P71A 1SR3A 3H0GH 3Q8DA 2ZJPA 3ICEA 4HIOA 1YJNA 1K3RA 2R93H 1Q46A 4WJ4A 1UWVA 3T1HQ 1N33Q 1KHIA 4NB3A 1QUQB 4JI2Q 4DV5L 1KC8C 1JJ2A 1A63A 1I5FA 1HJPA 3TREA 1E3PA 3L7ZC 2R7ZG 1IXRA 2ODCI 2A1AA 4YWMA 5C4XG 5FJ8H 3RZOH 4A3MG 3B6YA 1S40A 1CKMA 3I55A 4LF8L 2NVXH 3GTPH 1YHAA 4OX9Q 4DV3L 3I4MH 4A3DH 3OTOQ 1L2FA 3KDFB 3F2DA 1RIPA 2KBNA 5IYDG 1XPUA 4GN5A 2FXQA 5C44H 2I0QA 3A5ZB 4Y7NH 2AWNA 2DGYA 3CP0A 1VQNA 2RCNA 3NBHB 3U4ZA 3UDIA 1Y14B 5E7NA 4LF5L 2LXJA 1EN7A 1NY4A 3UE1A 4A3FG 1CKNB 1IBML 2F4VQ 4GLVB 1L1OB 2E5LQ 4DV1L 3AFPA 3PO2G 4LFCQ 1HNWQ 1FL0A 4JC0A 3I4OA 4MZ9A 1S72A 4KHZA 4XIGS 4HJ7A 3CMEA 1VQKA 2ES2A 2LSSA 2VQFL 3F1ZA 3J80c 4B3TL 1XPOA 3RLNA 1B8AA 3HOZH 4K0KL 3T1YL 4IJLA 2CKZB 2JJQA 4R4QA 5IT9c 1XMOQ 4DV0Q 1IBKL 1XNQQ 5M5XH 4DV2Q 4NXML 4LF6L 5IP7H 1PH6A 3GTKH 4OWXB 5C0XG 1V43A 3TEHB 3H3VI 4YHHQ 5JJKA 2V1CC 2YYZA 2UUAL 3AEVA 2D0OA 4JV5Q 2PI2A 4JBKA 1LTLA 1KL9A 3F2CA 1R9TH 4B3SQ 4JI5Q 1VQ5A 1NMFA 3TS0A 2E2JH 3RLOA 4X66Q 4C3IH 5JEAJ 1EQQA 1KRTA 2CFMA 2ZTEA 4IPHA 4P74A 5JEAG 5GAEC 5LMUL 2B63H 3S17H 2GN5A 2EQSA 1SMXA 5K36G 1EWIA 3CW2C 5M3FG 1HZBA 4AYBG 3I7FA 1JT8A 5GROA 1VCIA 4A3LH 4L5TA 3E0EA 2JA8H 1YI2A 2R92H 3MEFA 3CCUA 1XNRQ 2Y0SG 3M85A 1P16A 4TQUS 2ODGC 3NELA 4IFDJ 1G6PA 3TS2A 3CC4A 4IFDG 4KI0A 1A62A 1RL2A 3AQQA 2VUMH 4A93H 1VQ9A 3K8AA 4DV6L 4BXXH 1LYLA 4UP7A 1UE5A 3E9IA 1GO3E 5FLXc 4B3ML 2Q2TA 3A74A 1KXLA 1I94L 5BR8L 1XTDA 4A3IG 4RG1A 4LF4L 1FJGQ 1GVPA 2GVBA 3IRBA 1C9OA 2I5HA 4GN4B 2ZM6Q 1H95A 2HJQA 1OTCA 1YJWA 3PIPA 1VQLA 1EFWA 1K83H 1VQGA 4DK3C 3FKIH 4AQYQ 4A76A 1BKBA 5AJ3Q 4BA2I 1VQFA 1YBYA 1MJCA 1WCMG 3DLLA 3RN2A 1YEZA 3J7ZC 2UUBQ 5M3MH 4A3KH 3J7A5 2ZTCA 4MTNA 1QVFA 5EAYA 3HFZB 4C3HH 1K0RA 2A19A 4A3EG 3PIOA 4NPSA 4QIWE 1YJ9A 1QVGA 1EUJA 1SLJA 1X3FA 2K4KA 5C3EG 1NJIC 2WB1E 3S2HH 2JA9A 4JI4Q 1VQEA 4TVAB 1VQ4A 3S1MH 2UXCQ 3ER0A 4P75A 3M4PA 3PV0A 1Q8KA 4P73A 4X64Q 2KHIA 2MPHA 4LF9L 4DR7L 2UU9L 2YV5A 3CCLA 4RMFA 4IFDI 5IWAL 3NENA 2LD7A 2WP8J 3K81C 3F8TA 2F52A 2HQLA 3CCVA 1CSQA 4GOPB 3K80C 3CCMA 1SFOH 1KIXA 2IX1A 3GTGH 4GKKQ 4PZ8A 3S1NH 3MXNB 3I4NH 2E5LL 4DK6C 5IYCH 5LMNL 3HOWG 4BBSH 4BBRH 4LFCL 1Y02A 2NVYH 1HR0W 1JB7A 1Z47A 2K5NA 2Q2IA 4JYAQ 3H15A 2QA4A 3RN5A 1PFSA 1MIUA 1E1OA 2A8VA 5DLQE 2AHOB 3UDXA 4APVA 4LFAL 4JOIC 1Z9FA 4JI6Q 1B70B 1PYSB 1NE3A 4R4TA 1OXTA 4L5RC 1X54A 1Q1EA 1IZ6A 2Z6KC 4GNXC 1V1QA 3BU2A 1OXSC 4PG3A 1XNQL 3KDFA 1Y1VG 1J5EL 3GTLH 4JI3L 1SRUA 3HKSA 1YITA 4YY3Q 4DUYL 1BBUA 4JI0Q 4DNIA 4HJ8A 1Q12A 4JI8Q 2JA5G 4JBMA 2GVAA 1BVSA 1CKOA 1Q82C 1GL9B 3FHWA 1D7QA 1EIFA 5FLMG 4A3JG 1CKNA 4A3GH 4NXNQ 4ME3A 2R7ZH 1L1OA 1C0AA 2AKWB 2Z6KA 2IHFA 4DV7L 3J81i 1E7ZA 3U50C 1QVCA 3OYYA 2KENA 1GM5A 1W3SA 5IP9G 4X62Q 3W5OA 3JAMc 2VNUD 5IYDH 1HR0Q 2VL6A 1IBLL 4X65Q 1Y1WG 2G80A 2UXBL 5GADC 2KCMA 1VQOA 3G48A 3KYHC 4DV4L 2Q2HA 4DUZQ 5IYBG 3K0XA 2KHJA 5IY0A 3U58A 3S2DH 1TWGH 4QY7A 1NMGA 3PO2H 2ZTDA 1HNZQ 3CC7A 4GLXA 3S1QH 1AE3A 4GNXB 2E2HH 4DR5Q 1HZAA 3WWVA 4GKJQ 2ATWA 4UP9A 4JI7Q 2K52A 2LXKA 1I3QH 5FJ8G 1N32Q 2N78A 4PZ7A 1YHQA 1HNXQ 4QL5A 3G71A 1Q86C 3PUVA 1K8AC 1XMQQ 4LF7L 3I4MG 4A3DG 3ULLA 4LFBL 1PVOA 3PUZA 4AIMA 4DPGA 1D8LA 4PMWA 3HOYG 4O0AA 4IOAA 5C44G 1N36L 4DR3Q 1HZ9A 2L15A 1MKHA 4A75A 4DR6Q 2WB1G 2MQHA 2Q2UA 5H1SE 1VQ6A 1OXUA 1X3GA 2UXDQ 4A3CG 2D0PA 1K9MC 3PF4A 1DGSA 1GKUB 3GTMH 4B3RQ 1YNSA 4ALPA 1U0LA 4LNQA 1WJJA 2K14A 4DR1L 2IX0A 2KFVA 1PH5A 3M7NA 3CCEA 3PF5A 3S15H 4H02A 3M4QA 1VQBA 1TWFH 3HKZE 2ZJQA 2N49A 5M3FH 4DR4L 1PH7A 4OXPA 3S24A 5HY6A 2VQEQ 4BY7G 3CXCA 1V9PA 1A8VA 2WFWA 1ASYA 3BJUA 1X55A 4KHPQ 1FGUA 2MNAA 5IP7G 1EOVA 2NZHA 4IO9A 3CD6A 1IL2A 3M9BA 2JQOA 4GOPC 2OTJA 1PH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 Q;  2OTL A;  1PYB A;  4DR2 L;  1MJE A;  3PO3 H;  1Q1B A;  3AYH B;  4POF A;  3KOJ A;  1N34 L;  1WFQ A;  4A3B H;  3D31 A;  4LF8 Q;  2IT1 A;  1BBW A;  1TWC H;  3EBE A;  1B7Y B;  2CQO A;  1X3E A;  4JCV E;  4C2M H;  2BH8 A;  3CCQ A;  4GOP A;  2VW9 A;  1WCM H;  2E2I H;  2NVQ H;  3T1H L;  1N33 L;  4OWW B;  4OO1 I;  2MO1 A;  4A3E H;  4JI2 L;  1IYJ B;  2R92 G;  1KRS A;  2K50 A;  2CCZ A;  3L2P A;  2MO0 A;  2MFI A;  1IBM Q;  2YTX A;  5GAG C;  5IE8 A;  4DV1 Q;  3CF5 A;  2VUM G;  1LUZ A;  4A93 G;  3DM3 A;  4OX9 L;  3GTJ H;  1X6O A;  2F3I A;  3OTO L;  3F2B A;  2Z0S A;  1HZC A;  1UE1 A;  2ASB A;  2D62 A;  2JA6 H;  2VQF Q;  1E22 A;  1SN8 A;  3GTQ H;  1AE2 A;  4B3T Q;  2HHH Q;  2CWA A;  1PH3 A;  2NN6 I;  3BZC A;  2C35 B;  4EX5 A;  4K0K Q;  2RHS B;  4DAM A;  3T1Y Q;  3HOV H;  3KF8 B;  3FKI G;  4HJ5 A;  4GLA C;  3CC2 A;  2F4V L;  3HOW H;  1G29 1;  2K5V A;  3UDG A;  4LF6 Q;  1WYD A;  2HIV A;  1PHJ A;  1HNW L;  4L5S A;  5M3M G;  4X6A H;  2ZJR A;  1HH2 P;  1VQ7 A;  3CPW A;  2UUA Q;  1PH1 A;  4PZ6 A;  1N32 L;  5HGQ A;  3CQZ H;  1UE7 A;  5ELN A;  1ASZ A;  2VZA A;  2JA7 G;  2QNC A;  3A0J A;  2OQK A;  1Y1V H;  3ERS X;  4IPD A;  4DAY B;  1XMO L;  3BZK A;  3HOX H;  4DV0 L;  1U5K A;  3HOU G;  1VQC A;  4DV2 L;  4IPC A;  1P8L A;  5M5W H;  4BA1 I;  4DR6 L;  1M90 C;  4YHH L;  2QEX A;  1GKH A;  4GS3 A;  4AH6 A;  4BY1 G;  4QGU A;  2PQA B;  3I56 A;  4GN3 B;  3I4N G;  4JV5 L;  4JOI A;  3AFQ A;  4JI5 L;  3J80 i;  1KQS A;  1VQH A;  4IPG A;  3W1B A;  4B3S L;  4BBS G;  3U4V A;  3PGZ A;  5C4X H;  4GNX A;  4X66 L;  3HKZ G;  2OCE A;  4A3M H;  2Y0S E;  4LUV A;  3D0F A;  5IP9 H;  2PI2 E;  2VS1 A;  1E24 A;  3H3V H;  2ID0 A;  2JK8 A;  3PUW A;  4R4I A;  4DV6 Q;  1Y1W H;  4B3M Q;  1I94 Q;  1YNX A;  5BR8 Q;  1WI5 A;  3KF6 A;  5LMN W;  4LF4 Q;  4HJ9 A;  1PH2 A;  1N9W A;  3CAM A;  5IYB H;  3ULP A;  3L0O A;  2WAQ E;  1XNR L;  4Y52 H;  4A3F H;  2CWP A;  4J15 A;  1TWA H;  3H0G G;  4POG A;  3W1G A;  3CMA A;  5J3B A;  2R93 G;  1VQA A;  2VY3 A;  3GO5 A;  2XTI A;  3ULJ A;  4HJA A;  4A3G G;  1SE8 A;  1E7D A;  1CUK A;  2E8G A;  1FJG L;  3SGI A;  2ZM6 L;  1QZG A;  2K75 A;  4LF9 Q;  1I6H H;  4DR7 Q;  3KF6 B;  1QZH A;  5GQO A;  1PA6 A;  2UU9 Q;  1FVI A;  3CPF A;  2BA0 A;  3HOY H;  4AQY L;  5AJ3 L;  2AMC B;  2OQ0 A;  2R6G A;  1OXV A;  4MNO A;  5IWA Q;  1VQM A;  3A5U A;  2UUC Q;  2I5M X;  2UUB L;  2I5L X;  1VQ8 A;  4L5Q A;  3G6E A;  2RF4 A;  4A4I A;  4FDB A;  3STB D;  2QGQ A;  3K7U C;  4A3C H;  2BA1 A;  1Q7Y C;  1VQJ A;  5LMN Q;  4YCW A;  2UXC L;  4JI4 L;  4JG2 A;  1PH4 A;  4KLK A;  1XJV A;  2JEB I;  4OON A;  4X64 L;  4DKA C;  4R4C A;  3CCJ A;  2YTV A;  3S16 H;  1W2B A;  2KCT A;  1JJG A;  4JI1 Q;  4LFA Q;  2N3S A;  3VDY A;  1X56 A;  4OO1 G;  2XGT A;  1EQR A;  3PCO B;  3G4S A;  2HHH L;  2BH2 A;  3PSI A;  4BY7 H;  4GKK L;  1JE5 A;  4LWC A;  2YTY A;  2HIX A;  1YZ6 A;  3J81 c;  1JJC B;  3J81 j;  3HOZ G;  1J5E Q;  5C0X J;  4JI3 Q;  3S14 H;  3PUY A;  4DUY Q;  1UEB A;  2YU9 H;  1A0I A;  4JYA L;  1TXY A;  4UPA A;  4YCU A;  5ELO A;  3JC6 6;  2JEA I;  3OW2 A;  2NN6 G;  1K73 C;  4JI6 L;  3NEM A;  5GAH C;  3GTO H;  4DV7 Q;  4A3I H;  3UDF A;  2IHE A;  1C7Y A;  4HID A;  1AH9 A;  4JI0 L;  4YY3 L;  4P72 A;  2B63 G;  4DV3 Q;  3EIV A;  4UY8 C;  1IBL Q;  4JI8 L;  2UXB Q;  3UE0 A;  1NTG A;  4DV4 Q;  2IY5 B;  1E7L A;  1VQP A;  1XPR A;  4A3L G;  2EIF A;  2R7D A;  2JA8 G;  2EXD A;  4NXN L;  4XTC S;  4QJF A;  5M5Y H;  5JJL A;  4LF5 Q;  1VS0 A;  3KJP A;  5C3E H;  4UP8 A;  4IOC A;  1NBW A;  2R7F A;  4X62 L;  5C0X I;  4QQB X;  3RLF A;  4HIK A;  1HR0 L;  4BXX G;  4X65 L;  2DUD A;  1YIJ A;  1GD7 A;  3PO3 G;  2AWO A;  2JE6 I;  3K7A H;  1EYG A;  2WAQ G;  4LUZ A;  4DUZ L;  1YHB A;  3TRZ A;  4A3B G;  3KFU A;  1K8G A;  4LF7 Q;  1J6Q A;  2B3G A;  1SRO A;  4JBW A;  4YCV A;  2NVT H;  4LUO A;  2OWO A;  4LFB Q;  4R4O A;  1HNZ L;  4O2D A;  1X9N A;  1IBK Q;  4IJH A;  1EIY B;  2NZO A;  1PV4 A;  4WJ3 M;  4NXM Q;  3RNU A;  1X65 A;  3LGJ A;  4C3J H;  3E9H A;  1N36 Q;  1KD1 C;  5C4J H;  1PH8 A;  3STB C;  3GD7 A;  2PQA A;  3JAM i;  4JBJ A;  4HIM A;  4DR5 L;  4A3K G;  4GKJ L;  4YWL A;  2N8N A;  3ZJY C;  4JI7 L;  1Q81 C;  3PUX A;  2QNF A;  3GDE A;  1YVC A;  1HNX L;  1N8R C;  2JA7 H;  1S3O A;  1XMQ L;  1I50 H;  3FP9 A;  3M4O H;  4DR1 Q;  3HOU H;  3S1R H;  2UUC L;  2RHQ B;  5LMU Q;  1VQD A;  4DR3 L;  2JA6 G;  3M3Y H;  2JA5 H;  2PNH A;  4DR4 Q;  4BY1 H;  3RZD H;  3CCR A;  1TWH H;  2H5X A;  4OWT B;  2UXD L;  3HOV G;  1JMC A;  1LM0 A;  5FLM H;  4A3J H;  1T9H A;  4AYB E;  1G51 A;  5IYC G;  3TQY A;  4B3R L;  4BBR G;  1O7I A;  2HT1 A;  1QUQ A;  2K5H A;  4LW1 A;  4R1J A;  4JI1 L;  1VQI A;  3KLW A;  1CSP A;  3EN2 A;  1L0W A;  3I2Z A;  3RR5 A;  1E1T A;  1OXX K;  1KAW A;  3KJO A;  4DR2 Q;  1L1O C;  2B29 A;  1WOC A;  4YWK A;  4EQ5 A;  2VQE L;  2PMZ E;  1M1K C;  1N34 Q;  5JJI A;  1UE6 A;  2ALY B;  3HOX G;  3CCS A;  4KHP L;  4P71 A;  1SR3 A;  3H0G H;  3Q8D A;  2ZJP A;  3ICE A;  4HIO A;  1YJN A;  1K3R A;  2R93 H;  1Q46 A;  4WJ4 A;  1UWV A;  3T1H Q;  1N33 Q;  1KHI A;  4NB3 A;  1QUQ B;  4JI2 Q;  4DV5 L;  1KC8 C;  1JJ2 A;  1A63 A;  1I5F A;  1HJP A;  3TRE A;  1E3P A;  3L7Z C;  2R7Z G;  1IXR A;  2A1A A;  4YWM A;  5C4X G;  5FJ8 H;  3RZO H;  4A3M G;  3B6Y A;  1S40 A;  1CKM A;  3I55 A;  4LF8 L;  2NVX H;  3GTP H;  1YHA A;  4OX9 Q;  4DV3 L;  3I4M H;  4A3D H;  3OTO Q;  1L2F A;  3KDF B;  3F2D A;  1RIP A;  2KBN A;  5IYD G;  1XPU A;  4GN5 A;  2FXQ A;  5C44 H;  2I0Q A;  3A5Z B;  4Y7N H;  2AWN A;  2DGY A;  3CP0 A;  1VQN A;  2RCN A;  3NBH B;  3U4Z A;  3UDI A;  1Y14 B;  5E7N A;  4LF5 L;  2LXJ A;  1EN7 A;  1NY4 A;  3UE1 A;  4A3F G;  1CKN B;  1IBM L;  2F4V Q;  4GLV B;  1L1O B;  2E5L Q;  4DV1 L;  3AFP A;  3PO2 G;  4LFC Q;  1HNW Q;  1FL0 A;  4JC0 A;  3I4O A;  4MZ9 A;  1S72 A;  4KHZ A;  4XIG S;  4HJ7 A;  3CME A;  1VQK A;  2ES2 A;  2LSS A;  2VQF L;  3F1Z A;  3J80 c;  4B3T L;  1XPO A;  3RLN A;  1B8A A;  3HOZ H;  4K0K L;  3T1Y L;  4IJL A;  2CKZ B;  2JJQ A;  4R4Q A;  5IT9 c;  1XMO Q;  4DV0 Q;  1IBK L;  1XNQ Q;  5M5X H;  4DV2 Q;  4NXM L;  4LF6 L;  5IP7 H;  1PH6 A;  3GTK H;  4OWX B;  5C0X G;  1V43 A;  3TEH B;  3H3V I;  4YHH Q;  5JJK A;  2V1C C;  2YYZ A;  2UUA L;  3AEV A;  2D0O A;  4JV5 Q;  2PI2 A;  4JBK A;  1LTL A;  1KL9 A;  3F2C A;  1R9T H;  4B3S Q;  4JI5 Q;  1VQ5 A;  1NMF A;  3TS0 A;  2E2J H;  3RLO A;  4X66 Q;  4C3I H;  5JEA J;  1EQQ A;  1KRT A;  2CFM A;  2ZTE A;  4IPH A;  4P74 A;  5JEA G;  5GAE C;  5LMU L;  2B63 H;  3S17 H;  2GN5 A;  2EQS A;  1SMX A;  5K36 G;  1EWI A;  3CW2 C;  5M3F G;  1HZB A;  4AYB G;  3I7F A;  1JT8 A;  5GRO A;  1VCI A;  4A3L H;  4L5T A;  3E0E A;  2JA8 H;  1YI2 A;  2R92 H;  3MEF A;  3CCU A;  1XNR Q;  2Y0S G;  3M85 A;  1P16 A;  4TQU S;  3NEL A;  4IFD J;  1G6P A;  3TS2 A;  3CC4 A;  4IFD G;  4KI0 A;  1A62 A;  1RL2 A;  3AQQ A;  2VUM H;  4A93 H;  1VQ9 A;  3K8A A;  4DV6 L;  4BXX H;  1LYL A;  4UP7 A;  1UE5 A;  3E9I A;  1GO3 E;  5FLX c;  4B3M L;  2Q2T A;  3A74 A;  1KXL A;  1I94 L;  5BR8 L;  1XTD A;  4A3I G;  4RG1 A;  4LF4 L;  1FJG Q;  1GVP A;  2GVB A;  3IRB A;  1C9O A;  2I5H A;  4GN4 B;  2ZM6 Q;  1H95 A;  2HJQ A;  1OTC A;  1YJW A;  3PIP A;  1VQL A;  1EFW A;  1K83 H;  1VQG A;  4DK3 C;  3FKI H;  4AQY Q;  4A76 A;  1BKB A;  5AJ3 Q;  4BA2 I;  1VQF A;  1YBY A;  1MJC A;  1WCM G;  3DLL A;  3RN2 A;  1YEZ A;  3J7Z C;  2UUB Q;  5M3M H;  4A3K H;  3J7A 5;  2ZTC A;  4MTN A;  1QVF A;  5EAY A;  3HFZ B;  4C3H H;  1K0R A;  2A19 A;  4A3E G;  3PIO A;  4NPS A;  4QIW E;  1YJ9 A;  1QVG A;  1EUJ A;  1SLJ A;  1X3F A;  2K4K A;  5C3E G;  1NJI C;  2WB1 E;  3S2H H;  2JA9 A;  4JI4 Q;  1VQE A;  4TVA B;  1VQ4 A;  3S1M H;  2UXC Q;  3ER0 A;  4P75 A;  3M4P A;  3PV0 A;  1Q8K A;  4P73 A;  4X64 Q;  2KHI A;  4LF9 L;  4DR7 L;  2UU9 L;  2YV5 A;  3CCL A;  4RMF A;  4IFD I;  5IWA L;  3NEN A;  2WP8 J;  3K81 C;  3F8T A;  2F52 A;  2HQL A;  3CCV A;  1CSQ A;  4GOP B;  3K80 C;  3CCM A;  1SFO H;  1KIX A;  2IX1 A;  3GTG H;  4GKK Q;  4PZ8 A;  3S1N H;  3MXN B;  3I4N H;  2E5L L;  4DK6 C;  5IYC H;  5LMN L;  3HOW G;  4BBS H;  4BBR H;  4LFC L;  2NVY H;  1HR0 W;  1JB7 A;  1Z47 A;  2K5N A;  2Q2I A;  4JYA Q;  3H15 A;  2QA4 A;  3RN5 A;  1PFS A;  1MIU A;  1E1O A;  2A8V A;  5DLQ E;  2AHO B;  3UDX A;  4APV A;  4LFA L;  4JOI C;  1Z9F A;  4JI6 Q;  1B70 B;  1PYS B;  1NE3 A;  4R4T A;  1OXT A;  4L5R C;  1X54 A;  1Q1E A;  1IZ6 A;  2Z6K C;  4GNX C;  1V1Q A;  3BU2 A;  1OXS C;  4PG3 A;  1XNQ L;  3KDF A;  1Y1V G;  1J5E L;  3GTL H;  4JI3 L;  1SRU A;  3HKS A;  1YIT A;  4YY3 Q;  4DUY L;  1BBU A;  4JI0 Q;  4DNI A;  4HJ8 A;  1Q12 A;  4JI8 Q;  2JA5 G;  4JBM A;  2GVA A;  1BVS A;  1CKO A;  1Q82 C;  3FHW A;  1D7Q A;  1EIF A;  5FLM G;  4A3J G;  1CKN A;  4A3G H;  4NXN Q;  4ME3 A;  2R7Z H;  1L1O A;  1C0A A;  2AKW B;  2Z6K A;  2IHF A;  4DV7 L;  3J81 i;  1E7Z A;  3U50 C;  1QVC A;  3OYY A;  2KEN A;  1GM5 A;  1W3S A;  5IP9 G;  4X62 Q;  3W5O A;  3JAM c;  2VNU D;  5IYD H;  1HR0 Q;  2VL6 A;  1IBL L;  4X65 Q;  1Y1W G;  2UXB L;  5GAD C;  2KCM A;  1VQO A;  3G48 A;  3KYH C;  4DV4 L;  2Q2H A;  4DUZ Q;  5IYB G;  3K0X A;  2KHJ A;  5IY0 A;  3U58 A;  3S2D H;  1TWG H;  4QY7 A;  1NMG A;  3PO2 H;  2ZTD A;  1HNZ Q;  3CC7 A;  4GLX A;  3S1Q H;  1AE3 A;  4GNX B;  2E2H H;  4DR5 Q;  1HZA A;  3WWV A;  4GKJ Q;  2ATW A;  4UP9 A;  4JI7 Q;  2K52 A;  2LXK A;  1I3Q H;  5FJ8 G;  1N32 Q;  2N78 A;  4PZ7 A;  1YHQ A;  1HNX Q;  4QL5 A;  3G71 A;  1Q86 C;  3PUV A;  1K8A C;  1XMQ Q;  4LF7 L;  3I4M G;  4A3D G;  3ULL A;  4LFB L;  1PVO A;  3PUZ A;  4AIM A;  4DPG A;  1D8L A;  4PMW A;  3HOY G;  4O0A A;  4IOA A;  5C44 G;  1N36 L;  4DR3 Q;  1HZ9 A;  2L15 A;  1MKH A;  4A75 A;  4DR6 Q;  2WB1 G;  2MQH A;  2Q2U A;  5H1S E;  1VQ6 A;  1OXU A;  1X3G A;  2UXD Q;  4A3C G;  2D0P A;  1K9M C;  3PF4 A;  1DGS A;  3GTM H;  4B3R Q;  4ALP A;  1U0L A;  4LNQ A;  1WJJ A;  2K14 A;  4DR1 L;  2IX0 A;  1PH5 A;  3M7N A;  3CCE A;  3PF5 A;  3S15 H;  4H02 A;  3M4Q A;  1VQB A;  1TWF H;  3HKZ E;  2ZJQ A;  2N49 A;  5M3F H;  4DR4 L;  1PH7 A;  4OXP A;  3S24 A;  5HY6 A;  2VQE Q;  4BY7 G;  3CXC A;  1V9P A;  1A8V A;  2WFW A;  1ASY A;  3BJU A;  1X55 A;  4KHP Q;  1FGU A;  2MNA A;  5IP7 G;  1EOV A;  2NZH A;  4IO9 A;  3CD6 A;  1IL2 A;  3M9B A;  2JQO A;  4GOP C;  2OTJ A;  1PH9 A; 
#chains in the Genus database with same CATH topology
 1LTG D;  4K8I A;  1BF4 A;  2F4I A;  3T4A C;  1K8M A;  1PYB A;  4RKL A;  1MJE A;  1Q1B A;  1O7Y A;  3GTO B;  4A3B H;  1M4V A;  3QWN A;  1PLF A;  2BDN A;  1B7Y B;  2CQO A;  1X3E A;  3NSW A;  2E2I H;  2VW9 A;  1WCM H;  2NVQ H;  1KHC A;  4KJN A;  4OWW B;  1QG7 A;  4OO1 I;  2M2L A;  2K50 A;  3L2P A;  3HP3 A;  2MO0 A;  5M5Y B;  2CW0 C;  1BCP B;  1W6J A;  4A93 G;  4HCS A;  3OTO L;  2F3I A;  3F2B A;  2Z0S A;  1HZC A;  3T16 A;  3HEJ A;  2VQF Q;  1OO9 B;  1E22 A;  3GTQ H;  3RUZ A;  2NN6 I;  1ZS9 A;  1LTT D;  2C35 B;  3FKI G;  3HOW H;  2DJF C;  4LF6 Q;  1KNA A;  1HNW L;  4NKL A;  4C3J B;  3DMU A;  2SDF A;  2RKS A;  5C4J B;  2ZJR A;  1HH2 P;  5CGK A;  1VQ7 A;  5KGU A;  4LMQ D;  4ZLT F;  5HGQ A;  2F0N A;  4ULL A;  2JA7 G;  2JA7 B;  3AU7 A;  4DAY B;  4DV0 L;  3M4O B;  3K5O A;  1VQC A;  2QIL A;  4DV2 L;  2DK4 A;  1W6K A;  4BA1 I;  4DR6 L;  3M3Y B;  1HPC A;  4GS3 A;  5JOB A;  1TU2 B;  1TWH B;  3I56 A;  4GN3 B;  1KQS A;  1H9E A;  2TMP A;  1SJE D;  3U4V A;  2NBF A;  1PTO D;  4GNX A;  4X66 L;  5IIF A;  3DHQ A;  1ZYR D;  2O2L D;  2VS1 A;  3H3V H;  2KW9 A;  3PUW A;  4ZAI A;  4DV6 Q;  2LC3 A;  1Y1W H;  4B3M Q;  4ZQ3 A;  4M1U B;  2PCF B;  1YNX A;  2H4O A;  3KF6 A;  1BXT A;  1PH2 A;  1QNU A;  1ICW A;  3A7A B;  3BVM A;  4N8X 1;  4TSS A;  1HXY D;  3VR6 A;  4DAV A;  4HCE A;  2F03 A;  3CMA A;  5J3B A;  2R93 G;  1PRT C;  2R93 B;  3GO5 A;  4WFN 3;  4H44 C;  2F0K A;  3L9A X;  2KHS A;  5CC4 A;  3RZO B;  4LF9 Q;  4DR7 Q;  3KF6 B;  3O13 A;  1QZH A;  3HOY H;  5IWA Q;  4UZW A;  2BOS A;  4Y7N B;  1C4Q A;  2MUY A;  4NMZ A;  2BA1 A;  5HGT A;  2UXC L;  4KN7 C;  4JI4 L;  4KLK A;  2JEB I;  4X64 L;  5I6Y A;  2YTV A;  5DM7 3;  4HMI A;  5J22 A;  5C5M A;  4O1N A;  5CMD A;  3G4S A;  2EY2 A;  3PSI A;  4BY7 H;  5E3F A;  4S3S A;  1SYB A;  4FVM A;  3QR8 A;  3J81 j;  3HOZ G;  3ITP A;  3HOZ B;  5IOD A;  1NCV A;  2Z1C A;  1FD7 D;  4JI3 Q;  3PUY A;  3EJI A;  3MFY A;  1KNE A;  4IFD H;  1DON A;  4UPA A;  1GHK A;  2B2V A;  3MHB A;  2KUM A;  2A6H C;  1U4M A;  3I70 A;  3NEM A;  5GAH C;  3GTO H;  2AQ3 B;  2IHE A;  4C3I B;  3BDL A;  1H9K A;  1KLU D;  4JI0 L;  4DV3 Q;  2UXB Q;  1NTG A;  4DV4 Q;  1B3Q A;  1VQP A;  1H1J S;  4A3L G;  1DCZ A;  3KF8 A;  4KKU A;  2JA8 G;  2JA8 B;  1F9R A;  3G7L A;  4XTC S;  3OWF A;  2B2W C;  5M5Y H;  3KJP A;  2IW3 A;  4RA8 A;  2D2C C;  3DEO A;  1RCV D;  1STN A;  2R7F A;  4X62 L;  1V1P A;  2VUM B;  4WJW A;  2K6A A;  3RLF A;  3SE0 A;  3ND8 A;  4X65 L;  1YIJ A;  4G57 A;  3VA5 A;  5FK9 C;  1JC7 A;  1J9O A;  1SND A;  2F0U A;  1S5F D;  5CV5 A;  4LF7 Q;  3MWY W;  4XQN A;  1K83 B;  1PTO B;  1H9F A;  4XXE A;  1DOM A;  1IBK Q;  1HNZ L;  1I4Q A;  1YNN C;  4KKS A;  2Z6B A;  3LGJ A;  4C3J H;  2OT2 A;  1BDO A;  5C4J H;  3STB C;  3GD7 A;  2PQA A;  1GJX A;  3H09 A;  2RNN A;  4JI7 L;  4RGT A;  3S2H B;  1QCB D;  3GDE A;  5CR3 A;  2JA7 H;  1EIH A;  1J8I A;  3RMH A;  3FP9 A;  3M4O H;  4DR1 Q;  3MA2 B;  4ID6 A;  5LMU Q;  3G6J B;  3U9O A;  5I2X A;  2JA6 G;  3M3Y H;  2JA5 H;  5JAV A;  1TWH H;  2FIN B;  2H5X A;  3HOV G;  3HOV B;  1EQT A;  3F2U A;  5IYC G;  3TQY A;  4B3R L;  4BBR G;  4BBR B;  2KCN A;  3HS0 C;  1SNC A;  5EBD A;  4ODG A;  4DR2 Q;  4OGQ C;  1WOC A;  2L1B A;  3T56 B;  5FO8 B;  1JWU D;  1UE6 A;  3HOX G;  3GTL B;  1Z6H A;  4FXG C;  3V05 A;  2ZJP A;  1YJN A;  2R93 H;  1HFG A;  3T1H Q;  1N33 Q;  4UDU C;  4DAP A;  4JI2 Q;  4KTA A;  5CBE E;  3P20 A;  1KC8 C;  1I5F A;  1JJ2 A;  2Z4H A;  1Q3L A;  5C4X G;  3RZO H;  1GUO A;  3QB3 A;  2XRQ D;  3FVQ A;  4FNF A;  4DV3 L;  3SXH A;  3KDF B;  1RIP A;  5IYD G;  4DXG A;  4O42 A;  4GN5 A;  2FXQ A;  3A5Z B;  4Y7N H;  2AWN A;  2PNR C;  1Y14 B;  2F0S A;  3C3L A;  4DF7 A;  1TWG B;  3FPU B;  4GLV B;  1L1O B;  1WVL A;  4B08 A;  2E5L Q;  3BZD B;  1MI2 A;  3VYR A;  3S1Q B;  4X3K A;  1S72 A;  3P75 A;  4XIG S;  4HJ7 A;  1UUP A;  2LSS A;  1WTV A;  2L55 A;  1JWM D;  1B8A A;  2F0P A;  2JP1 A;  5DM6 3;  2QDL A;  4DXF A;  1ML0 D;  1H9S A;  2JJQ A;  2K5D A;  4R4Q A;  3TZU A;  1IBK L;  4WJ3 M;  3H3V I;  4YHH Q;  1ZBH A;  2B2Y C;  1KDA A;  4JV5 Q;  2PI2 A;  3F2C A;  3A56 A;  3CRL C;  5IT9 L;  2A6E D;  3TS0 A;  4C3I H;  4MHE A;  2E74 C;  1GUT A;  1EQQ A;  5JEA G;  5LMU L;  2EXZ A;  3S15 B;  2GN5 A;  2MP1 A;  5K36 G;  1LTB D;  3I4L A;  4N9T A;  2QW7 A;  4A3L H;  2M9V A;  4KJO A;  3E0E A;  2JA8 H;  4RGO S;  1PXU A;  3MEF A;  3CCU A;  1RTO A;  3M85 A;  2ODG C;  3NEL A;  4IFD J;  3K5M A;  1PFM A;  2VUM H;  1VQ9 A;  3I90 A;  4KD3 A;  3NWS A;  1EYD A;  1I94 L;  4LAA A;  4IUV A;  1XTD A;  4A3I G;  1FJG Q;  4X3T A;  2ZM6 Q;  1YNJ C;  2HJQ A;  5NUC A;  1VQL A;  1G6Z A;  1K83 H;  1PTO H;  1XWE A;  1TWC B;  4AQY Q;  5JPM C;  5AJ3 Q;  2O4X A;  5FLX L;  3IFT A;  1YEZ A;  3J7Z C;  2F3W A;  3ZYY X;  2L4N A;  4NPS A;  1YJ9 A;  4Y52 H;  1X3F A;  2F0F A;  2BE5 D;  4G4K A;  3GV6 A;  4IQZ A;  5C3E G;  3S2H H;  2XVS A;  5E4X A;  1B9N A;  2MPH A;  1G8Z D;  5I4D A;  1ET9 A;  4RMF A;  4IFD I;  1WTP A;  3K7A B;  3DM1 A;  3P1H A;  1VMC A;  3CCV A;  3KLR A;  2NZ1 D;  4GOP B;  3K80 C;  4N8F A;  4K5X A;  3I4N H;  2E5L L;  1LT6 D;  4RHR A;  5IYC H;  5LMN L;  4KN4 C;  3OIQ A;  4BBR H;  2RA4 A;  1Y02 A;  1JB7 A;  2N88 A;  5BN4 A;  2K5N A;  3TP5 A;  1E1O A;  1TY2 A;  4U67 3;  2J7Z A;  1NE3 A;  3CQZ B;  1IZ6 A;  1GXD C;  2Z6K C;  4GNX C;  1V1Q A;  3BU2 A;  3MXG A;  5EPK A;  1F9Q A;  2RSO A;  1J5E L;  5E4W C;  4ZYS A;  3GTL H;  1F9S A;  1SRU A;  1CA6 A;  1ILP A;  4HJ8 A;  1Q12 A;  4JBM A;  1KTK A;  1V66 A;  5KRU A;  1CKN A;  4BWG B;  4NXN Q;  4ME3 A;  2A6H D;  5IGD A;  2IHF A;  4CDF C;  4A3M B;  3W5O A;  3JAM c;  5IYD H;  3M7G A;  5K5P A;  5GAD C;  3G48 A;  2L5T A;  2RQX A;  4KHV A;  1KDC A;  2OXP A;  1TWG H;  3UI2 A;  1CK1 A;  2B2U A;  4A3F B;  3K5N A;  2L0C A;  3S1Q H;  3M4Y A;  4GKJ Q;  4LJZ C;  2VB2 X;  2K52 A;  2LXK A;  1N32 Q;  2QF7 A;  1YHQ A;  4QL5 A;  2IX3 A;  3G71 A;  1Q86 C;  2F0I A;  4A3D G;  4A3D B;  3ULL A;  4LFB L;  4X3U A;  3MVV A;  4RGN A;  5C44 G;  5C44 B;  4HSP A;  1N36 L;  1YNN D;  1HZ9 A;  4J6H A;  2WB1 G;  1WTR A;  2UXD Q;  1K9M C;  1A2T A;  3PF4 A;  1DGS A;  4BS9 A;  1GKU B;  4ALP A;  4C56 C;  1JE4 A;  3S16 B;  1WJJ A;  1LO5 D;  3AB9 A;  3S15 H;  1I4G A;  5C3X A;  1D5X C;  4RCN A;  4ABN A;  2N49 A;  4QCL A;  4DR4 L;  1PH7 A;  4H13 C;  1TR5 A;  3S24 A;  5HY6 A;  5IT9 E;  2IJ0 A;  4AYB B;  1V9P A;  1Y8P B;  4PMC A;  4EQN A;  1FGU A;  3S14 B;  5IP7 G;  1BBX C;  3K58 A;  2NZH A;  3EA6 A;  5COR A;  1PH9 A;  2B2T C;  1O80 A;  2IWH A;  3KOJ A;  1WFQ A;  4LF8 Q;  3H91 A;  2F0O A;  1TWC H;  2HD3 A;  4OEM B;  3VA7 A;  1PRT F;  3OMC A;  3A54 A;  2MO1 A;  3H6M A;  1VMP A;  2CCZ A;  2WKD A;  2YTX A;  1JWS D;  5IE8 A;  4DV1 Q;  1TS2 A;  5LL6 S;  3CF5 A;  1LUZ A;  1KDB A;  3DM3 A;  4OX9 L;  3VR4 A;  1B1Z A;  4KY5 A;  1PZJ D;  3MZ5 A;  5KND A;  1SN8 A;  1AE2 A;  3TSS A;  2CWA A;  4CHT B;  4EX5 A;  1PFB A;  4HJ5 A;  4GLA C;  1ZXT A;  1G29 1;  2RDH A;  1WYD A;  2HIV A;  1IL8 A;  1PHJ A;  1BNZ A;  4XYQ A;  5M3M G;  1ENC A;  3AMU A;  2UUA Q;  3CPW A;  1PH1 A;  1SYF A;  1N32 L;  3U9S A;  1MBY A;  3CQZ H;  1VDZ A;  3NPP A;  2EE1 A;  2VZA A;  1UAP A;  1XMO L;  3BZK A;  1JIC A;  3OIP A;  4OIJ A;  3J7A V;  4IPC A;  3S1R B;  1HUM A;  2QEX A;  1GKH A;  5I6W A;  1SFO B;  4AH6 A;  1CHP D;  4BY1 G;  4BY1 B;  2F0H A;  2DY8 A;  2K28 A;  3VR3 A;  5BN5 A;  3J80 i;  1SNP A;  4A3J B;  3SK6 A;  4BBS G;  4DNR B;  4HSV A;  4U68 A;  3HKZ G;  4A3M H;  4HTH A;  1ILQ A;  2PI2 E;  3OWE B;  2JK8 A;  2B8G A;  3MEH A;  3X3M A;  5BR8 Q;  1SYG A;  3QG1 A;  3SDZ A;  3L0O A;  3N52 A;  1XNR L;  2KED A;  4A3F H;  2CWP A;  2EJG C;  5IGE A;  1ESR A;  1SNO A;  4A3G G;  1ICF B;  2LS0 1;  4G7O C;  1E2W A;  4PV1 C;  1SE8 A;  1CI3 M;  1CUK A;  2EYO A;  3I72 A;  4WOR A;  2G9H D;  1TY0 A;  1IYV A;  4L8J A;  1WTO A;  1EOT A;  1FVI A;  3CPF A;  3I4M B;  2R6G A;  4MNO A;  2D5D A;  1JOR A;  3A5U A;  2UUB L;  2I5L X;  3OMG A;  4L5Q A;  4A4I A;  4HN7 A;  2EYF A;  1Q7Y C;  2EYM A;  1PH4 A;  5IGG A;  3HGB A;  4OON A;  4IUN A;  4DKA C;  3S16 H;  3I73 A;  3SR1 A;  1W2B A;  1LTR D;  4LFA Q;  4DK1 A;  4I65 A;  2K01 A;  2PZT A;  5DNF A;  4LWC A;  2YTY A;  1ROD A;  3J81 c;  5ELD A;  2ICI A;  1B9M A;  3S14 H;  2P5Z X;  5IOC A;  3Q0A A;  3T13 A;  1LT4 D;  4KV6 A;  1KAB A;  3JC6 6;  5COY A;  1K8O A;  5CYU A;  1QJO A;  4K5V A;  2EYJ A;  1K73 C;  4FYD A;  2F0J A;  4DV7 Q;  2E2J B;  5C3W A;  1C7Y A;  2B63 G;  2B63 B;  4P72 A;  1X3Q A;  2K5W A;  5DAU A;  4XQQ A;  1IBL Q;  4JI8 L;  2WV6 D;  1RDP D;  2EIF A;  1PZI D;  1FNU A;  2EXD A;  5EKI A;  1EU3 A;  1VS0 A;  3BS1 A;  5JVH 3;  2AQ2 B;  3C1F A;  3TN2 A;  4UP8 A;  4IOC A;  1NBW A;  2KEE A;  4A93 B;  4QQB X;  4HIK A;  1HR0 L;  2DUD A;  1GD7 A;  3PO3 G;  2WAQ G;  1SE3 A;  1YHB A;  3KFU A;  4DAY A;  4JBW A;  1EY7 A;  3FKI B;  1X9N A;  1PV4 A;  1X65 A;  1B44 D;  3W2D A;  2ES2 A;  3SHL A;  4JBJ A;  4PNY A;  5EJW A;  1XMQ L;  2RVL A;  3S1R H;  5G3L F;  4G7Z C;  2OEO A;  1VQD A;  3J7Y W;  4BY1 H;  3RZD H;  4H0L C;  2DNC A;  4A3J H;  1T9H A;  4AYB E;  1G51 A;  2R61 A;  4HED A;  1I4P A;  2F0V A;  1CQF A;  4R1J A;  4V19 0;  3EN2 A;  2NWG A;  3RR5 A;  1E1T A;  1STY A;  3KJO A;  4DNT B;  1D1K A;  1N34 Q;  3NXW A;  2ALY B;  2CH4 W;  1CTM A;  4NDX A;  3CCS A;  1JR0 D;  4P2C B;  4KHP L;  4WRD A;  1WTH A;  1SR3 A;  1Q46 A;  1KHI A;  5I9O A;  1QNK A;  4J1M A;  3HRZ C;  1A63 A;  1E3P A;  2ODC I;  4CBV A;  2A1A A;  5FJ8 H;  2B2U C;  4UAI A;  1CKM A;  3S9W A;  1YHA A;  3I4M H;  1L2F A;  3PMF A;  2SNS A;  4OHJ A;  5KIX A;  2WQG A;  4V0B A;  2I0Q A;  3CP0 A;  3NBH B;  2A68 C;  3U4Z A;  3FDT A;  1HRJ A;  2I07 B;  3E0J A;  3UE1 A;  2F4V Q;  4PMB A;  3S2D B;  3AFP A;  1SXT A;  2E2H B;  1K0S A;  4KHZ A;  2K7V A;  1SBB B;  2ZXP A;  2VQF L;  1EY4 A;  1XPO A;  1BQQ T;  3R8B A;  3RLN A;  4IJL A;  4LF6 L;  1PH6 A;  3ERQ A;  5C0X G;  3BYY B;  3J80 L;  3KBX A;  1A2U A;  5FO7 B;  2D0O A;  4JBK A;  1KL9 A;  4B3S Q;  1SE2 A;  4JI5 Q;  2E2J H;  3RLO A;  3WOE A;  2DN8 A;  4OEL B;  1KRT A;  2JYO A;  5GAE C;  2B63 H;  1GOZ A;  3A8J E;  1FGB D;  1SNQ A;  1U9R A;  1EWI A;  3VR2 A;  5M3F G;  5M3F B;  1HFN A;  4L5T A;  3MC0 B;  4QF4 A;  2Y0S G;  2Y0S B;  2AUJ D;  4TQU S;  2SNM A;  1HQM C;  3CC4 A;  2F0E A;  4FO2 A;  2D9U A;  4A93 H;  3K8A A;  4DV6 L;  1IHZ A;  1LYL A;  4UP7 A;  3E9I A;  1GO3 E;  4B3M L;  1O7Z A;  1ZEQ X;  2GVB A;  1LAB A;  3IRB A;  3MXP A;  1OTC A;  2KEC A;  3PIP A;  1EFW A;  2LFN A;  2NTT A;  3FKI H;  5T1I A;  2K5Q A;  1LTA D;  4BA2 I;  1MJC A;  2A69 C;  4ME5 A;  5EPJ A;  3T51 B;  3NK9 A;  1K0R A;  3PIO A;  1QE6 A;  4GZY C;  1NJI C;  3KLS X;  4FF2 A;  1LAC A;  1VQ4 A;  4LF9 L;  3M4P A;  3PV0 A;  4DR7 L;  4P73 A;  3GTJ B;  1X3P A;  4TKO B;  5IWA L;  3NEN A;  3K81 C;  1Y69 U;  3NQI A;  5CV6 A;  1JOO A;  1LTI D;  1JJR A;  2IX1 A;  2JA6 B;  2J0T D;  2PW5 A;  4GKK Q;  3NBI A;  3ERO A;  4DK6 C;  3H3V C;  1SNM A;  1R4P B;  4JYA Q;  2QA4 A;  1PFS A;  4JW0 A;  2PPB C;  1Z9F A;  4JI6 Q;  2K03 A;  4L5R C;  2Z4I A;  4R4T A;  2ICE C;  3CRK C;  3KDF A;  5CV9 A;  4JI3 L;  1D1I A;  2H1E A;  3HKS A;  3HOX B;  4G7H C;  4YY3 Q;  4FP5 D;  5M5W B;  1D6E C;  1EZ8 A;  2GVA A;  4IUU A;  2F3V A;  1NR4 A;  1D7Q A;  5FLM G;  2A74 C;  2VXW A;  1L1O A;  2ZT9 C;  5C4X B;  1SMY C;  2VNU D;  2QDB A;  5D14 A;  4KKT A;  2UXB L;  3T53 B;  1VQO A;  4DV4 L;  2Q2H A;  4XT1 B;  4DUZ Q;  1MSH A;  5IYB G;  1BUV T;  2KVD A;  1SYC A;  4DN4 M;  2KHJ A;  5CBA E;  5IY0 A;  2CHB D;  3S2D H;  1NMG A;  2ZTD A;  1AW7 A;  4GLX A;  2CW0 D;  1PZK D;  1AE3 A;  1S5D D;  2TSS A;  4EQP A;  2E2H H;  1EL0 A;  3TME A;  4DR5 Q;  4K0K L;  2ATW A;  4KY7 A;  1HNX Q;  4J8Q A;  4LF7 L;  1K8A C;  3PUV A;  1I6H B;  3PUZ A;  4O0A A;  1PYW D;  5C0X H;  4DR3 Q;  2E2D C;  2F0M A;  3WDN A;  1CA5 A;  2EOT A;  3DEP A;  4ZCK A;  2ZXO A;  2XWB B;  1SYD A;  3DXJ C;  1NAP A;  2K14 A;  4DR1 L;  3M7N A;  3J80 E;  3CCE A;  5M3F H;  4OXP A;  3QIA A;  2VQE Q;  1BCP C;  2KA7 A;  5C4H A;  1MHW C;  1CT1 D;  2L9H A;  3CD6 A;  2NTS A;  1D5M C;  5HUR A;  2YU9 B;  1TVX A;  5KNB A;  5A2Q L;  4ZKC B;  3K6O A;  4DV5 Q;  2DNE A;  1FNV A;  2OTL A;  4DR2 L;  2RNO A;  5ISR A;  3K59 A;  4A3I B;  1TT2 A;  3D31 A;  2IT1 A;  1BBW A;  1B4O A;  4Z9C B;  1CQV A;  4UHV A;  4ZUJ A;  3CCQ A;  4GOP A;  2JVW A;  3T1H L;  1N33 L;  2K04 A;  2RBM A;  4JI2 L;  1TQO A;  2OF1 A;  1PRT D;  1GUN A;  1KRS A;  4QMG A;  2R92 G;  2R92 B;  1A3U A;  4KK7 A;  3LWU A;  1IBM Q;  5C3E B;  3MFG A;  3GTJ H;  1X6O A;  1JQY D;  1UE1 A;  2B39 A;  2D62 A;  4HAE A;  2L11 A;  3VYS A;  3DUZ A;  1U4P A;  2JA6 H;  1QB5 D;  4XDX A;  4B3T Q;  2HHH Q;  2KVM A;  3BZC A;  2RHS B;  3D6C A;  3T1Y Q;  3HOV H;  1DOK A;  4EGV A;  3CC2 A;  2K5V A;  2EJM A;  4L5S A;  4X6A H;  3LWE A;  1RKN A;  3QJY A;  4C3H G;  4PZ6 A;  2EPB A;  2DJG C;  3E5S A;  1ASZ A;  5AFW A;  2F0T A;  2QNC A;  3A0J A;  2OQK A;  3ERS X;  4IPD A;  3HOX H;  4B9W A;  1EY9 A;  1RF2 D;  5M5W H;  1M90 C;  1CZG A;  5EBC A;  4YHH L;  4QGU A;  1WTW A;  1GHJ A;  4I7Z C;  1IKL A;  4JV5 L;  3BG3 A;  4JOI A;  3AFQ A;  1VQH A;  4IPG A;  4CJ2 C;  1D5Z C;  3PGZ A;  5C4X H;  1RTN A;  2Y0S E;  5FOB B;  2GA4 B;  3C2P A;  1E24 A;  1K28 A;  3K5L A;  4LF4 Q;  4HJ9 A;  1ONL A;  1N9W A;  3CAM A;  5IYB H;  3BVG A;  5CV8 A;  5CV7 A;  1MGS A;  3W1G A;  2HCC A;  2VY3 A;  2XTI A;  3ULJ A;  4HJA A;  1Z7T A;  1GUG A;  2XSC A;  2K33 A;  1QWY A;  4ZRZ A;  2EJF C;  1E7D A;  4FF3 A;  1FJG L;  1F9P A;  2EVB A;  2ZM6 L;  1I6H H;  1XTC D;  5IGB A;  3TP6 A;  5GQO A;  2NVX B;  2UU9 Q;  4AQY L;  5AJ3 L;  5J1Z A;  2OQ0 A;  2UUC Q;  1OXV A;  1VQ8 A;  2RF4 A;  2WB1 B;  3STB D;  1FNW A;  2ZXR A;  4YCW A;  4JG2 A;  3R93 A;  1H9J A;  2EY6 A;  3DWQ A;  3NP8 A;  4R4C A;  3CCJ A;  2KCT A;  1JJG A;  5JEA H;  1EY0 A;  2N3S A;  1I3Q B;  1STH A;  2B2V C;  2HHH L;  3PCO B;  5K36 H;  1IYU A;  2FHT A;  1PRT B;  3VYU A;  1ESF A;  1JE5 A;  2B8F A;  4ILW A;  2HIX A;  1YZ6 A;  2E76 C;  4CKB A;  4FF1 A;  5ELC A;  5C0X J;  5M5X B;  3Q22 A;  4DUY Q;  4F8M A;  3GTK B;  1G2T A;  1JEI A;  1SSO A;  2YU9 H;  1A0I A;  1ENA A;  1Q90 A;  4YCU A;  1QOH A;  4MN3 A;  5ELO A;  1SYE A;  2JEA I;  4XYO A;  5EGT A;  4BIT A;  1PTO C;  3E3X A;  2EY5 A;  1R9T B;  4A3I H;  1F2Z A;  2QEJ C;  4IUR A;  1B53 A;  5A2Q E;  3EIV A;  4UY8 C;  4CKC A;  1H9M A;  3SEB A;  3UE0 A;  4RFB A;  1IW7 C;  3I3C A;  2IY5 B;  1HUN A;  4FXD A;  1XPR A;  2R7D A;  3D3R A;  4HMJ A;  4NXN L;  4QJF A;  1F2L A;  4F7X A;  5C3E H;  3Q23 A;  3IL8 A;  1STB A;  1JB3 A;  2ENB A;  5FLX E;  5C0X I;  4BXX G;  1DXM A;  3GV3 A;  3K7A H;  2IL8 A;  5LHY 1;  4DGZ A;  2Z9H A;  4A3B G;  4A3B B;  5E1F A;  3A8I E;  1K8G A;  1J6Q A;  5IGF A;  4YCV A;  3C46 A;  4LUO A;  2OWO A;  2W51 A;  1EIY B;  4O2D A;  4IJH A;  4NXM Q;  1S4Z A;  1R4Q B;  3E9H A;  1KD1 C;  1PH8 A;  3JAM i;  5M3M B;  4A3K G;  4A3K B;  2NYZ D;  2N8N A;  5FO9 B;  4GKJ L;  5JJZ A;  3PUX A;  2QNF A;  1YVC A;  1N8R C;  4H7B A;  5EKK A;  2DY7 A;  2UUC L;  1LLR D;  3D4R A;  2PNH A;  5G3L D;  2UXD L;  1JMC A;  4BBS B;  2NVY B;  1O7I A;  2X6L A;  2MHV A;  4N9P A;  4LW1 A;  3QKJ A;  3HKZ B;  3KLW A;  1CSP A;  4KD4 A;  3VYT A;  1L0W A;  2OTJ A;  2QKI C;  1L1O C;  2B29 A;  4EQ5 A;  5JJI A;  1B2T A;  1MSG A;  2C9O A;  4P71 A;  3GP7 A;  3ICE A;  5L37 A;  1K3R A;  1HTL D;  3E6Z X;  4M8A A;  4DU9 A;  4NB3 A;  4E6I A;  3LLR A;  5EKL A;  4A3G B;  2R7Z G;  2R7Z B;  4YWM A;  1XYI A;  1S40 A;  5EPL A;  2XWJ B;  2NVX H;  4LF8 L;  4A3D H;  3OTO Q;  1YNJ D;  3F2D A;  2KBN A;  2Q8T A;  1XPU A;  5I9P A;  5C44 H;  1C8C A;  2AUK A;  5JVG 3;  5DEH A;  2Q8I B;  2RCN A;  1CZW A;  1AZP A;  2N55 A;  3L3O C;  4IUP A;  1LV9 A;  4R8I A;  5E7N A;  4TRD A;  1I6V C;  1EN7 A;  4I7A A;  4DV1 L;  5D3I B;  4LFC Q;  1C48 A;  1DYQ A;  1FL0 A;  3I4O A;  4JC0 A;  1HNW Q;  1AFP A;  3R2T A;  2SEB D;  2X6G A;  2WIN B;  3RD4 A;  3CME A;  1VQK A;  4ZKB B;  2VB3 X;  2CKZ B;  5IT9 c;  4DV0 Q;  2BDO A;  5M5X H;  1EQV A;  4DV2 Q;  4NXM L;  2JXM B;  5IP7 H;  3GTK H;  2FJ2 A;  1V43 A;  2EYP A;  5JJK A;  2YYZ A;  2UUA L;  1VF7 A;  3AEV A;  3NQT A;  1LTL A;  1R9T H;  1ZKO A;  2KOL A;  1NMF A;  4X66 Q;  2AQ1 B;  3BDO A;  5JEA J;  1WD0 A;  2CFM A;  2FMM A;  4P74 A;  3URY A;  2PZW A;  1Q8I A;  2EQS A;  2C5C A;  4KY6 A;  1TWF B;  1WD1 A;  2O5J C;  3CW2 C;  5CIU A;  3I7F A;  1JT8 A;  1VCI A;  1ET6 A;  2PO4 A;  1I4R A;  3ONA B;  3WOF A;  3OOC A;  4IFD G;  3D8G A;  4KI0 A;  1PDQ A;  1DD2 A;  3IAY A;  4BXX H;  2MJ8 A;  4CJ0 B;  5TSS A;  5FLX c;  2Q2T A;  3A74 A;  1KXL A;  5BR8 L;  2RSN A;  3PO3 B;  2I5H A;  2WAQ B;  4OL7 A;  1A15 A;  3SK8 A;  4A76 A;  1BKB A;  1VQF A;  4C2M B;  1EY8 A;  1AP0 A;  3RN2 A;  4CDE C;  5M3M H;  4A3K H;  2ZTC A;  3C1E A;  4A3E G;  4A3E B;  4JVZ A;  1EEI D;  2RDF A;  2FMC A;  1EWH A;  2K4K A;  2KJX A;  2WB1 E;  2UXC Q;  2JA9 A;  4JI4 Q;  1VQE A;  3LNN A;  1Q8K A;  4X64 Q;  2KHI A;  2WP8 J;  1BR9 A;  1PFN A;  3F8T A;  2F52 A;  2HQL A;  1SFO H;  1CSQ A;  4PZ8 A;  1RD9 D;  3X3N A;  3NHH A;  5CV4 A;  4BBS H;  4LFC L;  2NVY H;  4C3J G;  4RH6 A;  1Z47 A;  5M9O A;  3FLG A;  1MIU A;  4RWS C;  3UDX A;  5DLQ E;  4LFA L;  2A6E C;  1BCP F;  3TP8 A;  4JOI C;  1PYS B;  1OXT A;  1Q1E A;  4PG3 A;  1FR3 A;  1EZ6 A;  5IGC A;  5KYL A;  1A3T A;  1Y1V G;  1Y1V B;  1YIT A;  4JI0 Q;  1BBU A;  2JA5 G;  2JA5 B;  3NBH A;  3TZD A;  3OSO A;  4F87 A;  3GQB A;  1LT5 D;  3FHW A;  4ZUI A;  3V96 A;  4DFA A;  4A3G H;  2R7Z H;  3EQL C;  2CVR A;  4XQJ A;  1C0A A;  2Z6K A;  4DV7 L;  3J81 i;  1E7Z A;  3OYY A;  2KEN A;  2HCI A;  1GM5 A;  1W3S A;  5IP9 G;  4X62 Q;  2VL6 A;  1IBL L;  4X65 Q;  3KYH C;  1IW7 D;  3K0X A;  3U58 A;  4QY7 A;  1HNZ Q;  3JAM L;  1EFI D;  3CC7 A;  1TWA B;  2LMC B;  4GNX B;  2CH4 A;  2WAC A;  2LKV A;  4K8J A;  2BE5 C;  3EVQ A;  4UP9 A;  4JI7 Q;  2N78 A;  4PZ7 A;  3J7A F;  4FF4 A;  2F1M A;  1PVO A;  4AIM A;  1D8L A;  4PMW A;  1G91 A;  2L15 A;  1MKH A;  4A75 A;  2MQH A;  1VQ6 A;  2L12 A;  3LX0 A;  4A3C G;  5KEE A;  3Q6S A;  1D2B A;  1HCZ A;  4B3R Q;  3A8K E;  2MPM A;  1TS4 A;  1U0L A;  1BO0 A;  2KFV A;  1PH5 A;  1AEX A;  3PF5 A;  1TWF H;  1XXG A;  3HKZ E;  2M00 A;  1TKW B;  4L63 B;  3MXU A;  2G5D A;  1ASY A;  1X55 A;  2MNA A;  1EOV A;  1VF5 C;  4K6L A;  2G9D A;  1JOK A;  1IL2 A;  4RKB A;  1BOS A;  2JQO A;  1ENF A;  1STE A;  2PMZ B;  4JK1 C;  3PO3 H;  2NB0 A;  1II3 A;  3AYH B;  4POF A;  4C3I G;  1N34 L;  4KMU C;  4C1N K;  1STA A;  1NNX A;  3EBE A;  1M8A A;  4JCV E;  4C2M H;  2BH8 A;  3VR5 A;  3HG9 A;  2B2T A;  2Q8R E;  5ELE A;  4MTK A;  4A3E H;  1IYJ B;  4F88 A;  3OW7 A;  1PMR A;  1UEA B;  2MFI A;  5GAG C;  1A3V A;  4CJ1 B;  2VUM G;  3NTI A;  1Y8N B;  2ASB A;  1O7L A;  4QB4 A;  3FPP A;  2F0Q A;  3D4W A;  3CU7 A;  4K6D A;  4Q5V A;  3CKI B;  1PH3 A;  3K0Y A;  4K0K Q;  4DAM A;  2NVT B;  3KF8 B;  3P7J A;  2F4V L;  1FYC A;  1LTS D;  3BDC A;  1DM0 B;  3UDG A;  5LL6 X;  1E2V A;  2HDM A;  1T5X D;  1V1P B;  1NSN S;  3H94 A;  1EY6 A;  1UE7 A;  5ELN A;  1I50 B;  1Y1V H;  4ZK9 B;  1EU4 A;  1U5K A;  3HOU G;  3HOU B;  1P8L A;  1PTO F;  2PQA B;  3QO2 A;  3I4N G;  3I4N B;  1S5E D;  4JI5 L;  4B3S L;  1CHQ D;  3W1B A;  1EYA A;  4K2K A;  4NW2 A;  2OCE A;  4LUV A;  3D0F A;  5IP9 H;  1NUC A;  2ID0 A;  5C4Z A;  4R4I A;  1AN8 A;  1I94 Q;  1WI5 A;  2V4D A;  5LMN W;  3ULP A;  2RCF A;  3Q24 A;  2WKC A;  2WAQ E;  4J15 A;  2EY1 A;  1TWA H;  3SK4 A;  3H0G G;  3H0G B;  4POG A;  2IPK D;  2SOB A;  1TS3 A;  1VQA A;  4CKE A;  5JPN C;  2E8G A;  3SGI A;  3JAM E;  1QZG A;  2K75 A;  1PA6 A;  4QUF A;  3GTP B;  1I4H A;  2BA0 A;  1E0B A;  2AMC B;  1VQM A;  2JSO A;  2I5M X;  4QIW B;  3G6E A;  4FDB A;  4A3C H;  2QGQ A;  2X69 A;  3K7U C;  1GUW A;  1VQJ A;  4R8N A;  5LMN Q;  2PZU A;  2Z8L A;  1XJV A;  4JI1 Q;  1F2Y A;  1SDF A;  3VDY A;  1WTQ A;  1X56 A;  1SEB D;  5D3D A;  4OO1 G;  3BYT B;  2XGT A;  1EQR A;  4C1N I;  2BH2 A;  2NUC A;  3N6R A;  4GKK L;  3PIP 3;  1JJC B;  1IKM A;  1J5E Q;  1GUS A;  1UEB A;  4JYA L;  1HQR D;  1TXY A;  3PIO 3;  3J81 L;  3OW2 A;  4IN3 A;  2E75 C;  2NN6 G;  4JI6 L;  3FRP B;  3UDF A;  5KNC A;  4EQO A;  5D65 A;  2FFK B;  3A7L A;  4HID A;  1AH9 A;  3S17 B;  1H9S B;  4YY3 L;  3DWP A;  3KK7 A;  3I8Z A;  1E7L A;  1EIG A;  1WTX A;  5JJL A;  4LF5 Q;  1GJJ A;  4EVO A;  2F0L A;  1L0X B;  2AWO A;  2JE6 I;  3QOJ A;  2PYK A;  1EYG A;  3QOL A;  4LUZ A;  4DUZ L;  3TRZ A;  2B3G A;  1SRO A;  2NVT H;  2A68 D;  4LFB Q;  2EZV A;  4R4O A;  2XNA C;  2NZO A;  3OPO A;  3RNU A;  1N36 Q;  2KVE A;  4DR5 L;  2K05 A;  4HIM A;  4PQX A;  2O5I C;  4YWL A;  3ZJY C;  4C3H B;  1Q81 C;  4JPB W;  3W3A A;  1HNX L;  3CHB D;  1S3O A;  3TDQ A;  3S1M B;  1I50 H;  1L0Y B;  3HOU H;  1Y8O B;  3HZX A;  2RHQ B;  5EQ0 A;  1NR2 A;  4DR3 L;  4DR4 Q;  3CCR A;  3V2T A;  3GTG B;  4OWT B;  3K57 A;  4CDC C;  1LM0 A;  3S1N B;  5FLM H;  4K5W A;  2F0W A;  1A6X A;  1HA6 A;  2HT1 A;  1QUQ A;  2A73 B;  1I4X A;  2K5H A;  4JI1 L;  1VQI A;  4DK0 A;  3I2Z A;  1OXX K;  1KAW A;  3NE5 B;  1RHP A;  4YWK A;  2VQE L;  2PMZ E;  1M1K C;  1S5B D;  4MIU A;  3H0G H;  3Q8D A;  4HIO A;  4WJ4 A;  1UWV A;  1QUQ B;  4QUC A;  4DV5 L;  1HJP A;  3TRE A;  3L7Z C;  1DOL A;  4CDD C;  1IXR A;  2QCP X;  4K2L A;  3B6Y A;  4A3M G;  1STG A;  3I55 A;  3GTP H;  4B9X A;  4OX9 Q;  5T1G A;  1EEF D;  1O78 A;  3IFD A;  3OHX C;  3FMC A;  1JCK B;  2DGY A;  2XRS D;  1VQN A;  2A69 D;  2I46 A;  3UDI A;  4LF5 L;  2LXJ A;  1EY5 A;  1NY4 A;  4A3F G;  1CKN B;  4CGY B;  1IBM L;  3PO2 G;  1X32 A;  3DWA A;  3PO2 B;  4MZ9 A;  5I2Y A;  3IKJ A;  4FXK C;  3SVM A;  2RDG A;  4OO1 H;  1B50 A;  3F1Z A;  3J80 c;  2WII B;  4B3T L;  5KYI A;  4IAL A;  3T1Y L;  1K3B C;  1XMO Q;  1XNQ Q;  2HDL A;  3SK5 A;  4OWX B;  3TEH B;  2KVU A;  2XN9 C;  1HA5 A;  2V1C C;  3R2I A;  2HUG A;  2NN6 H;  3EFX D;  5FKA C;  3NTH A;  1CFM A;  3GTM B;  5ELF A;  3MTS A;  1F77 A;  2K1B A;  3ND9 A;  1EWC A;  1ZYR C;  2ZTE A;  4IPH A;  3S17 H;  2KQ3 A;  2EYL A;  2J4X A;  3PQI A;  4RHS A;  3J81 E;  1SMX A;  1HZB A;  4AYB G;  4OIK A;  2CQA A;  3D6W A;  5GRO A;  3NTK A;  1YI2 A;  2R92 H;  1EYC A;  1XNR Q;  1JEQ A;  1P16 A;  1G6P A;  1U4L A;  3TS2 A;  1A62 A;  1RL2 A;  3AQQ A;  3BVZ A;  1V1O A;  1F2M A;  1SMY D;  1UE5 A;  1H9R A;  4YIJ A;  2EDG A;  4NP5 A;  4LF4 L;  4RG1 A;  5C5L A;  5J39 A;  1GVP A;  1C9O A;  4GN4 B;  4XT3 B;  1H95 A;  1U4R A;  2A5H A;  2B2W A;  1YJW A;  1VQG A;  1KAA A;  3FEW X;  4DK3 C;  4Q0F A;  2KCC A;  1YBY A;  2E2I B;  1WCM G;  1WCM B;  2BCO A;  3MXN A;  3DLL A;  2UUB Q;  2NVQ B;  3J7A 5;  4MTN A;  1QVF A;  5EAY A;  3HFZ B;  4C3H H;  1VQ5 A;  2A19 A;  1QVG A;  3NWT A;  1RJT A;  4QIW E;  1EUJ A;  2PQE A;  1SLJ A;  3R3O A;  4TVA B;  3S1M H;  3ER0 A;  4P75 A;  2UU9 L;  2YV5 A;  3CCL A;  2F0G A;  4L6T B;  2LD7 A;  2R3Z A;  3GTG H;  3GTQ B;  3CCM A;  1KIX A;  1TII D;  3S1N H;  3MXN B;  1MD2 D;  1HTP A;  2PW7 A;  4RAU C;  3HOW G;  3HOW B;  1HR0 W;  2Q2I A;  3MAQ A;  4X3S A;  3H15 A;  2MGS A;  1SAP A;  3KUP A;  4APV A;  3RN5 A;  2A8V A;  2AHO B;  4IUQ A;  4R9W A;  2JN4 A;  4RGM A;  1B70 B;  1X54 A;  3NUC A;  1XNQ L;  1OXS C;  1BCP D;  1TS5 A;  4DUY L;  4DNI A;  3KBG A;  4JI8 Q;  3TBI B;  3RZD B;  1BVS A;  1CKO A;  1Q82 C;  3D4D A;  4RCO A;  1GL9 B;  1EIF A;  1XX8 A;  4A3J G;  1QIL A;  2AKW B;  2F0D A;  1CM9 A;  3U50 C;  1QVC A;  1UNS A;  3TP7 A;  5ELB A;  1HR0 Q;  1AZQ A;  1Y1W G;  1Y1W B;  2G80 A;  2KCM A;  5BN3 A;  1JOQ A;  1SE4 A;  3PO2 H;  2EYH A;  1T5E A;  3KLS A;  3HOZ H;  1V8Q A;  1HZA A;  3WWV A;  1DZ1 A;  1I3Q H;  5FJ8 G;  5F2D A;  1XMQ Q;  3I4M G;  4DPG A;  3HOY G;  3HOY B;  4IOA A;  4DR6 Q;  2Q2U A;  5H1S E;  1OXU A;  1X3G A;  3A55 A;  4DA2 A;  2D0P A;  3GTM H;  1YNS A;  3I91 A;  4LNQ A;  4IZ8 A;  1LT3 D;  5A35 A;  2IX0 A;  4K14 A;  1SJH D;  4H02 A;  3M4Q A;  1VQB A;  1E2Z A;  2ZJQ A;  5C6A A;  2B2Y A;  1KLG D;  1HHV A;  4BY7 G;  4BY7 B;  1S5C D;  4IUT A;  2HQE A;  3CXC A;  1A8V A;  2K32 A;  2WFW A;  2XIW A;  1DJR D;  3BJU A;  4KHP Q;  2LY7 A;  4LK1 C;  4HR7 B;  4IO9 A;  3M9B A;  4GOP C;  1G2S A;  1B3A A; 
#chains in the Genus database with same CATH homology
 4DV5 Q;  2OTL A;  1PYB A;  4DR2 L;  1MJE A;  3PO3 H;  1Q1B A;  3AYH B;  4POF A;  3KOJ A;  1N34 L;  1WFQ A;  4A3B H;  3D31 A;  4LF8 Q;  2IT1 A;  1BBW A;  1TWC H;  3EBE A;  1B7Y B;  2CQO A;  1X3E A;  4JCV E;  4C2M H;  2BH8 A;  3CCQ A;  4GOP A;  2VW9 A;  1WCM H;  2E2I H;  2NVQ H;  3T1H L;  1N33 L;  4OWW B;  4OO1 I;  2MO1 A;  4A3E H;  4JI2 L;  1IYJ B;  2R92 G;  1KRS A;  2K50 A;  2CCZ A;  3L2P A;  2MO0 A;  2MFI A;  1IBM Q;  2YTX A;  5GAG C;  5IE8 A;  4DV1 Q;  3CF5 A;  2VUM G;  1LUZ A;  4A93 G;  3DM3 A;  4OX9 L;  3GTJ H;  1X6O A;  2F3I A;  3OTO L;  3F2B A;  2Z0S A;  1HZC A;  1UE1 A;  2ASB A;  2D62 A;  2JA6 H;  2VQF Q;  1E22 A;  1SN8 A;  3GTQ H;  1AE2 A;  4B3T Q;  2HHH Q;  2CWA A;  1PH3 A;  2NN6 I;  1ZS9 A;  3BZC A;  2C35 B;  4EX5 A;  4K0K Q;  2RHS B;  4DAM A;  3T1Y Q;  3HOV H;  3KF8 B;  3FKI G;  4HJ5 A;  4GLA C;  3CC2 A;  2F4V L;  3HOW H;  1G29 1;  2K5V A;  3UDG A;  4LF6 Q;  1WYD A;  2HIV A;  1PHJ A;  1HNW L;  4L5S A;  5M3M G;  4X6A H;  2ZJR A;  1HH2 P;  1VQ7 A;  3CPW A;  2UUA Q;  1PH1 A;  4PZ6 A;  1N32 L;  5HGQ A;  3CQZ H;  1UE7 A;  5ELN A;  1ASZ A;  2VZA A;  2JA7 G;  2QNC A;  3A0J A;  2OQK A;  1Y1V H;  3ERS X;  4IPD A;  4DAY B;  1XMO L;  3BZK A;  3HOX H;  4DV0 L;  1U5K A;  3HOU G;  1VQC A;  4DV2 L;  4IPC A;  2DK4 A;  1P8L A;  5M5W H;  4BA1 I;  4DR6 L;  1M90 C;  4YHH L;  2QEX A;  1GKH A;  4GS3 A;  4AH6 A;  4BY1 G;  4QGU A;  2PQA B;  3I56 A;  4GN3 B;  3I4N G;  4JV5 L;  4JOI A;  3AFQ A;  1H9E A;  3J80 i;  4JI5 L;  1VQH A;  4IPG A;  3W1B A;  1KQS A;  4B3S L;  3U4V A;  4BBS G;  3PGZ A;  5C4X H;  4GNX A;  4X66 L;  3HKZ G;  2OCE A;  4A3M H;  2Y0S E;  4LUV A;  3D0F A;  5IP9 H;  2PI2 E;  2VS1 A;  1E24 A;  3H3V H;  2ID0 A;  2JK8 A;  3PUW A;  4R4I A;  4DV6 Q;  2LC3 A;  1Y1W H;  4B3M Q;  1I94 Q;  1YNX A;  5BR8 Q;  1WI5 A;  3KF6 A;  5LMN W;  4LF4 Q;  4HJ9 A;  1PH2 A;  1N9W A;  3CAM A;  5IYB H;  3ULP A;  3L0O A;  2WAQ E;  1XNR L;  4Y52 H;  4A3F H;  2CWP A;  4J15 A;  1TWA H;  3H0G G;  4POG A;  3W1G A;  3CMA A;  5J3B A;  2R93 G;  1VQA A;  2VY3 A;  3GO5 A;  2XTI A;  3ULJ A;  4HJA A;  4A3G G;  1SE8 A;  1E7D A;  1CUK A;  2E8G A;  1FJG L;  3SGI A;  2ZM6 L;  1QZG A;  2K75 A;  4LF9 Q;  1I6H H;  4DR7 Q;  3KF6 B;  1QZH A;  5GQO A;  1PA6 A;  2UU9 Q;  1FVI A;  3CPF A;  2BA0 A;  3HOY H;  4AQY L;  5AJ3 L;  2AMC B;  2OQ0 A;  2R6G A;  1OXV A;  4MNO A;  5IWA Q;  1VQM A;  3A5U A;  2UUC Q;  2I5M X;  2UUB L;  2I5L X;  1VQ8 A;  4L5Q A;  3G6E A;  2RF4 A;  4A4I A;  4FDB A;  3STB D;  2QGQ A;  3K7U C;  4A3C H;  2BA1 A;  1Q7Y C;  1VQJ A;  5LMN Q;  4YCW A;  2UXC L;  4JI4 L;  4JG2 A;  1PH4 A;  4KLK A;  1XJV A;  2JEB I;  4OON A;  4X64 L;  4DKA C;  4R4C A;  3CCJ A;  2YTV A;  3S16 H;  1W2B A;  2KCT A;  1JJG A;  4JI1 Q;  4LFA Q;  2N3S A;  3VDY A;  1X56 A;  4OO1 G;  2XGT A;  1EQR A;  3PCO B;  3G4S A;  2HHH L;  2BH2 A;  3PSI A;  4BY7 H;  4GKK L;  1JE5 A;  4LWC A;  2YTY A;  2HIX A;  1YZ6 A;  3J81 c;  1JJC B;  3J81 j;  3HOZ G;  1J5E Q;  5C0X J;  4JI3 Q;  3S14 H;  3PUY A;  4DUY Q;  1UEB A;  1JEI A;  2YU9 H;  1A0I A;  4JYA L;  1TXY A;  4UPA A;  4YCU A;  5ELO A;  3JC6 6;  2JEA I;  3OW2 A;  2NN6 G;  1K73 C;  4JI6 L;  3NEM A;  5GAH C;  3GTO H;  4DV7 Q;  4A3I H;  3UDF A;  2IHE A;  1C7Y A;  4HID A;  1AH9 A;  4JI0 L;  4YY3 L;  4P72 A;  2B63 G;  4DV3 Q;  3EIV A;  4UY8 C;  1IBL Q;  4JI8 L;  2UXB Q;  3UE0 A;  1NTG A;  4DV4 Q;  2IY5 B;  1E7L A;  1VQP A;  1XPR A;  4A3L G;  2EIF A;  2R7D A;  2JA8 G;  2EXD A;  4NXN L;  4XTC S;  4QJF A;  5M5Y H;  5JJL A;  4LF5 Q;  1VS0 A;  3KJP A;  5C3E H;  1GJJ A;  4UP8 A;  4IOC A;  1NBW A;  2R7F A;  4X62 L;  5C0X I;  4QQB X;  3RLF A;  4HIK A;  1HR0 L;  4BXX G;  4X65 L;  2DUD A;  1YIJ A;  1GD7 A;  3PO3 G;  2AWO A;  2JE6 I;  3K7A H;  1EYG A;  2WAQ G;  4LUZ A;  4DUZ L;  1YHB A;  3TRZ A;  4A3B G;  3KFU A;  1K8G A;  4LF7 Q;  1J6Q A;  2B3G A;  1SRO A;  4JBW A;  4YCV A;  2NVT H;  4LUO A;  2OWO A;  2W51 A;  4LFB Q;  1H9F A;  4R4O A;  1HNZ L;  4O2D A;  1X9N A;  1IBK Q;  4IJH A;  1EIY B;  2NZO A;  1PV4 A;  4WJ3 M;  4NXM Q;  3RNU A;  1X65 A;  3LGJ A;  4C3J H;  3E9H A;  1N36 Q;  1KD1 C;  5C4J H;  1PH8 A;  3STB C;  3GD7 A;  2PQA A;  3JAM i;  4JBJ A;  4HIM A;  4DR5 L;  4A3K G;  4GKJ L;  4YWL A;  2N8N A;  3ZJY C;  4JI7 L;  1Q81 C;  3PUX A;  2QNF A;  3GDE A;  1YVC A;  1HNX L;  1N8R C;  2JA7 H;  1S3O A;  1XMQ L;  1I50 H;  3FP9 A;  3M4O H;  4DR1 Q;  3HOU H;  3S1R H;  2UUC L;  2RHQ B;  5LMU Q;  1VQD A;  4DR3 L;  2JA6 G;  3M3Y H;  2JA5 H;  2PNH A;  4DR4 Q;  4BY1 H;  3RZD H;  3CCR A;  1TWH H;  2H5X A;  4OWT B;  2UXD L;  3HOV G;  1JMC A;  1LM0 A;  5FLM H;  4A3J H;  1T9H A;  4AYB E;  1G51 A;  5IYC G;  3TQY A;  4B3R L;  4BBR G;  1O7I A;  2HT1 A;  1QUQ A;  2K5H A;  4LW1 A;  4R1J A;  4JI1 L;  1VQI A;  3KLW A;  1CSP A;  3EN2 A;  1L0W A;  3I2Z A;  3RR5 A;  1E1T A;  1OXX K;  1KAW A;  3KJO A;  4DR2 Q;  1L1O C;  2B29 A;  1WOC A;  4YWK A;  4EQ5 A;  2VQE L;  2PMZ E;  1M1K C;  1N34 Q;  5JJI A;  1UE6 A;  2ALY B;  3HOX G;  3CCS A;  4KHP L;  4P71 A;  1SR3 A;  3H0G H;  3Q8D A;  2ZJP A;  3ICE A;  4HIO A;  1YJN A;  1K3R A;  2R93 H;  1Q46 A;  4WJ4 A;  1UWV A;  3T1H Q;  1N33 Q;  1KHI A;  4NB3 A;  1QUQ B;  4JI2 Q;  4DV5 L;  1KC8 C;  1JJ2 A;  1A63 A;  1I5F A;  1HJP A;  3TRE A;  1E3P A;  3L7Z C;  2R7Z G;  1IXR A;  2ODC I;  2A1A A;  4YWM A;  5C4X G;  5FJ8 H;  3RZO H;  4A3M G;  3B6Y A;  1S40 A;  1CKM A;  3I55 A;  4LF8 L;  2NVX H;  3GTP H;  1YHA A;  4OX9 Q;  4DV3 L;  3I4M H;  4A3D H;  3OTO Q;  1L2F A;  3KDF B;  3F2D A;  1RIP A;  2KBN A;  5IYD G;  1XPU A;  4GN5 A;  2FXQ A;  5C44 H;  2I0Q A;  3A5Z B;  4Y7N H;  2AWN A;  2DGY A;  3CP0 A;  1VQN A;  2RCN A;  3NBH B;  3U4Z A;  3UDI A;  1Y14 B;  5E7N A;  4LF5 L;  2LXJ A;  1EN7 A;  1NY4 A;  3UE1 A;  4A3F G;  1CKN B;  1IBM L;  2F4V Q;  4GLV B;  1L1O B;  2E5L Q;  4DV1 L;  3AFP A;  3PO2 G;  4LFC Q;  1HNW Q;  1FL0 A;  4JC0 A;  3I4O A;  4MZ9 A;  1S72 A;  4KHZ A;  4XIG S;  4HJ7 A;  3CME A;  1VQK A;  2ES2 A;  2LSS A;  2VQF L;  3F1Z A;  3J80 c;  4B3T L;  1XPO A;  3RLN A;  1B8A A;  3HOZ H;  4K0K L;  3T1Y L;  4IJL A;  2CKZ B;  2JJQ A;  4R4Q A;  5IT9 c;  1XMO Q;  4DV0 Q;  1IBK L;  1XNQ Q;  5M5X H;  4DV2 Q;  4NXM L;  4LF6 L;  5IP7 H;  1PH6 A;  3GTK H;  4OWX B;  5C0X G;  1V43 A;  3TEH B;  3H3V I;  4YHH Q;  5JJK A;  2V1C C;  2YYZ A;  2UUA L;  3AEV A;  2D0O A;  4JV5 Q;  2PI2 A;  4JBK A;  1LTL A;  1KL9 A;  3F2C A;  1R9T H;  4B3S Q;  4JI5 Q;  1VQ5 A;  1NMF A;  3TS0 A;  2E2J H;  3RLO A;  4X66 Q;  4C3I H;  5JEA J;  1EQQ A;  1KRT A;  2CFM A;  2ZTE A;  4IPH A;  4P74 A;  5JEA G;  5GAE C;  5LMU L;  2B63 H;  3S17 H;  2GN5 A;  2EQS A;  1SMX A;  5K36 G;  1EWI A;  3CW2 C;  5M3F G;  1HZB A;  4AYB G;  3I7F A;  1JT8 A;  5GRO A;  1VCI A;  4A3L H;  4L5T A;  3E0E A;  2JA8 H;  1YI2 A;  2R92 H;  3MEF A;  3CCU A;  1XNR Q;  2Y0S G;  3M85 A;  1P16 A;  4TQU S;  2ODG C;  3NEL A;  4IFD J;  1G6P A;  3TS2 A;  3CC4 A;  4IFD G;  4KI0 A;  1A62 A;  1RL2 A;  3AQQ A;  2VUM H;  4A93 H;  1VQ9 A;  3K8A A;  4DV6 L;  4BXX H;  1LYL A;  4UP7 A;  1UE5 A;  3E9I A;  1GO3 E;  5FLX c;  4B3M L;  2Q2T A;  3A74 A;  1KXL A;  1I94 L;  5BR8 L;  1XTD A;  4A3I G;  4RG1 A;  4LF4 L;  1FJG Q;  1GVP A;  2GVB A;  3IRB A;  1C9O A;  2I5H A;  4GN4 B;  2ZM6 Q;  1H95 A;  2HJQ A;  1OTC A;  1YJW A;  3PIP A;  1VQL A;  1EFW A;  1K83 H;  1VQG A;  4DK3 C;  3FKI H;  4AQY Q;  4A76 A;  1BKB A;  5AJ3 Q;  4BA2 I;  1VQF A;  1YBY A;  1MJC A;  1WCM G;  3DLL A;  3RN2 A;  1YEZ A;  3J7Z C;  2UUB Q;  5M3M H;  4A3K H;  3J7A 5;  2ZTC A;  4MTN A;  1QVF A;  5EAY A;  3HFZ B;  4C3H H;  1K0R A;  2A19 A;  4A3E G;  3PIO A;  4NPS A;  4QIW E;  1YJ9 A;  1QVG A;  1EUJ A;  1SLJ A;  1X3F A;  2K4K A;  5C3E G;  1NJI C;  2WB1 E;  3S2H H;  2JA9 A;  4JI4 Q;  1VQE A;  4TVA B;  1VQ4 A;  3S1M H;  2UXC Q;  3ER0 A;  4P75 A;  3M4P A;  3PV0 A;  1Q8K A;  4P73 A;  4X64 Q;  2KHI A;  2MPH A;  4LF9 L;  4DR7 L;  2UU9 L;  2YV5 A;  3CCL A;  4RMF A;  4IFD I;  5IWA L;  3NEN A;  2LD7 A;  2WP8 J;  3K81 C;  3F8T A;  2F52 A;  2HQL A;  3CCV A;  1CSQ A;  4GOP B;  3K80 C;  3CCM A;  1SFO H;  1KIX A;  2IX1 A;  3GTG H;  4GKK Q;  4PZ8 A;  3S1N H;  3MXN B;  3I4N H;  2E5L L;  4DK6 C;  5IYC H;  5LMN L;  3HOW G;  4BBS H;  4BBR H;  4LFC L;  1Y02 A;  2NVY H;  1HR0 W;  1JB7 A;  1Z47 A;  2K5N A;  2Q2I A;  4JYA Q;  3H15 A;  2QA4 A;  3RN5 A;  1PFS A;  1MIU A;  1E1O A;  2A8V A;  5DLQ E;  2AHO B;  3UDX A;  4APV A;  4LFA L;  4JOI C;  1Z9F A;  4JI6 Q;  1B70 B;  1PYS B;  1NE3 A;  4R4T A;  1OXT A;  4L5R C;  1X54 A;  1Q1E A;  1IZ6 A;  2Z6K C;  4GNX C;  1V1Q A;  3BU2 A;  1OXS C;  4PG3 A;  1XNQ L;  3KDF A;  1Y1V G;  1J5E L;  3GTL H;  4JI3 L;  1SRU A;  3HKS A;  1YIT A;  4YY3 Q;  4DUY L;  1BBU A;  4JI0 Q;  4DNI A;  4HJ8 A;  1Q12 A;  4JI8 Q;  2JA5 G;  4JBM A;  2GVA A;  1BVS A;  1CKO A;  1Q82 C;  1GL9 B;  3FHW A;  1D7Q A;  1EIF A;  5FLM G;  4A3J G;  1CKN A;  4A3G H;  4NXN Q;  4ME3 A;  2R7Z H;  1L1O A;  1C0A A;  2AKW B;  2Z6K A;  2IHF A;  4DV7 L;  3J81 i;  1E7Z A;  3U50 C;  1QVC A;  3OYY A;  2KEN A;  1GM5 A;  1W3S A;  5IP9 G;  4X62 Q;  3W5O A;  3JAM c;  2VNU D;  5IYD H;  1HR0 Q;  2VL6 A;  1IBL L;  4X65 Q;  1Y1W G;  2G80 A;  2UXB L;  5GAD C;  2KCM A;  1VQO A;  3G48 A;  3KYH C;  4DV4 L;  2Q2H A;  4DUZ Q;  5IYB G;  3K0X A;  2KHJ A;  5IY0 A;  3U58 A;  3S2D H;  1TWG H;  4QY7 A;  1NMG A;  3PO2 H;  2ZTD A;  1HNZ Q;  3CC7 A;  4GLX A;  3S1Q H;  1AE3 A;  4GNX B;  2E2H H;  4DR5 Q;  1HZA A;  3WWV A;  4GKJ Q;  2ATW A;  4UP9 A;  4JI7 Q;  2K52 A;  2LXK A;  1I3Q H;  5FJ8 G;  1N32 Q;  2N78 A;  4PZ7 A;  1YHQ A;  1HNX Q;  4QL5 A;  3G71 A;  1Q86 C;  3PUV A;  1K8A C;  1XMQ Q;  4LF7 L;  3I4M G;  4A3D G;  3ULL A;  4LFB L;  1PVO A;  3PUZ A;  4AIM A;  4DPG A;  1D8L A;  4PMW A;  3HOY G;  4O0A A;  4IOA A;  5C44 G;  1N36 L;  4DR3 Q;  1HZ9 A;  2L15 A;  1MKH A;  4A75 A;  4DR6 Q;  2WB1 G;  2MQH A;  2Q2U A;  5H1S E;  1VQ6 A;  1OXU A;  1X3G A;  2UXD Q;  4A3C G;  2D0P A;  1K9M C;  3PF4 A;  1DGS A;  1GKU B;  3GTM H;  4B3R Q;  1YNS A;  4ALP A;  1U0L A;  4LNQ A;  1WJJ A;  2K14 A;  4DR1 L;  2IX0 A;  2KFV A;  1PH5 A;  3M7N A;  3CCE A;  3PF5 A;  3S15 H;  4H02 A;  3M4Q A;  1VQB A;  1TWF H;  3HKZ E;  2ZJQ A;  2N49 A;  5M3F H;  4DR4 L;  1PH7 A;  4OXP A;  3S24 A;  5HY6 A;  2VQE Q;  4BY7 G;  3CXC A;  1V9P A;  1A8V A;  2WFW A;  1ASY A;  3BJU A;  1X55 A;  4KHP Q;  1FGU A;  2MNA A;  5IP7 G;  1EOV A;  2NZH A;  4IO9 A;  3CD6 A;  1IL2 A;  3M9B A;  2JQO A;  4GOP C;  2OTJ A;  1PH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...