1A62A

Crystal structure of the rna-binding domain of the transcriptional terminator protein rho
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the RNA-binding domain from transcription termination factor rho.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transcription termination
molecule keywords RHO
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07497 Rho_RNA_bind Rho termination factor, RNA-binding domain
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a62A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a62A02
5J3BA 4QIWE 2K14A 4X64L 3CC4A 1G51A 5AJ3L 2IHFA 3S2DH 2IT1A 2UUBL 2R6GA 1E7DA 5FJ8G 5M3FH 4WJ3M 4XIGS 5C4XH 1K3RA 1HJPA 1PA6A 4QGUA 3CCSA 5IYDH 1QVCA 4A75A 4AQYQ 3L2PA 3RN5A 4A3MH 3SGIA 2GVAA 3GTMH 1N32Q 3FKIG 1PH8A 2UXBQ 4JI3Q 1XTDA 2UXDQ 4R4TA 2FXQA 1TWGH 2ID0A 3KDFB 3NELA 3U50C 5C3EG 1NBWA 4GKKQ 4A3FG 3HOWH 4GN3B 1X65A 1Y1WH 3DM3A 1N36L 2VUMH 2K5VA 3KJOA 4POGA 3PF4A 4JG2A 5C4XG 1IBKL 4KLKA 4R4OA 1KAWA 4WJ4A 4A3KG 2NVQH 1WCMG 1XNRL 1E1TA 3GTQH 1CKOA 5JJKA 1UEBA 2EXDA 1XPRA 3CW2C 2Y0SE 1V1QA 5IP9G 2OTLA 4LF8Q 2BH2A 3BZCA 2D0PA 4J15A 4UP8A 1VQKA 2UUCL 2RCNA 3CD6A 4JI3L 4A3BG 2UXDL 1SMXA 1YJNA 4LW1A 2AWOA 4TQUS 4HJ5A 2K52A 4BBSH 4A3MG 2JEAI 4NXNL 1N9WA 5IYCG 3E9HA 5IYBG 3PUYA 1M90C 3TS2A 4RMFA 3T1HL 4QQBX 5GADC 2I5MX 2JA8H 2AMCB 5M3MH 2GN5A 5IY0A 2ZJPA 1E24A 1HR0L 3UDFA 3KLWA 3TREA 2BA1A 4JI1Q 1XNRQ 5EAYA 1U0LA 1YZ6A 2JEBI 1OXXK 1EQQA 4HIKA 1NJIC 1PH9A 1XNQL 1LTLA 1VQIA 3HOUH 4YCWA 2JA7H 4R4QA 4LF9Q 1YJWA 3KJPA 1MJCA 2RF4A 5FLMH 1JB7A 2JA5H 2B63H 1YVCA 2ZTCA 4A3EH 1XMQL 1Q81C 1D8LA 4DUYL 1HR0W 1OXTA 5IP7H 4HIDA 1I94Q 1UE5A 1VQHA 2R93H 5GROA 2I5HA 1YHQA 2OCEA 4OWTB 3JC66 1L2FA 3S1RH 4DR7L 4YY3L 3PUXA 4LUVA 2NN6G 2Z6KA 4P75A 3CF5A 4JBMA 2NN6I 2N49A 2KCTA 3KFUA 1EN7A 2IX0A 2NVTH 3KYHC 3I4NG 3G6EA 1VCIA 2LXJA 3ULPA 2R7FA 4AH6A 1IBLQ 5C0XI 2B29A 4OONA 1X3FA 1M1KC 1VQOA 1N33Q 1MJEA 2CWAA 4A76A 1K83H 1ASZA 4Y52H 3CMAA 4DV5L 2JA8G 2UXCQ 1YHAA 2KHJA 2OQKA 4NXMQ 3L0OA 3JAMi 4IFDG 2WAQG 3I4OA 4X66Q 4DV3Q 4A3JH 4C3JH 1W2BA 3GTKH 1CSPA 2XTIA 4JI8L 4X65L 3BZKA 3CXCA 2JA5G 1VQLA 4YY3Q 4IOAA 4DK3C 4IOCA 1Q7YC 4A3EG 2CCZA 3CC2A 2R93G 3BU2A 4DV0Q 1EIYB 1B70B 1X6OA 2JE6I 4LF6L 3RZOH 3GO5A 1IBLL 5C0XJ 1JE5A 5M3MG 4BA2I 4C3IH 2WB1G 3F1ZA 1HZAA 2NVYH 2VL6A 1KRTA 3PUVA 4IO9A 1N33L 3J80c 3CCMA 1IBML 2NZHA 4NB3A 1VQJA 3F2BA 1BKBA 1AE3A 3I4MG 1GO3E 1WFQA 2RHQB 4OWWB 2HHHL 5BR8Q 2VZAA 4A3DH 1TWAH 4P72A 3W1BA 5GAHC 2VQFQ 2UU9Q 4BY7H 3S2HH 2I5LX 2K50A 1SR3A 4JV5L 3PGZA 1K8GA 1AE2A 3M85A 1VQBA 3T1YL 1VQ5A 2V1CC 2UXBL 4JBWA 3HOZG 1IL2A 5ELNA 1R9TH 4JI4L 3J81j 3PF5A 5DLQE 2F4VQ 5H1SE 1A63A 2QGQA 3AFPA 4MTNA 4A4IA 4UY8C 1HZBA 4L5RC 3A74A 4GS3A 1SN8A 5LMNQ 4JI0Q 1WJJA 2DUDA 3PIOA 1HNZQ 3M9BA 1HH2P 4YWKA 4X64Q 3IRBA 5C0XG 4YHHL 1IXRA 2VQFL 2VQEQ 3GTJH 1Q86C 2Z0SA 4JBKA 4IFDJ 4HJ8A 4B3TQ 3FP9A 3M7NA 2IX1A 2R7ZG 4JI2L 3T1YQ 2UUCQ 3G71A 4JI6Q 1YIJA 2YU9H 1OXSC 4NPSA 4DPGA 1N32L 4B3RL 1SLJA 4JI5L 2WFWA 1SE8A 5GAGC 5C44G 1J5EQ 1C0AA 2CWPA 1J6QA 1PYBA 4BBRG 4GN5A 2ZM6L 2LXKA 3A5UA 1GM5A 3H0GG 4YWLA 1P16A 3STBD 4LF4L 4LWCA 3CAMA 1N36Q 3PUZA 1K0RA 1WI5A 1KL9A 1BBUA 1PH5A 1MKHA 2PQAB 5M5WH 3G48A 3K81C 1A62A 5FJ8H 5M3FG 2R7ZH 1KHIA 1PHJA 1L1OC 4HIOA 4C3HH 3J7ZC 1EWIA 1QZGA 1NMFA 3D31A 4KHPL 3HOXH 1QZHA 5M5XH 1EYGA 3PSIA 1Q82C 2E2JH 1V43A 1VS0A 4LF9L 4DAYB 2JA6H 3PO3H 2B63G 2E5LL 4DUZQ 3STBC 1YEZA 3M4OH 2H5XA 2WAQE 2E2HH 4IPGA 1C9OA 2C35B 4YCUA 3HOUG 4BXXG 1J5EL 3RNUA 4JBJA 1H95A 4DR7Q 2VW9A 4LF4Q 1S3OA 4IPHA 2N3SA 1VQAA 3H15A 1EUJA 3OW2A 2MQHA 3ERSX 1LYLA 3L7ZC 1QUQA 3NENA 5ELOA 2ES2A 1CSQA 1SFOH 1S40A 1YHBA 1L0WA 3I56A 2N78A 4OX9L 2LSSA 4JOIA 4JI1L 4GLVB 1E7ZA 1C7YA 3KF6A 4A3BH 3HOYH 1UE7A 4P73A 3J80i 4DV5Q 4O0AA 2E5LQ 1AH9A 2UUAQ 1EIFA 4A3JG 1NE3A 2WB1E 1VQ6A 3HOXG 2KCMA 4APVA 2F52A 2IHEA 2K5HA 4JI8Q 4X65Q 3PIPA 4LFCQ 3TRZA 4DV4Q 5IP7G 2L15A 2OWOA 3TEHB 4A3LG 1PVOA 2DGYA 5HY6A 1UWVA 3ER0A 2K5NA 3TS0A 1G291 4K0KL 1NY4A 3KF6B 3W5OA 3K7UC 2KENA 5LMUQ 5K36G 1UE6A 2VUMG 2CQOA 2JA9A 1YBYA 4PG3A 4GNXA 2YTYA 1Y1VG 4HJAA 4OXPA 4BBSG 1UE1A 3AYHB 2R92H 2VS1A 1O7IA 1VQEA 1VQ9A 3I2ZA 2F3IA 5AJ3Q 1X3EA 4DV2L 2R7DA 2QEXA 1E1OA 3S1QH 2K75A 4IPDA 3CCUA 1KXLA 2JA7G 4IFDI 4GN4B 4LUOA 3M4QA 1KQSA 2YYZA 3E9IA 3Q8DA 4X62L 4GOPB 3NBHB 1K73C 1FJGL 2F4VL 3I4NH 5LMUL 3VDYA 4A3KH 1Z47A 1HZCA 3PO2H 4R4IA 3B6YA 4A3IH 4A3CH 2BH8A 4JI0L 1FL0A 1VQCA 1Y14B 3M3YH 4DR6Q 2K4KA 3GTLH 1HNWQ 4DK6C 1IBKQ 3FHWA 1YNXA 1BBWA 3F2DA 1HNXL 4JYAQ 1Q8KA 3AFQA 2A19A 4DV2Q 5JEAG 3K80C 4PZ6A 3UDXA 2VQEL 3RLFA 3CCRA 2HHHQ 3ICEA 1GVPA 3UE0A 3OTOL 4DV7L 1RIPA 1WOCA 4O2DA 4B3TL 4BY7G 1IYJB 1PV4A 4JI6L 4JV5Q 1QUQB 3LGJA 3MEFA 5LMNW 3CCJA 4JI4Q 1PH6A 3DLLA 3UDIA 4LF8L 4BXXH 1VQMA 2IY5B 1KIXA 1VQFA 5HGQA 3PUWA 4UPAA 3W1GA 3J81i 5C4JH 4LFBL 4DR2Q 2HT1A 5E7NA 2QNCA 4DR3Q 3T1HQ 1G6PA 4LF5Q 1HNXQ 1QVFA 1TWHH 4IPCA 1SROA 4A93H 1VQNA 3WWVA 4AIMA 1HNZL 1NTGA 3ULLA 2D0OA 4A3GH 3UDGA 4KHPQ 4QY7A 5M5YH 3EN2A 2OQ0A 5IWAQ 3OTOQ 4DV7Q 1YITA 4HJ9A 3HOZH 1OXVA 1N8RC 1I6HH 2Q2TA 3KDFA 1HZ9A 2YV5A 1BVSA 4RG1A 1YJ9A 2N8NA 1XMQQ 5IYBH 4B3RQ 4DUYQ 1JJCB 1Y1VH 5IE8A 2WP8J 2E2IH 3RN2A 4LNQA 4DR4Q 1Y1WG 4DR2L 3S15H 2ATWA 2BA0A 4JC0A 4KHZA 4ME3A 1I94L 1ASYA 3H3VI 4GOPC 1EQRA 1LUZA 2B3GA 4PZ8A 4LF7L 1JJ2A 3UE1A 4H02A 5IWAL 1PH7A 1CKNA 4L5SA 2PMZE 2ZJQA 3U4ZA 1VQ4A 3TQYA 2JA6G 2VY3A 4L5TA 3CMEA 1FGUA 1CUKA 3U58A 4Y7NH 4PMWA 4EX5A 5C3EH 4B3SQ 2MO0A 1XPOA 4IJHA 3CCVA 4DV3L 3GDEA 4DV4L 4C2MH 4YWMA 2HQLA 2Q2HA 3AQQA 2UXCL 2GVBA 4QL5A 4NXML 3RLOA 1EFWA 3ULJA 2UUBQ 4X66L 3F2CA 3S14H 2KBNA 1IZ6A 3I4MH 5IYDG 3RLNA 1A8VA 1PH2A 4LF7Q 2AWNA 4DR5L 1JJGA 5GAEC 2A1AA 4LFAQ 3HKZG 4BY1G 1N34L 3CCQA 1TWFH 3CPFA 5C44H 1NMGA 4GKKL 4DR1L 4EQ5A 4LF6Q 4X6AH 1I5FA 1SRUA 2JK8A 1B7YB 2UU9L 2ZTEA 4B3ML 1X54A 2MNAA 3I7FA 1WCMH 3J7A5 2MFIA 5FLMG 3EBEA 2JQOA 2KHIA 3J81c 2VNUD 2CFMA 2NZOA 4A3GG 1CKNB 4AYBE 3GTPH 2PQAA 4GNXB 3S16H 3PV0A 1KC8C 4A3IG 1W3SA 2YTVA 3E0EA 4HJ7A 4DR5Q 2PI2E 1E7LA 1JT8A 1K9MC 3HOYG 1X56A 1N34Q 4LFAL 5GQOA 1T9HA 1I3QH 1L1OA 3JAMc 1PH3A 1Q1EA 1TXYA 2QNFA 5JEAJ 3FKIH 3CC7A 1K8AC 4DR1Q 4JYAL 1Q12A 2D62A 1QVGA 4NXNQ 3NEMA 1U5KA 4DKAC 4GLXA 5LMNL 3CCLA 1X3GA 3D0FA 4GKJL 1E3PA 4YHHQ 1HR0Q 3HOVH 3K8AA 2OTJA 1L1OB 1Z9FA 4GLAC 1FJGQ 1MIUA 4P71A 4X62Q 1RL2A 1EOVA 4QJFA 1LM0A 2CKZB 3U4VA 1PFSA 4DAMA 4JI2Q 4AYBG 2Z6KC 1PYSB 1Q46A 3PO2G 3G4SA 4UP7A 2QA4A 4A3CG 4A93G 1P8LA 4DR3L 2PI2A 1WYDA 1XMOL 1VQ7A 4JI5Q 4POFA 4DR6L 1S72A 2ZM6Q 1GKHA 3PCOB 4A3LH 2NVXH 3GD7A 3HKSA 3CPWA 3I55A 1XJVA 3KOJA 5IYCH 3K0XA 3GTOH 4TVAB 2A8VA 2AHOB 1VQGA 4GKJQ 1KD1C 1XPUA 1I50H 1DGSA 3F8TA 1X55A 1YI2A 3HKZE 2R92G 4A3DG 4BBRH 4DV6L 4HIMA 3CQZH 4R4CA 2HIVA 2YTXA 4LUZA 1XNQQ 5IP9H 2EQSA 1E22A 1TWCH 2AKWB 3BJUA 1FVIA 4DUZL 1X9NA 4DV1L 3A5ZB 3M4PA 3CP0A 4FDBA 2JJQA 3S24A 2HJQA 1XMOQ 4LFBQ 1B8AA 2ASBA 1D7QA 4ALPA 4LF5L 4OO1G 2Y0SG 1A0IA 4MZ9A 3H3VH 4L5QA 2RHSB 5IT9c 1HNWL 4DV0L 3HOVG 2MO1A 3OYYA 3HFZB 4JI7L 4DV6Q 4IJLA 3S1NH 2E8GA 2I0QA 3CCEA 4MNOA 2UUAL 2Q2IA 4OX9Q 4UP9A 4A3FH 3HOWG 4KI0A 4JCVE 3EIVA 3A0JA 4PZ7A 4JOIC 1VQPA 2ALYB 4YCVA 2EIFA 3RR5A 4DV1Q 3K7AH 5BR8L 1KRSA 1PH1A 1V9PA 2ZTDA 1OXUA 4BA1I 4DNIA 3AEVA 4DR4L 1VQ8A 4LFCL 1GD7A 3PO3G 1PH4A 4R1JA 1JMCA 3H0GH 3ZJYC 4OO1I 2ZJRA 4BY1H 4AQYL 1Q1BA 2PNHA 4K0KQ 3GTGH 3KF8B 4OWXB 4JI7Q 3S1MH 3MXNB 5JJLA 4GOPA 4XTCS 2XGTA 3RZDH 5FLXc 1CKMA 4B3MQ 4P74A 2Q2UA 1VQDA 2HIXA 3S17H 5JJIA 4B3SL 1OTCA 4GNXC 1IBMQ
chains in the Genus database with same CATH superfamily
5J3BA 3CC4A 4DN4M 1H9EA 5AJ3L 1EOTA 4Q0FA 5M3FH 3L9AX 5C4XH 3JAML 1XX8A 3RN5A 3GTMH 2AUKA 4R4TA 2FXQA 2CHBD 1AZQA 4GKKQ 4GN3B 1BR9A 1Y1WH 1PTOH 1PLFA 3VYUA 3PF4A 1BDOA 3JAME 1GOZA 4KKSA 1H9SB 3GTKB 3MXNA 1XPRA 2OTLA 2V4DA 1SNCA 2RCNA 3KLSA 3HOUB 4HCEA 1SYGA 4LW1A 4WJWA 2JEAI 3DUZA 1TT2A 2XN9C 1M90C 3T1HL 4Z9CB 4BS9A 1TWHB 2I5MX 1HXYD 1SXTA 4R8IA 1HR0L 1XNRQ 1H9FA 5EAYA 2JEBI 4DF7A 3M3YB 4RA8A 4C1NK 1Y1VB 4R4QA 4ZUJA 2KECA 2JA5H 3LWUA 4DUYL 5IP7H 4XT1B 3K59A 5GROA 2OCEA 3OPOA 4OWTB 3JC66 2EYHA 5ELDA 1ET6A 4YY3L 1ONLA 4CDCC 4C3JB 2QILA 5A2QE 4IFDH 5CORA 3ULPA 2R7FA 4AH6A 2TMPA 4IZ8A 4OONA 1M1KC 2K01A 1VMPA 4C2MB 2K33A 1K83H 4A76A 4PMBA 2DY8A 1Q3LA 1DOKA 2UXCQ 1YHAA 2KHJA 3JAMi 3SR1A 2WAQG 2O5IC 1W2BA 4A3JH 4O42A 1NUCA 3BZKA 2F0LA 3CXCA 2JA5G 2I46A 2J7ZA 3HS0C 2K5DA 4DK3C 3J7YW 1C8CA 2F0VA 4BBSB 3K58A 5C0XJ 4BA2I 4ODGA 4C3IH 3F1ZA 1N33L 4MN3A 3PUVA 3J80c 2KEEA 4KY6A 4C3HG 1ET9A 1LV9A 5EKKA 2LFNA 4A3DH 5GAHC 2D9UA 3S2HH 2EJFC 4JV5L 3PGZA 3M85A 2V1CC 4JBWA 3HOZG 1IL2A 5C3EB 2F4VQ 1R4PB 3AFPA 4IUPA 1CQFA 4MTNA 4A4IA 1HZBA 1JEQA 2CH4W 3BDOA 4GS3A 4OGQC 4TKOB 4EQOA 5EJWA 3PIOA 2A74C 2F0GA 1Y8NB 2LC3A 1HNZQ 3M9BA 1HH2P 5C0XG 3IKJA 3IRBA 1EEFD 1IXRA 2RBMA 2A6HC 2M9VA 3UI2A 4UAIA 4JBKA 1V1PB 1WTPA 4B3TQ 3M7NA 3T1YQ 2MP1A 4F88A 1YIJA 2YU9H 3TP8A 1SLJA 4OIKA 2WFWA 1C0AA 2ZM6L 3A5UA 1GM5A 1P16A 4LF4L 1CQVA 4LWCA 2E2HB 5NUCA 1XYIA 2RSOA 2R7ZH 3G48A 3K81C 1A62A 1WTHA 5FJ8H 1I50B 1PHJA 4I7AA 3U9SA 2D5DA 4ABNA 1EWIA 4C3HH 3J7ZC 1NMFA 3EROA 4K2LA 2EDGA 3STBC 1TIID 5G3LD 2H5XA 2DNEA 4YCUA 2WACA 1H95A 1MSGA 2VW9A 4YIJA 4FP5D 1F9QA 3NENA 2F0KA 5ELOA 5FLXE 5CV9A 1IKLA 1YHBA 1W6JA 3I56A 2N78A 2C5CA 4JI1L 1E7ZA 1E2VA 1C7YA 4XXEA 4A3BH 2IPKD 2E5LQ 4IALA 4O0AA 1PMRA 1O78A 1VQ6A 2WB1E 4IQZA 1A2TA 2KCMA 4APVA 2F52A 2IHEA 4DV4Q 4X3TA 1LTRD 3KF6B 3W5OA 1TR5A 1UE6A 3OWFA 2CQOA 5EKIA 4HJAA 1ZXTA 2VS1A 2L12A 4J1MA 2F3IA 4DV2L 2L4NA 4NP5A 1PDQA 1E1OA 2KFVA 4KY7A 1LLRD 3IL8A 5D65A 5BN4A 2JA7G 4KD3A 1X3PA 1BOSA 2VB2X 3M4QA 2F4VL 3I72A 2VB3X 5E1FA 3NE5B 5KYLA 1ENCA 1F2ZA 1HZCA 5LHY1 4R4IA 4A3CH 1SYBA 4G57A 1ZYRD 1MSHA 1HNWQ 1IBKQ 1CT1D 4JYAQ 3AFQA 5FO9B 2VUMB 4A3EB 5JEAG 3UDXA 4PZ6A 2HHHQ 3KFUA 3RLFA 2X6LA 4HSVA 1GVPA 4B3TL 3OTOL 2GA4B 1PFBA 1PV4A 2F0HA 1MGSA 3LGJA 3MXPA 4PNYA 4TRDA 1EQTA 3NUCA 5KIXA 4E6IA 1VQMA 5HGQA 4UPAA 5C4JH 2HT1A 4DR3Q 1G6PA 3MHBA 4HEDA 5C5MA 3WWVA 3H91A 5CR3A 5IWAQ 4DV7Q 1YITA 1OXVA 5M3MB 4L8JA 2Q2TA 2YV5A 1PTOB 2XWBB 1BVSA 2WINB 1GJXA 2IWHA 4B3RQ 2OEOA 1JJCB 5IE8A 1EY9A 2LS01 1QNUA 3C1FA 3EA6A 2B63B 4A3GB 2K03A 1AP0A 2ATWA 4X3UA 3DWQA 1ASYA 4ME3A 5IOCA 4GOPC 4K5XA 3X3NA 5KGUA 3PIP3 4N8FA 4H02A 3UE1A 4IUTA 5CV8A 2PMZE 3E6ZX 3SK6A 2ZJQA 3MFGA 3TQYA 2JA6G 2XIWA 3Q6SA 1CZGA 1GUGA 4PMWA 4Y7NH 4B3SQ 3I8ZA 1XPOA 4DV3L 4DV4L 4YWMA 2HQLA 2Q2HA 3QB3A 2UXCL 5DAUA 3OSOA 4QL5A 3RLOA 3ULJA 2UUBQ 4FF4A 3F2CA 4G7ZC 2AQ2B 2F0QA 1PFNA 3ERQA 1D1IA 4DR5L 4RHRA 1GUSA 3VYRA 1IYVA 2A1AA 3TP7A 3CCQA 2RKSA 2NTSA 2KJXA 3FPUB 2L5TA 2F0IA 1Y8PB 4N9TA 2UU9L 2ZTEA 1WCMH 2K6AA 1W6KA 1ZKOA 2NZOA 4ILWA 3BDLA 4N9PA 3PV0A 1JB3A 1K83B 3E0EA 1JT8A 2PI2E 1K9MC 1A3UA 4OO1H 1TXYA 2QNFA 4JYAL 2D62A 1QVGA 4NXNQ 1GHJA 3NEMA 1IKMA 5I6YA 3CCLA 4QUFA 3VR3A 1EYDA 1DOMA 2OTJA 1L1OB 4P71A 4H7BA 5I6WA 4OHJA 1EOVA 3FKIB 1RD9D 2KQ3A 1CFMA 4NW2A 5CIUA 1Q46A 3PO2G 4HAEA 4DR3L 4KV6A 4POFA 2XRSD 2ZM6Q 3PCOB 3CPWA 1BCPD 2MPHA 5EQ0A 4UHVA 4XYOA 3K0XA 3GTOH 4TVAB 1BF4A 2L9HA 1PYWD 3MFYA 2B2VC 4FXKC 4BBRH 2PCFB 2HIVA 4RGOS 4LUZA 3I4LA 5IP9H 1SBBB 5C5LA 4FDBA 3DM1A 1QOHA 1B8AA 2ASBA 3MTSA 2WAQB 4LF5L 4OO1G 1K8MA 4DV0L 2MO1A 4DV6Q 2Z9HA 5TSSA 2Q2IA 4PMCA 4A3FH 3GTGB 2NZ1D 1VQPA 4DV1Q 2EIFA 4M1UB 1PH1A 3TN2A 4DR4L 1VQ8A 1LTTD 3QKJA 2F0JA 1PH4A 1JMCA 3H0GH 2HDLA 2QDBA 4OO1I 1Q1BA 2HUGA 4EQPA 4OWXB 2EYPA 4JI7Q 1F2LA 1O80A 4J8QA 4GOPA 4R9WA 1CKMA 4MTKA 2Q2UA 2HIXA 3S17H 1OTCA 4CKEA 1IBMQ 4X64L 1TY2A 1E2ZA 3DMUA 1TY0A 3CQZB 2IHFA 3S2DH 5JAVA 5KNCA 1B4OA 4K14A 4XIGS 1K3RA 1PA6A 2ICEC 4QGUA 3S1MB 2Z6BA 1QVCA 4A75A 1N32Q 4A3MH 1UAPA 2GVAA 2DN8A 3A8IE 3FKIG 4JI3Q 2F0UA 2UXDQ 3GV6A 4RHSA 2ID0A 5C3EG 3KDFB 1I6HB 1JORA 1JOQA 1N36L 4CBVA 3Q0AA 4POGA 5C4XG 4F87A 1IBKL 1M8AA 2E2IB 4WJ4A 4A3KG 4DNTB 1YNNC 1E1TA 1UEBA 2IJ0A 2XRQD 2BH2A 3CW2C 1V1QA 5IP9G 1EU3A 1HQMC 2UUCL 4O1NA 4CDEC 1LT3D 3IFDA 1RDPD 1HUMA 1EY0A 2K32A 1FYCA 2AWOA 4TQUS 4DXGA 4A3MG 2JA5B 2NVQB 3NHHA 2BDNA 2KVDA 4CJ0B 1SE2A 2EZVA 2K28A 2B2TA 3M4YA 1Y8OB 5I2YA 2ZJPA 3A7LA 4RCOA 5M5YB 1SDFA 2R61A 1PH9A 4HIKA 1IL8A 1LTLA 4YCWA 1AEXA 2A68C 1XXGA 3KJPA 5FLMH 4A3EH 2MHVA 1Q81C 1OXTA 4HIDA 1UE5A 3LLRA 1VQHA 5KNBA 1BNZA 3S1RH 2A68D 1F2YA 1L2FA 1UNSA 4LUVA 4JBMA 2Z6KA 1EFID 5FO8B 2KCTA 3KYHC 3HOWB 3G6EA 2LXJA 1IBLQ 5IODA 3VR2A 1VQOA 1MJEA 3KBGA 1DXMA 1ZBHA 2CWAA 3SEBA 2QKIC 3CMAA 3BDCA 3S9WA 4RFBA 3RMHA 3J80E 4CDFC 4IFDG 4DV3Q 5I4DA 3NWTA 3T53B 5IIFA 4IOAA 3BYYB 5IGEA 4IOCA 4L6TB 1Q7YC 3CC2A 3BU2A 3NXWA 1X6OA 4DGZA 1LO5D 1STNA 3AB9A 3CCMA 1IBML 1GUOA 1VQJA 3F2BA 3NK9A 3I4MG 1WFQA 4H0LC 2EVBA 4OWWB 4P72A 2UU9Q 2VQFQ 2I5LX 2RNOA 2K50A 1SR3A 2NVXB 3D4RA 4QIWB 4Y7NB 4JI4L 2Q8RE 1JQYD 5CV5A 3SK4A 5H1SE 1BCPB 3NPPA 1V1PA 2CQAA 2YU9B 4F8MA 5C6AA 5LMNQ 1VF5C 2ZXPA 2E75C 4YWKA 1B9NA 2PYKA 3URYA 1HFGA 2ZXOA 1C48A 1LT5D 4IFDJ 4EGVA 4JI2L 2UUCQ 4JI6Q 4NPSA 2HCIA 4DPGA 1IYUA 3W3AA 2EYOA 5IT9E 5C44G 4BBRG 2LXKA 4YWLA 1I4RA 3LNNA 3STBD 3PUZA 2B2TC 1KL9A 4KKTA 1TS5A 5M5WH 5M3FG 1KHIA 1HA6A 4RKLA 4KHPL 3D31A 5L37A 1QZHA 1D2BA 1V43A 1SNDA 2B63G 5ISRA 2RVLA 2JYOA 2WAQE 1EZ8A 4JW0A 1C9OA 4ZUIA 2F0MA 4CDDC 3HOUG 1KAAA 1J5EL 4BXXG 3RNUA 3HGBA 1S3OA 1S5ED 5ELFA 1O7ZA 1VQAA 3TMEA 3H15A 1EUJA 3OW2A 4X3KA 1LT4D 1SE4A 2ES2A 1F9SA 1OO9B 4OX9L 1TS2A 2H1EA 2Z4IA 4JOIA 5J39A 1GUTA 3KF6A 1AH9A 3DEOA 4B9WA 2EE1A 1AFPA 3LX0A 4LFCQ 1ESRA 2JN4A 3GTOB 3SK5A 1TWGB 2SDFA 3L3OC 2L15A 2KVMA 4A3LG 1PVOA 2DGYA 5JPMC 1UWVA 3TS0A 5DNFA 1H1JS 4K0KL 1NY4A 5J22A 4WRDA 3K7UC 5LMUQ 1HHVA 1I4XA 2C9OA 2JA9A 1I4GA 1VF7A 1WVLA 2E74C 4PG3A 2YTYA 1Y1VG 3NTIA 1S4ZA 5K5PA 4OXPA 3KBXA 3AYHB 2R92H 1O7IA 2K7VA 1STEA 1SNMA 2PMZB 3I2ZA 4QMGA 2OXPA 1ZYRC 2Q8IB 5M3FB 4KJOA 3CCUA 5C4XB 3PO3B 1JWUD 2YYZA 1K73C 4A3FB 2G80A 1JWSD 3A55A 3VDYA 4A3KH 2JA8B 1Z47A 1YNSA 3B6YA 5CC4A 1TVXA 3QIAA 1SJED 1H9RA 1RODA 1Y14B 2K4KA 3GTLH 3D4DA 3FHWA 5EBDA 1ENFA 1BBWA 2DY7A 5JPNC 1Q8KA 2A19A 3CRKC 2A69D 3OIQA 1KDAA 1KDBA 3UE0A 4BY7G 4JI6L 4JV5Q 1KDCA 3J7AV 3EJIA 3CCJA 5DEHA 1QE6A 4NDXA 3DLLA 3UDIA 4BXXH 5EGTA 1VQFA 3J81i 3S2DB 4DR2Q 5HGTA 1QVFA 1HNXQ 1TWHH 4IPCA 1VQNA 1HNZL 4KKUA 3ULLA 2D0OA 4A3GH 4KHPQ 1ESFA 4QY7A 1HRJA 2WIIB 3I73A 1SYDA 2OQ0A 5E4XA 4HJ9A 1EEID 2K05A 4DXFA 3HOZH 5D3IB 5JJZA 1I6HH 5EBCA 3KDFA 1HZ9A 5ELCA 1XMQQ 3FEWX 1SE3A 2E2IH 2K5WA 2NWGA 2WP8J 4RGMA 3RN2A 4JK1C 2KCCA 2BA0A 3SE0A 2A6HD 2WQGA 4U673 2AQ3B 2B3GA 4PZ8A 4RH6A 1NR2A 1B44D 1PH7A 1CKNA 1GXDC 4L5SA 3U4ZA 2NVTB 2KUMA 1BQQT 4L5TA 3CMEA 1CUKA 3U58A 4EX5A 2OT2A 4IJHA 3NWSA 3TZDA 4FF1A 2GVBA 1H9JA 3I4MH 2FINB 2QF7A 4LF7Q 3C46A 3K5OA 5GAEC 1TWFH 3CPFA 5C44H 4HMJA 2SEBD 1AN8A 2IL8A 3NTKA 2JXMB 4RAUC 4EQ5A 3BVGA 1I5FA 5FKAC 1I4QA 4KMUC 1E2WA 1KTKA 1G6ZA 1TWCB 1S5FD 2MFIA 2P5ZX 3J81c 3A54A 2FJ2A 2PQAA 4GNXB 1TS4A 4A3IG 1W3SA 2YTVA 1A15A 4HJ7A 1E7LA 1MI2A 1X56A 1N34Q 4LFAL 5J1ZA 1I3QH 1L1OA 1PH3A 3BYTB 1IW7D 4BWGB 3FKIH 3CC7A 2JA6B 1DOLA 4DR1Q 4GLXA 3IAYA 5LMNL 2O4XA 1HTLD 4GKJL 1WTWA 2LKVA 3HOVH 3K8AA 2KEDA 4GLAC 3TBIB 1Q90A 2CKZB 4JI2Q 3G4SA 4K5WA 4OL7A 2PZTA 2PZUA 2QA4A 1WYDA 1XMOL 2AUJD 1GKHA 4A3LH 2DJFC 2NVXH 3GD7A 1XJVA 2ICIA 3KOJA 1VQGA 2F0WA 1SNOA 1Z6HA 1S5DD 1ILQA 1EIGA 1KD1C 1XPUA 4A3DG 1GL9B 2WV6D 1DONA 1JOOA 1MD2D 5D14A 1XNQQ 3A8JE 2AKWB 1X9NA 3M4OB 3A5ZB 3CP0A 4K2KA 2NBFA 1G91A 2JSOA 3S24A 3K5LA 1HA5A 1SYEA 1D7QA 2NTTA 4ZKBB 4MIUA 5CMDA 2A69C 1Y1WB 4L5QA 2RHSB 1LT6D 3BVZA 5IT9c 3S1QB 2EYMA 2CW0D 5DM63 3S1NH 4V0BA 2UUAL 4OX9Q 3WDNA 3Q23A 3HOWG 2EY6A 1B1ZA 4JCVE 2B2UC 4IUUA 3PO2B 2ALYB 3RR5A 2EPBA 4BITA 5BR8L 1KRSA 4A3IB 4DNIA 3R3OA 3AEVA 4LFCL 3PO3G 1EIHA 5JOBA 2ZJRA 4BY1H 2ENBA 1T5EA 2PNHA 3MA2B 4K0KQ 2NUCA 1H9SA 3S1MH 3MXNB 2A6EC 3VYSA 4QB4A 2BOSA 4B3SL 1JICA 4LMQD 5C0XH 2K14A 4C1NI 3WOEA 1BO0A 1MBYA 2IT1A 2UUBL 1JWMD 1FNWA 1HJPA 3K0YA 3H09A 5IYDH 4AQYQ 4FO2A 1EU4A 2G5DA 5IGFA 4DK0A 4ZLTF 1PH8A 1YNND 5DM73 1TWGH 3P7JA 3NELA 1B2TA 1RKNA 1NBWA 2IW3A 2MPMA 4A3FG 1WTQA 1X65A 1U4RA 3DM3A 2VUMH 2PQEA 2XWJB 4DAPA 1A3VA 4R4OA 3V96A 3A7AB 2NVQH 5FO7B 1XNRL 3R8BA 3GTQH 1CKOA 1XTCD 1KLGD 2EXDA 3D6WA 3I70A 3K7AB 3GQBA 3BZCA 4UP8A 3OMCA 3NSWA 1SMXA 1CHQD 4KK7A 1YJNA 2ODGC 4BBSH 1K3BC 4NXNL 3E9HA 3PUYA 5GADC 4A3KB 2AMCB 2JA8H 5M3MH 3OIPA 3S1RB 3DXJC 1E24A 3TREA 1U0LA 5KRUA 1XNQL 2KA7A 1EQQA 1NJIC 1B50A 1VQIA 1K8OA 2J4XA 1NSNS 2JA7H 1EYCA 4LF9Q 2F1MA 1YJWA 1B3AA 2B63H 1IW7C 2ZTCA 1XMQL 1D8LA 1HR0W 1LABA 1I94Q 2R93H 1YHQA 3BZDB 3PUXA 1B9MA 2NN6G 4P75A 4KTAA 2L11A 2NN6I 5FOBB 2B39A 3I4NG 3CU7A 3T13A 1QB5D 5C0XI 2O5JC 3GTPB 1X3FA 4UZWA 2G9HD 1N33Q 5G3LF 2OF1A 3N6RA 4U68A 4Y52H 2KVUA 4KN7C 2OQKA 3I90A 2M00A 4IUNA 1QG7A 1PRTB 3Q24A 3GTKH 4JI8L 2B2WC 5CV7A 3MAQA 4YY3Q 3NQIA 1SNQA 3W2DA 2EY1A 4IN3A 4RGNA 3P1HA 4DA2A 4A3EG 1PRTD 3OHXC 3Q22A 2R93G 4KN4C 4DV0Q 5ELEA 3K6OA 4LF6L 3RZOH 4C3HB 1JE5A 5M3MG 3QG1A 1X3QA 1KRTA 2NVYH 2VXWA 4IO9A 2NZHA 2L1BA 2KOLA 1BKBA 1AE3A 3MZ5A 1GO3E 1TWAH 2LY7A 5JVG3 2H4OA 1CHPD 1K8GA 1AE2A 3PIO3 3T1YL 1VQ5A 1UEAB 5M9OA 2CW0C 3RD4A 5K36H 3PF5A 1S5BD 2R3ZA 2QGQA 5C3XA 2X6GA 1SN8A 4BY7B 1WJJA 3O13A 3HKZB 1QILA 4FXGC 4X64Q 2VQEQ 2EYLA 3MXGA 3GTJH 1WD0A 1Q86C 2Z0SA 4IUQA 4HJ8A 2F4IA 1G8ZD 3G71A 4CHTB 1N32L 3FMCA 4DK1A 4JI5L 4A3JB 1SE8A 4GN5A 1CZWA 3CHBD 3QWNA 5D3DA 3CAMA 1N36Q 2F3VA 3OOCA 1K0RA 3TZUA 2ODCI 2JP1A 2PQAB 3EQLC 1SSOA 5I2XA 3BS1A 1NNXA 4UDUC 1QZGA 3HOXH 2E2JH 3PSIA 1Q82C 4LF9L 2JA6H 1VS0A 2E5LL 1YEZA 1V1OA 1HQRD 3MC0B 3OMGA 2RCFA 4IPGA 2C35B 5A2QL 3OWEB 5JVH3 4K8JA 1STGA 3OW7A 4LF4Q 4IPHA 2N3SA 5EPLA 1V66A 3ERSX 1LYLA 3L7ZC 1QUQA 5E4WC 3HP3A 2KVEA 1SFOH 1RTOA 3T51B 3NP8A 2SNSA 2DJGC 3ND8A 4N8X1 3HOYH 1UE7A 1STYA 2F0FA 2UUAQ 1EIFA 1RCVD 1T5XD 1NE3A 1G2SA 3HOXG 4JI8Q 3TRZA 2MJ8A 5IP7G 3TEHB 5HY6A 3ER0A 4ZAIA 1G291 4HN7A 1PFMA 2N88A 4JVZA 2B2YA 3KUPA 5K36G 1ML0D 3P20A 1LTID 4BBSG 1UE1A 1JOKA 4MHEA 1VQ9A 3IFTA 2CVRA 3RZDB 4DFAA 2RDHA 3GTLB 2R7DA 3SHLA 2Z4HA 3S1QH 2K75A 4IPDA 4DU9A 2JVWA 1KXLA 4IFDI 4GN4B 1KQSA 4A3MB 3H6MA 3Q8DA 4X62L 4GOPB 1FJGL 2SOBA 3PO2H 4HR7B 4ZKCB 2PW5A 4A3IH 2BH8A 2Q8TA 1WTRA 4DR6Q 2EXZA 3G6JB 4DK6C 1PRTF 5C3WA 5IGGA 1A6XA 1CTMA 4DV2Q 2VQEL 3CCRA 1O7YA 4PQXA 3DHQA 1A3TA 2FFKB 4DV7L 1RIPA 1WOCA 4O2DA 2HCCA 1IYJB 4ZCKA 1QUQB 2A6ED 5LMNW 4OIJA 3LWEA 2WKDA 4JI4Q 1PH6A 2RQXA 5COYA 3QO2A 2IY5B 1KIXA 1F9PA 4LFBL 2SNMA 4J6HA 4AIMA 1NTGA 2BE5C 3UDGA 4RGTA 5M5YH 3EN2A 3OTOQ 1KHCA 4QF4A 2BE5D 2FMMA 1ENAA 2N8NA 2B2WA 5IYBH 1EYAA 4M8AA 1Y1VH 1JCKB 3S15H 4KHVA 4JC0A 4KHZA 1WTVA 3D6CA 4H13C 1I94L 1K0SA 1B3QA 2D2CC 1STAA 1EQRA 1LUZA 4XQNA 2F03A 3ITPA 5IWAL 3I4MB 3J81L 4WFN3 1EZ6A 1EY5A 1FGUA 1SAPA 2EY5A 1R9TB 2MO0A 3SVMA 3CCVA 2NB0A 3GDEA 4C2MH 5KYIA 2EY2A 1SJHD 3AQQA 1D5XC 5BN5A 2Y0SB 3S14H 5I9OA 2KBNA 1BCPF 1SEBD 4ID6A 3RLNA 2JA7B 1PH2A 4ZK9B 1JJGA 3FRPB 3GV3A 4BY1G 4KJNA 2HQEA 1CI3M 1NMGA 4GKKL 2EJMA 2L0CA 4LF6Q 3D8GA 2KW9A 1B7YB 4LK1C 4B3ML 3VA7A 1NCVA 4L63B 3TSSA 5FLMG 3KF8A 5FLXL 3EBEA 2JQOA 2MGSA 2VNUD 4A3GG 3GTPH 4P2CB 3S16H 3HG9A 4DR5Q 1HUNA 5C4HA 3HRZC 1T9HA 5JEAJ 1Q12A 1Y69U 2B2YC 1D1KA 3D0FA 3WOFA 3VR6A 1E3PA 1HR0Q 2KHSA 1QJOA 1MIUA 1NAPA 1EL0A 4QJFA 1LM0A 3H0GB 1JE4A 1PFSA 5I9PA 3TDQA 5IT9L 3F2UA 1QNKA 3QOJA 4A3CG 4JI5Q 3FVQA 2PI2A 1VQ7A 1BXTA 4A93G 1EY7A 5AFWA 4C56C 5CGKA 3K57A 3I55A 3S17B 4PV1C 2A8VA 1YNJC 1FD7D 1I50H 1DGSA 1YI2A 1STBA 3M7GA 4DV6L 1GUWA 3NTHA 3CQZH 2F3WA 4HIMA 1F9RA 1HTPA 2WKCA 2O2LD 4C3IG 4DV1L 3M4PA 2JJQA 2HJQA 5CYUA 3T4AC 4ALPA 1GJJA 1SYCA 3KLRA 2Y0SG 1A0IA 1TKWB 4MZ9A 4IURA 3X3MA 2EJGC 3HOVG 3OYYA 2W51A 2K04A 3HFZB 5CV6A 4JI7L 2E8GA 3CCEA 3NQTA 4MNOA 4XT3B 4UP9A 3I4NB 4TSSA 4PZ7A 2QDLA 4A3BB 2B8FA 3DEPA 4AYBB 4EQNA 3VR4A 1OXUA 2DNCA 3GP7A 2E2JB 3E3XA 4QUCA 1L0XB 3KF8B 3J80L 1J8IA 1Z7TA 5JJLA 3CKIB 4EVOA 5FLXc 4B3MQ 4P74A 1VQDA 1WTOA 1VQKA 1D5ZC 4QIWE 1G51A 2QW7A 2R6GA 1E7DA 5FJ8G 4WJ3M 4A93B 1NR4A 3CCSA 1KNAA 3NBIA 1II3A 3L2PA 3SGIA 2UXBQ 3GTQB 1XTDA 3U50C 2PNRC 3HOWH 1RJTA 5IGBA 2RDGA 2K5VA 3KJOA 4JG2A 2RNNA 4KLKA 3E5SA 1KAWA 5C4ZA 1WCMG 3BVMA 2BCOA 5JJKA 1MHWC 1CA6A 2Y0SE 4LF8Q 4B08A 2D0PA 1UUPA 4J15A 2E2DC 3CD6A 4JI3L 4A3BG 2UXDL 4HJ5A 4ME5A 2K52A 1N9WA 2A73B 5IYCG 5IYBG 5C4JB 3PQIA 1BBXC 3TS2A 4RMFA 5CBAE 3EFXD 4QQBX 4GZYC 3A8KE 2XNAC 2GN5A 5IY0A 4XQQA 1O7LA 1I4PA 2AQ1B 3KLWA 1EQVA 2BA1A 1Y02A 4G4KA 4JI1Q 3UDFA 1YZ6A 5ELBA 1OXXK 3I3CA 2MUYA 2EYJA 1A2UA 1HCZA 3HOUH 4Q5VA 3V05A 3C2PA 1MJCA 3I91A 2RF4A 1JB7A 1DZ1A 1YVCA 1Q8IA 2I5HA 3A56A 4K5VA 5IGDA 4DR7L 3CF5A 4DAYA 5FK9C 1ZEQX 2RA4A 1DYQA 2N49A 1EN7A 2IX0A 4CKBA 2NVTH 3KK7A 2CH4A 2K5QA 3TP6A 1VCIA 5T1IA 2B29A 4K6DA 1DCZA 3KLSX 1ASZA 3RZOB 3HZXA 4DV5L 4X3SA 4V190 2JA8G 4NXMQ 2L55A 3L0OA 4X66Q 3I4OA 4C3JH 3MXUA 1CSPA 2XTIA 4X65L 1J9OA 1PZJD 1VQLA 4K6LA 1TWAB 5IGCA 2QEJC 3MEHA 1YNJD 4G7HC 5C44B 2CCZA 5M5WB 1X32A 1EIYB 1SNPA 1B70B 2JE6I 3GO5A 1IBLL 1GHKA 2WB1G 3RUZA 1TS3A 1HZAA 2VL6A 3QOLA 3S15B 1HNWL 4NB3A 4R8NA 1U9RA 1KABA 2RHQB 1D5MC 2HHHL 5BR8Q 2VZAA 3W1BA 4BY7H 2ZXRA 1QWYA 1KNEA 4FNFA 2F0TA 1VQBA 3HEJA 2UXBL 2F0DA 4ULLA 5ELNA 4C3IB 1R9TH 2DK4A 1I3QB 3R2IA 3J81j 5DLQE 1A63A 4UY8C 4RWSC 2X69A 3G7LA 1BUVT 4L5RC 2B2VA 3A74A 4A3DB 2TSSA 4JI0Q 1R4QB 2DUDA 3D3RA 2A5HA 1CM9A 1LACA 2F0OA 3NBHA 4YHHL 3HOVB 2HDMA 2VQFL 1PZKD 3VR5A 4CJ2C 4FVMA 5T1GA 3FP9A 2IX1A 2R7ZG 4OEMB 1OXSC 1XWEA 1TQOA 4RCNA 4B3RL 5GAGC 1J5EQ 2CWPA 1J6QA 1PYBA 2RSNA 3H0GG 4XYQA 1EWHA 2XVSA 1WI5A 2KCNA 1F2MA 1FR3A 2Z1CA 1BBUA 5KEEA 1MKHA 3QR8A 1PH5A 2R92B 4ZQ3A 1L1OC 4HIOA 4XQJA 2PPBC 4QCLA 2G9DA 5M5XH 1EYGA 3H3VC 1SFOB 4DAYB 3PO3H 4BBRB 1STHA 4DUZQ 3M4OH 4F7XA 3VA5A 2E2HH 1ZS9A 4JPBW 4LJZC 4S3SA 5BN3A 1VDZA 3HOYB 1S5CD 4C3JG 4JBJA 2R7ZB 4DR7Q 4H44C 3H94A 5LL6S 2MQHA 3K5NA 3T56B 3V2TA 4FF3A 1CSQA 1S40A 1ICFB 1L0WA 1PTOD 2E76C 3S1NB 2LSSA 4GLVB 3MVVA 4P73A 4DV5Q 3J80i 4NMZA 4A3JG 3GTMB 1U4LA 2K5HA 3PIPA 4X65Q 1EY4A 2OWOA 1VMCA 1V8QA 2K5NA 2NYZD 5EPJA 1IHZA 2FHTA 2KENA 2VUMG 5JEAH 5F2DA 1YBYA 4GNXA 1EY8A 3J81E 4FF2A 1H9KA 2BDOA 1VQEA 1HFNA 2PW7A 3N52A 5AJ3Q 1X3EA 1SMYD 2QEXA 1BCPC 4LUOA 3E9IA 3I4NH 3NBHB 5LMUL 1LTSD 3T16A 3AMUA 2J0TD 3FDTA 4JI0L 1FL0A 1VQCA 2PO4A 2N55A 4CKCA 3M3YH 1F77A 1I4HA 1YNXA 3F2DA 1HNXL 1EWCA 2QCPX 3K80C 4FYDA 5A35A 3ICEA 3SK8A 1H9MA 5E3FA 1PRTC 1EY6A 5LL6X 1U4MA 2XSCA 3VYTA 3MEFA 4G7OC 3EVQA 4DAVA 4LF8L 2NN6H 3PUWA 3W1GA 5KNDA 1TWFB 5E7NA 2QNCA 1C4QA 4B9XA 1PXUA 3T1HQ 4LF5Q 4A93H 1SROA 4K8IA 1SYFA 3FPPA 1RTNA 4IUVA 1HPCA 1M4VA 1ICWA 2WB1B 1N8RC 1JEIA 1GKUB 2F0SA 3DWPA 2EYFA 3D4WA 2HD3A 4RG1A 2F0EA 1YJ9A 1RF2D 4DUYQ 4LAAA 4LNQA 2R93B 4DR4Q 1E0BA 1Y1WG 4DR2L 3H3VI 5EKLA 2B8GA 2PZWA 2LD7A 4LF7L 1JJ2A 3SXHA 2IX3A 3CRLC 2FMCA 4KD4A 3S2HB 3S14B 2Z8LA 3AU7A 1VQ4A 2VY3A 5C3EH 4CGYB 1K28A 1JJRA 4ZRZA 4HSPA 2B2UA 4NXML 1EFWA 4X66L 5HURA 3E0JA 1G2TA 1IZ6A 5IYDG 1A8VA 1AZPA 2AWNA 4I7ZC 4ZYSA 2EOTA 3DWAA 3BG3A 4WORA 3HKZG 4LFAQ 1N34L 2NVYB 3S16B 4DR1L 3K5MA 3J7AF 4X6AH 2JK8A 1SRUA 3ONAB 1L0YB 5CBEE 5CV4A 1X54A 4RKBA 2MNAA 3HOZB 3I7FA 3J7A5 3C3LA 2KHIA 2CFMA 1CKNB 1LTBD 1TU2B 4AYBE 3SDZA 3FLGA 1U4PA 1KC8C 1PTOC 2ZT9C 2F0PA 3HOYG 5GQOA 4HTHA 3JAMc 1Q1EA 4HMIA 1K8AC 1WCMB 1U5KA 4DKAC 2F0NA 4HCSA 4NKLA 1JC7A 3MWYW 2K1BA 1X3GA 3GTJB 1DM0B 4YHHQ 4OELB 1Z9FA 1FJGQ 4DNRB 4X62Q 1QCBD 1RL2A 2RDFA 1KLUD 3U4VA 4DAMA 4AYBG 2Z6KC 1D6EC 1PYSB 4KY5A 4BY1B 1FNVA 1WD1A 4UP7A 2LMCB 1P8LA 5EPKA 4DR6L 1S72A 3TP5A 3HKSA 1GUNA 1SMYC 5IYCH 4CJ1B 3HOXB 2AHOB 4GKJQ 1FNUA 3F8TA 1B53A 1X55A 3HKZE 2R92G 2I07B 3QJYA 4R4CA 2YTXA 1LTAD 2EQSA 1E22A 1TWCH 1FVIA 3BJUA 1CK1A 4DUZL 1PZID 1XMOQ 4LFBQ 1CA5A 1DJRD 3H3VH 1AW7A 1WTXA 3U9OA 1FGBD 3PMFA 4IJLA 2I0QA 3R2TA 3P75A 3ZYYX 4KI0A 1I6VC 3EIVA 3A0JA 4JOIC 4YCVA 3ND9A 4XDXA 3K7AH 3R93A 1V9PA 2ZTDA 4BA1I 1GD7A 4I65A 1RHPA 2M2LA 5M5XB 1PTOF 4R1JA 1DD2A 3ZJYC 1LTGD 4AQYL 4FXDA 1JR0D 3GTGH 3C1EA 4XTCS 2XGTA 3RZDH 5JJIA 1ILPA 4GNXC
chains in the Genus database with same CATH topology
5J3BA 4QIWE 2K14A 4X64L 3CC4A 1G51A 1H9EA 5AJ3L 2IHFA 3S2DH 2IT1A 2UUBL 2R6GA 1E7DA 5FJ8G 5M3FH 4WJ3M 4XIGS 5C4XH 1K3RA 1HJPA 1PA6A 4QGUA 3CCSA 5IYDH 1QVCA 4A75A 4AQYQ 3L2PA 3RN5A 4A3MH 3SGIA 2GVAA 3GTMH 1N32Q 3FKIG 1PH8A 2UXBQ 4JI3Q 1XTDA 2UXDQ 4R4TA 2FXQA 1TWGH 2ID0A 3KDFB 3NELA 3U50C 5C3EG 1NBWA 4GKKQ 4A3FG 3HOWH 4GN3B 1X65A 1Y1WH 3DM3A 1N36L 2VUMH 2K5VA 3KJOA 4POGA 3PF4A 4JG2A 5C4XG 1IBKL 4KLKA 4R4OA 1KAWA 4WJ4A 4A3KG 2NVQH 1WCMG 1XNRL 1E1TA 3GTQH 1CKOA 5JJKA 1UEBA 2EXDA 1XPRA 3CW2C 2Y0SE 1V1QA 5IP9G 2OTLA 4LF8Q 2BH2A 3BZCA 2D0PA 4J15A 4UP8A 1VQKA 2UUCL 2RCNA 3CD6A 4JI3L 4A3BG 2UXDL 1SMXA 1YJNA 4LW1A 2AWOA 2ODGC 4TQUS 4HJ5A 2K52A 4BBSH 4A3MG 2JEAI 4NXNL 1N9WA 5IYCG 3E9HA 5IYBG 3PUYA 1M90C 3TS2A 4RMFA 3T1HL 4QQBX 5GADC 1XNRQ 2I5MX 2JA8H 2AMCB 5M3MH 2GN5A 5IY0A 2ZJPA 1E24A 1HR0L 3UDFA 3KLWA 3TREA 2BA1A 1H9FA 1Y02A 5EAYA 1U0LA 1YZ6A 2JEBI 1OXXK 4JI1Q 4HIKA 1EQQA 1NJIC 1PH9A 1LTLA 1VQIA 1XNQL 3HOUH 4YCWA 2JA7H 4R4QA 4LF9Q 1YJWA 3KJPA 1MJCA 2RF4A 5FLMH 1JB7A 2JA5H 2B63H 1YVCA 2ZTCA 4A3EH 1XMQL 1Q81C 1D8LA 4DUYL 1HR0W 1OXTA 5IP7H 4HIDA 1I94Q 1UE5A 1VQHA 2R93H 5GROA 2I5HA 1YHQA 2OCEA 4OWTB 3JC66 1L2FA 3S1RH 4DR7L 4YY3L 3PUXA 4LUVA 2NN6G 2Z6KA 4P75A 3CF5A 4JBMA 2NN6I 2N49A 2KCTA 3KFUA 1EN7A 2IX0A 2NVTH 3KYHC 3I4NG 3G6EA 1VCIA 2LXJA 3ULPA 2R7FA 4AH6A 1IBLQ 5C0XI 2B29A 4OONA 1X3FA 1M1KC 1VQOA 1N33Q 1MJEA 2CWAA 4A76A 1K83H 1ASZA 4Y52H 3CMAA 4DV5L 2JA8G 2UXCQ 1YHAA 2KHJA 2OQKA 4NXMQ 3L0OA 3JAMi 4IFDG 2WAQG 3I4OA 4X66Q 4DV3Q 4A3JH 4C3JH 1W2BA 3GTKH 1CSPA 2XTIA 4JI8L 4X65L 3BZKA 3CXCA 2JA5G 1VQLA 4YY3Q 4IOAA 4DK3C 4IOCA 1Q7YC 4A3EG 2CCZA 3CC2A 2R93G 3BU2A 4DV0Q 1EIYB 1B70B 1X6OA 2JE6I 4LF6L 3RZOH 3GO5A 1IBLL 5C0XJ 1JE5A 5M3MG 4BA2I 4C3IH 2WB1G 3F1ZA 1HZAA 2NVYH 2VL6A 1KRTA 3PUVA 4IO9A 1N33L 3J80c 3CCMA 1IBML 2NZHA 4NB3A 1VQJA 3F2BA 1BKBA 1AE3A 3I4MG 1GO3E 1WFQA 2RHQB 4OWWB 2HHHL 5BR8Q 2VZAA 4A3DH 1TWAH 4P72A 3W1BA 5GAHC 2VQFQ 2UU9Q 4BY7H 3S2HH 2I5LX 2K50A 1SR3A 4JV5L 3PGZA 1K8GA 1AE2A 3M85A 1VQBA 3T1YL 1VQ5A 2V1CC 2UXBL 4JBWA 3HOZG 1IL2A 5ELNA 1R9TH 4JI4L 2DK4A 3J81j 3PF5A 5DLQE 2F4VQ 5H1SE 1A63A 2QGQA 3AFPA 4MTNA 4A4IA 4UY8C 1HZBA 4L5RC 3A74A 4GS3A 1SN8A 5LMNQ 4JI0Q 1WJJA 2DUDA 3PIOA 1HNZQ 2LC3A 3M9BA 1HH2P 4YWKA 4X64Q 3IRBA 5C0XG 4YHHL 1IXRA 2VQFL 2VQEQ 3GTJH 1Q86C 2Z0SA 4JBKA 4IFDJ 4HJ8A 4B3TQ 3FP9A 3M7NA 2IX1A 2R7ZG 4JI2L 3T1YQ 2UUCQ 3G71A 4JI6Q 1YIJA 2YU9H 1OXSC 4NPSA 4DPGA 1N32L 4B3RL 1SLJA 4JI5L 2WFWA 1SE8A 5GAGC 5C44G 1J5EQ 1C0AA 2CWPA 1J6QA 1PYBA 4BBRG 4GN5A 2ZM6L 2LXKA 3A5UA 1GM5A 3H0GG 4YWLA 1P16A 3STBD 4LF4L 4LWCA 3CAMA 1N36Q 3PUZA 1K0RA 1WI5A 1KL9A 2ODCI 1BBUA 1PH5A 1MKHA 2PQAB 5M5WH 3G48A 3K81C 1A62A 5FJ8H 5M3FG 2R7ZH 1KHIA 1PHJA 1L1OC 4HIOA 4C3HH 3J7ZC 1EWIA 1QZGA 1NMFA 3D31A 4KHPL 3HOXH 1QZHA 5M5XH 1EYGA 3PSIA 1Q82C 2E2JH 1V43A 1VS0A 4LF9L 4DAYB 2JA6H 3PO3H 2B63G 2E5LL 4DUZQ 3STBC 1YEZA 3M4OH 2H5XA 2WAQE 2E2HH 4IPGA 1ZS9A 1C9OA 2C35B 4YCUA 3HOUG 4BXXG 1J5EL 3RNUA 4JBJA 1H95A 4DR7Q 2VW9A 4LF4Q 1S3OA 4IPHA 2N3SA 1VQAA 3H15A 1EUJA 3OW2A 2MQHA 3ERSX 1LYLA 3L7ZC 1QUQA 3NENA 5ELOA 2ES2A 1CSQA 1SFOH 1S40A 1YHBA 1L0WA 3I56A 2N78A 4OX9L 2LSSA 4JOIA 4JI1L 4GLVB 1E7ZA 1C7YA 3KF6A 4A3BH 3HOYH 1UE7A 4P73A 3J80i 4DV5Q 4O0AA 2E5LQ 1AH9A 2UUAQ 1EIFA 4A3JG 1NE3A 2WB1E 1VQ6A 3HOXG 2KCMA 4APVA 2F52A 2IHEA 2K5HA 4JI8Q 4X65Q 3PIPA 4LFCQ 3TRZA 4DV4Q 5IP7G 2L15A 2OWOA 3TEHB 4A3LG 1PVOA 2DGYA 5HY6A 1UWVA 3ER0A 2K5NA 3TS0A 1G291 4K0KL 1NY4A 3KF6B 3W5OA 3K7UC 2KENA 5LMUQ 5K36G 1UE6A 2VUMG 2CQOA 2JA9A 1YBYA 4PG3A 4GNXA 2YTYA 1Y1VG 4HJAA 4OXPA 4BBSG 1UE1A 3AYHB 2R92H 2VS1A 1O7IA 1VQEA 1VQ9A 3I2ZA 2F3IA 5AJ3Q 1X3EA 4DV2L 2R7DA 2QEXA 1E1OA 2KFVA 3S1QH 2K75A 4IPDA 3CCUA 1KXLA 2JA7G 4IFDI 4GN4B 4LUOA 3M4QA 1KQSA 2YYZA 3E9IA 3Q8DA 4X62L 4GOPB 3NBHB 2G80A 1K73C 1FJGL 2F4VL 3I4NH 5LMUL 3VDYA 4A3KH 1Z47A 1YNSA 1HZCA 3PO2H 4R4IA 3B6YA 4A3IH 4A3CH 2BH8A 4JI0L 1FL0A 1VQCA 1Y14B 3M3YH 4DR6Q 2K4KA 3GTLH 1HNWQ 4DK6C 1IBKQ 3FHWA 1YNXA 1BBWA 3F2DA 1HNXL 4JYAQ 1Q8KA 3AFQA 2A19A 4DV2Q 5JEAG 3K80C 4PZ6A 3UDXA 2VQEL 3RLFA 3CCRA 2HHHQ 3ICEA 1GVPA 3UE0A 3OTOL 4DV7L 1RIPA 1WOCA 4O2DA 4B3TL 4BY7G 1IYJB 1PV4A 4JI6L 4JV5Q 1QUQB 3LGJA 3MEFA 5LMNW 3CCJA 4JI4Q 1PH6A 3DLLA 3UDIA 4LF8L 4BXXH 1VQMA 2IY5B 1KIXA 1VQFA 5HGQA 3PUWA 4UPAA 3W1GA 3J81i 5C4JH 4LFBL 4DR2Q 2HT1A 5E7NA 2QNCA 4DR3Q 3T1HQ 1G6PA 4LF5Q 1HNXQ 1QVFA 1TWHH 4IPCA 1SROA 4A93H 1VQNA 3WWVA 4AIMA 1HNZL 1NTGA 3ULLA 2D0OA 4A3GH 3UDGA 4KHPQ 4QY7A 5M5YH 3EN2A 2OQ0A 5IWAQ 3OTOQ 4DV7Q 1YITA 4HJ9A 3HOZH 1OXVA 1N8RC 1JEIA 1GKUB 1I6HH 2Q2TA 3KDFA 1HZ9A 2YV5A 1BVSA 4RG1A 1YJ9A 2N8NA 1XMQQ 5IYBH 4B3RQ 4DUYQ 1JJCB 1Y1VH 5IE8A 2WP8J 2E2IH 3RN2A 4LNQA 4DR4Q 1Y1WG 4DR2L 3S15H 2ATWA 2BA0A 4JC0A 4KHZA 4ME3A 1I94L 1ASYA 3H3VI 4GOPC 1EQRA 1LUZA 2B3GA 2LD7A 4PZ8A 4LF7L 1JJ2A 3UE1A 4H02A 5IWAL 1PH7A 1CKNA 4L5SA 2PMZE 2ZJQA 3U4ZA 1VQ4A 3TQYA 2JA6G 2VY3A 4L5TA 3CMEA 1FGUA 1CUKA 3U58A 4Y7NH 4PMWA 4EX5A 5C3EH 4B3SQ 2MO0A 1XPOA 4IJHA 3CCVA 4DV3L 3GDEA 4DV4L 4C2MH 4YWMA 2HQLA 2Q2HA 3AQQA 2UXCL 2GVBA 4QL5A 4NXML 3RLOA 1EFWA 3ULJA 2UUBQ 4X66L 3F2CA 3S14H 2KBNA 1IZ6A 3I4MH 5IYDG 3RLNA 1A8VA 1PH2A 4LF7Q 2AWNA 4DR5L 1JJGA 5GAEC 2A1AA 4LFAQ 3HKZG 4BY1G 1N34L 3CCQA 1TWFH 3CPFA 5C44H 1NMGA 4GKKL 4DR1L 4EQ5A 4LF6Q 4X6AH 1I5FA 1SRUA 2JK8A 1B7YB 2UU9L 2ZTEA 4B3ML 1X54A 2MNAA 3I7FA 1WCMH 3J7A5 2MFIA 5FLMG 3EBEA 2JQOA 2KHIA 3J81c 2VNUD 2CFMA 2NZOA 4A3GG 1CKNB 4AYBE 3GTPH 2PQAA 4GNXB 3S16H 3PV0A 1KC8C 4A3IG 1W3SA 2YTVA 3E0EA 4HJ7A 4DR5Q 2PI2E 1E7LA 1JT8A 1K9MC 3HOYG 1X56A 1N34Q 4LFAL 5GQOA 1T9HA 1I3QH 1L1OA 3JAMc 1PH3A 1Q1EA 1TXYA 2QNFA 5JEAJ 3FKIH 3CC7A 1K8AC 4DR1Q 4JYAL 1Q12A 2D62A 1QVGA 4NXNQ 3NEMA 1U5KA 4DKAC 4GLXA 5LMNL 3CCLA 1X3GA 3D0FA 4GKJL 1E3PA 4YHHQ 1HR0Q 3HOVH 3K8AA 2OTJA 1L1OB 1Z9FA 4GLAC 1FJGQ 1MIUA 4P71A 4X62Q 1RL2A 1EOVA 4QJFA 1LM0A 2CKZB 3U4VA 1PFSA 4DAMA 4JI2Q 4AYBG 2Z6KC 1PYSB 1Q46A 3PO2G 3G4SA 4UP7A 2QA4A 4A3CG 4A93G 1P8LA 4DR3L 2PI2A 1WYDA 1XMOL 1VQ7A 4JI5Q 4POFA 4DR6L 1S72A 2ZM6Q 1GKHA 3PCOB 4A3LH 2NVXH 3GD7A 3HKSA 3CPWA 3I55A 1XJVA 2MPHA 3KOJA 5IYCH 3K0XA 3GTOH 4TVAB 2A8VA 2AHOB 1VQGA 4GKJQ 1KD1C 1XPUA 1I50H 1DGSA 3F8TA 1X55A 1YI2A 3HKZE 2R92G 4A3DG 4BBRH 4DV6L 4HIMA 1GL9B 3CQZH 4R4CA 2HIVA 2YTXA 4LUZA 1XNQQ 5IP9H 2EQSA 1E22A 1TWCH 2AKWB 3BJUA 1FVIA 4DUZL 1X9NA 4DV1L 3A5ZB 3M4PA 3CP0A 4FDBA 2JJQA 3S24A 2HJQA 1XMOQ 4LFBQ 1B8AA 2ASBA 1D7QA 4ALPA 1GJJA 4LF5L 4OO1G 2Y0SG 1A0IA 4MZ9A 3H3VH 4L5QA 2RHSB 5IT9c 1HNWL 4DV0L 3HOVG 2MO1A 3OYYA 2W51A 3HFZB 4JI7L 4DV6Q 4IJLA 3S1NH 2E8GA 2I0QA 3CCEA 4MNOA 2UUAL 2Q2IA 4OX9Q 4UP9A 4A3FH 3HOWG 4KI0A 4JCVE 3EIVA 3A0JA 4PZ7A 4JOIC 1VQPA 2ALYB 4YCVA 2EIFA 3RR5A 4DV1Q 3K7AH 5BR8L 1KRSA 1PH1A 1V9PA 2ZTDA 1OXUA 4BA1I 4DNIA 3AEVA 4DR4L 1VQ8A 4LFCL 1GD7A 3PO3G 1PH4A 4R1JA 1JMCA 3H0GH 3ZJYC 4OO1I 2ZJRA 4BY1H 4AQYL 1Q1BA 2PNHA 4K0KQ 3GTGH 3KF8B 4OWXB 4JI7Q 3S1MH 3MXNB 5JJLA 4GOPA 4XTCS 2XGTA 3RZDH 5FLXc 1CKMA 4B3MQ 4P74A 2Q2UA 1VQDA 2HIXA 3S17H 5JJIA 4B3SL 1OTCA 4GNXC 1IBMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3B A;  4QIW E;  2K14 A;  4X64 L;  3CC4 A;  1G51 A;  5AJ3 L;  2IHF A;  3S2D H;  2IT1 A;  2UUB L;  2R6G A;  1E7D A;  5FJ8 G;  5M3F H;  4WJ3 M;  4XIG S;  5C4X H;  1K3R A;  1HJP A;  1PA6 A;  4QGU A;  3CCS A;  5IYD H;  1QVC A;  4A75 A;  4AQY Q;  3L2P A;  3RN5 A;  4A3M H;  3SGI A;  2GVA A;  3GTM H;  1N32 Q;  3FKI G;  1PH8 A;  2UXB Q;  4JI3 Q;  1XTD A;  2UXD Q;  4R4T A;  2FXQ A;  1TWG H;  2ID0 A;  3KDF B;  3NEL A;  3U50 C;  5C3E G;  1NBW A;  4GKK Q;  4A3F G;  3HOW H;  4GN3 B;  1X65 A;  1Y1W H;  3DM3 A;  1N36 L;  2VUM H;  2K5V A;  3KJO A;  4POG A;  3PF4 A;  4JG2 A;  5C4X G;  1IBK L;  4KLK A;  4R4O A;  1KAW A;  4WJ4 A;  4A3K G;  2NVQ H;  1WCM G;  1XNR L;  1E1T A;  3GTQ H;  1CKO A;  5JJK A;  1UEB A;  2EXD A;  1XPR A;  3CW2 C;  2Y0S E;  1V1Q A;  5IP9 G;  2OTL A;  4LF8 Q;  2BH2 A;  3BZC A;  2D0P A;  4J15 A;  4UP8 A;  1VQK A;  2UUC L;  2RCN A;  3CD6 A;  4JI3 L;  4A3B G;  2UXD L;  1SMX A;  1YJN A;  4LW1 A;  2AWO A;  4TQU S;  4HJ5 A;  2K52 A;  4BBS H;  4A3M G;  2JEA I;  4NXN L;  1N9W A;  5IYC G;  3E9H A;  5IYB G;  3PUY A;  1M90 C;  3TS2 A;  4RMF A;  3T1H L;  4QQB X;  5GAD C;  2I5M X;  2JA8 H;  2AMC B;  5M3M H;  2GN5 A;  5IY0 A;  2ZJP A;  1E24 A;  1HR0 L;  3UDF A;  3KLW A;  3TRE A;  2BA1 A;  4JI1 Q;  1XNR Q;  5EAY A;  1U0L A;  1YZ6 A;  2JEB I;  1OXX K;  1EQQ A;  4HIK A;  1NJI C;  1PH9 A;  1XNQ L;  1LTL A;  1VQI A;  3HOU H;  4YCW A;  2JA7 H;  4R4Q A;  4LF9 Q;  1YJW A;  3KJP A;  1MJC A;  2RF4 A;  5FLM H;  1JB7 A;  2JA5 H;  2B63 H;  1YVC A;  2ZTC A;  4A3E H;  1XMQ L;  1Q81 C;  1D8L A;  4DUY L;  1HR0 W;  1OXT A;  5IP7 H;  4HID A;  1I94 Q;  1UE5 A;  1VQH A;  2R93 H;  5GRO A;  2I5H A;  1YHQ A;  2OCE A;  4OWT B;  3JC6 6;  1L2F A;  3S1R H;  4DR7 L;  4YY3 L;  3PUX A;  4LUV A;  2NN6 G;  2Z6K A;  4P75 A;  3CF5 A;  4JBM A;  2NN6 I;  2N49 A;  2KCT A;  3KFU A;  1EN7 A;  2IX0 A;  2NVT H;  3KYH C;  3I4N G;  3G6E A;  1VCI A;  2LXJ A;  3ULP A;  2R7F A;  4AH6 A;  1IBL Q;  5C0X I;  2B29 A;  4OON A;  1X3F A;  1M1K C;  1VQO A;  1N33 Q;  1MJE A;  2CWA A;  4A76 A;  1K83 H;  1ASZ A;  4Y52 H;  3CMA A;  4DV5 L;  2JA8 G;  2UXC Q;  1YHA A;  2KHJ A;  2OQK A;  4NXM Q;  3L0O A;  3JAM i;  4IFD G;  2WAQ G;  3I4O A;  4X66 Q;  4DV3 Q;  4A3J H;  4C3J H;  1W2B A;  3GTK H;  1CSP A;  2XTI A;  4JI8 L;  4X65 L;  3BZK A;  3CXC A;  2JA5 G;  1VQL A;  4YY3 Q;  4IOA A;  4DK3 C;  4IOC A;  1Q7Y C;  4A3E G;  2CCZ A;  3CC2 A;  2R93 G;  3BU2 A;  4DV0 Q;  1EIY B;  1B70 B;  1X6O A;  2JE6 I;  4LF6 L;  3RZO H;  3GO5 A;  1IBL L;  5C0X J;  1JE5 A;  5M3M G;  4BA2 I;  4C3I H;  2WB1 G;  3F1Z A;  1HZA A;  2NVY H;  2VL6 A;  1KRT A;  3PUV A;  4IO9 A;  1N33 L;  3J80 c;  3CCM A;  1IBM L;  2NZH A;  4NB3 A;  1VQJ A;  3F2B A;  1BKB A;  1AE3 A;  3I4M G;  1GO3 E;  1WFQ A;  2RHQ B;  4OWW B;  2HHH L;  5BR8 Q;  2VZA A;  4A3D H;  1TWA H;  4P72 A;  3W1B A;  5GAH C;  2VQF Q;  2UU9 Q;  4BY7 H;  3S2H H;  2I5L X;  2K50 A;  1SR3 A;  4JV5 L;  3PGZ A;  1K8G A;  1AE2 A;  3M85 A;  1VQB A;  3T1Y L;  1VQ5 A;  2V1C C;  2UXB L;  4JBW A;  3HOZ G;  1IL2 A;  5ELN A;  1R9T H;  4JI4 L;  3J81 j;  3PF5 A;  5DLQ E;  2F4V Q;  5H1S E;  1A63 A;  2QGQ A;  3AFP A;  4MTN A;  4A4I A;  4UY8 C;  1HZB A;  4L5R C;  3A74 A;  4GS3 A;  1SN8 A;  5LMN Q;  4JI0 Q;  1WJJ A;  2DUD A;  3PIO A;  1HNZ Q;  3M9B A;  1HH2 P;  4YWK A;  4X64 Q;  3IRB A;  5C0X G;  4YHH L;  1IXR A;  2VQF L;  2VQE Q;  3GTJ H;  1Q86 C;  2Z0S A;  4JBK A;  4IFD J;  4HJ8 A;  4B3T Q;  3FP9 A;  3M7N A;  2IX1 A;  2R7Z G;  4JI2 L;  3T1Y Q;  2UUC Q;  3G71 A;  4JI6 Q;  1YIJ A;  2YU9 H;  1OXS C;  4NPS A;  4DPG A;  1N32 L;  4B3R L;  1SLJ A;  4JI5 L;  2WFW A;  1SE8 A;  5GAG C;  5C44 G;  1J5E Q;  1C0A A;  2CWP A;  1J6Q A;  1PYB A;  4BBR G;  4GN5 A;  2ZM6 L;  2LXK A;  3A5U A;  1GM5 A;  3H0G G;  4YWL A;  1P16 A;  3STB D;  4LF4 L;  4LWC A;  3CAM A;  1N36 Q;  3PUZ A;  1K0R A;  1WI5 A;  1KL9 A;  1BBU A;  1PH5 A;  1MKH A;  2PQA B;  5M5W H;  3G48 A;  3K81 C;  1A62 A;  5FJ8 H;  5M3F G;  2R7Z H;  1KHI A;  1PHJ A;  1L1O C;  4HIO A;  4C3H H;  3J7Z C;  1EWI A;  1QZG A;  1NMF A;  3D31 A;  4KHP L;  3HOX H;  1QZH A;  5M5X H;  1EYG A;  3PSI A;  1Q82 C;  2E2J H;  1V43 A;  1VS0 A;  4LF9 L;  4DAY B;  2JA6 H;  3PO3 H;  2B63 G;  2E5L L;  4DUZ Q;  3STB C;  1YEZ A;  3M4O H;  2H5X A;  2WAQ E;  2E2H H;  4IPG A;  1C9O A;  2C35 B;  4YCU A;  3HOU G;  4BXX G;  1J5E L;  3RNU A;  4JBJ A;  1H95 A;  4DR7 Q;  2VW9 A;  4LF4 Q;  1S3O A;  4IPH A;  2N3S A;  1VQA A;  3H15 A;  1EUJ A;  3OW2 A;  2MQH A;  3ERS X;  1LYL A;  3L7Z C;  1QUQ A;  3NEN A;  5ELO A;  2ES2 A;  1CSQ A;  1SFO H;  1S40 A;  1YHB A;  1L0W A;  3I56 A;  2N78 A;  4OX9 L;  2LSS A;  4JOI A;  4JI1 L;  4GLV B;  1E7Z A;  1C7Y A;  3KF6 A;  4A3B H;  3HOY H;  1UE7 A;  4P73 A;  3J80 i;  4DV5 Q;  4O0A A;  2E5L Q;  1AH9 A;  2UUA Q;  1EIF A;  4A3J G;  1NE3 A;  2WB1 E;  1VQ6 A;  3HOX G;  2KCM A;  4APV A;  2F52 A;  2IHE A;  2K5H A;  4JI8 Q;  4X65 Q;  3PIP A;  4LFC Q;  3TRZ A;  4DV4 Q;  5IP7 G;  2L15 A;  2OWO A;  3TEH B;  4A3L G;  1PVO A;  2DGY A;  5HY6 A;  1UWV A;  3ER0 A;  2K5N A;  3TS0 A;  1G29 1;  4K0K L;  1NY4 A;  3KF6 B;  3W5O A;  3K7U C;  2KEN A;  5LMU Q;  5K36 G;  1UE6 A;  2VUM G;  2CQO A;  2JA9 A;  1YBY A;  4PG3 A;  4GNX A;  2YTY A;  1Y1V G;  4HJA A;  4OXP A;  4BBS G;  1UE1 A;  3AYH B;  2R92 H;  2VS1 A;  1O7I A;  1VQE A;  1VQ9 A;  3I2Z A;  2F3I A;  5AJ3 Q;  1X3E A;  4DV2 L;  2R7D A;  2QEX A;  1E1O A;  3S1Q H;  2K75 A;  4IPD A;  3CCU A;  1KXL A;  2JA7 G;  4IFD I;  4GN4 B;  4LUO A;  3M4Q A;  1KQS A;  2YYZ A;  3E9I A;  3Q8D A;  4X62 L;  4GOP B;  3NBH B;  1K73 C;  1FJG L;  2F4V L;  3I4N H;  5LMU L;  3VDY A;  4A3K H;  1Z47 A;  1HZC A;  3PO2 H;  4R4I A;  3B6Y A;  4A3I H;  4A3C H;  2BH8 A;  4JI0 L;  1FL0 A;  1VQC A;  1Y14 B;  3M3Y H;  4DR6 Q;  2K4K A;  3GTL H;  1HNW Q;  4DK6 C;  1IBK Q;  3FHW A;  1YNX A;  1BBW A;  3F2D A;  1HNX L;  4JYA Q;  1Q8K A;  3AFQ A;  2A19 A;  4DV2 Q;  5JEA G;  3K80 C;  4PZ6 A;  3UDX A;  2VQE L;  3RLF A;  3CCR A;  2HHH Q;  3ICE A;  1GVP A;  3UE0 A;  3OTO L;  4DV7 L;  1RIP A;  1WOC A;  4O2D A;  4B3T L;  4BY7 G;  1IYJ B;  1PV4 A;  4JI6 L;  4JV5 Q;  1QUQ B;  3LGJ A;  3MEF A;  5LMN W;  3CCJ A;  4JI4 Q;  1PH6 A;  3DLL A;  3UDI A;  4LF8 L;  4BXX H;  1VQM A;  2IY5 B;  1KIX A;  1VQF A;  5HGQ A;  3PUW A;  4UPA A;  3W1G A;  3J81 i;  5C4J H;  4LFB L;  4DR2 Q;  2HT1 A;  5E7N A;  2QNC A;  4DR3 Q;  3T1H Q;  1G6P A;  4LF5 Q;  1HNX Q;  1QVF A;  1TWH H;  4IPC A;  1SRO A;  4A93 H;  1VQN A;  3WWV A;  4AIM A;  1HNZ L;  1NTG A;  3ULL A;  2D0O A;  4A3G H;  3UDG A;  4KHP Q;  4QY7 A;  5M5Y H;  3EN2 A;  2OQ0 A;  5IWA Q;  3OTO Q;  4DV7 Q;  1YIT A;  4HJ9 A;  3HOZ H;  1OXV A;  1N8R C;  1I6H H;  2Q2T A;  3KDF A;  1HZ9 A;  2YV5 A;  1BVS A;  4RG1 A;  1YJ9 A;  2N8N A;  1XMQ Q;  5IYB H;  4B3R Q;  4DUY Q;  1JJC B;  1Y1V H;  5IE8 A;  2WP8 J;  2E2I H;  3RN2 A;  4LNQ A;  4DR4 Q;  1Y1W G;  4DR2 L;  3S15 H;  2ATW A;  2BA0 A;  4JC0 A;  4KHZ A;  4ME3 A;  1I94 L;  1ASY A;  3H3V I;  4GOP C;  1EQR A;  1LUZ A;  2B3G A;  4PZ8 A;  4LF7 L;  1JJ2 A;  3UE1 A;  4H02 A;  5IWA L;  1PH7 A;  1CKN A;  4L5S A;  2PMZ E;  2ZJQ A;  3U4Z A;  1VQ4 A;  3TQY A;  2JA6 G;  2VY3 A;  4L5T A;  3CME A;  1FGU A;  1CUK A;  3U58 A;  4Y7N H;  4PMW A;  4EX5 A;  5C3E H;  4B3S Q;  2MO0 A;  1XPO A;  4IJH A;  3CCV A;  4DV3 L;  3GDE A;  4DV4 L;  4C2M H;  4YWM A;  2HQL A;  2Q2H A;  3AQQ A;  2UXC L;  2GVB A;  4QL5 A;  4NXM L;  3RLO A;  1EFW A;  3ULJ A;  2UUB Q;  4X66 L;  3F2C A;  3S14 H;  2KBN A;  1IZ6 A;  3I4M H;  5IYD G;  3RLN A;  1A8V A;  1PH2 A;  4LF7 Q;  2AWN A;  4DR5 L;  1JJG A;  5GAE C;  2A1A A;  4LFA Q;  3HKZ G;  4BY1 G;  1N34 L;  3CCQ A;  1TWF H;  3CPF A;  5C44 H;  1NMG A;  4GKK L;  4DR1 L;  4EQ5 A;  4LF6 Q;  4X6A H;  1I5F A;  1SRU A;  2JK8 A;  1B7Y B;  2UU9 L;  2ZTE A;  4B3M L;  1X54 A;  2MNA A;  3I7F A;  1WCM H;  3J7A 5;  2MFI A;  5FLM G;  3EBE A;  2JQO A;  2KHI A;  3J81 c;  2VNU D;  2CFM A;  2NZO A;  4A3G G;  1CKN B;  4AYB E;  3GTP H;  2PQA A;  4GNX B;  3S16 H;  3PV0 A;  1KC8 C;  4A3I G;  1W3S A;  2YTV A;  3E0E A;  4HJ7 A;  4DR5 Q;  2PI2 E;  1E7L A;  1JT8 A;  1K9M C;  3HOY G;  1X56 A;  1N34 Q;  4LFA L;  5GQO A;  1T9H A;  1I3Q H;  1L1O A;  3JAM c;  1PH3 A;  1Q1E A;  1TXY A;  2QNF A;  5JEA J;  3FKI H;  3CC7 A;  1K8A C;  4DR1 Q;  4JYA L;  1Q12 A;  2D62 A;  1QVG A;  4NXN Q;  3NEM A;  1U5K A;  4DKA C;  4GLX A;  5LMN L;  3CCL A;  1X3G A;  3D0F A;  4GKJ L;  1E3P A;  4YHH Q;  1HR0 Q;  3HOV H;  3K8A A;  2OTJ A;  1L1O B;  1Z9F A;  4GLA C;  1FJG Q;  1MIU A;  4P71 A;  4X62 Q;  1RL2 A;  1EOV A;  4QJF A;  1LM0 A;  2CKZ B;  3U4V A;  1PFS A;  4DAM A;  4JI2 Q;  4AYB G;  2Z6K C;  1PYS B;  1Q46 A;  3PO2 G;  3G4S A;  4UP7 A;  2QA4 A;  4A3C G;  4A93 G;  1P8L A;  4DR3 L;  2PI2 A;  1WYD A;  1XMO L;  1VQ7 A;  4JI5 Q;  4POF A;  4DR6 L;  1S72 A;  2ZM6 Q;  1GKH A;  3PCO B;  4A3L H;  2NVX H;  3GD7 A;  3HKS A;  3CPW A;  3I55 A;  1XJV A;  3KOJ A;  5IYC H;  3K0X A;  3GTO H;  4TVA B;  2A8V A;  2AHO B;  1VQG A;  4GKJ Q;  1KD1 C;  1XPU A;  1I50 H;  1DGS A;  3F8T A;  1X55 A;  1YI2 A;  3HKZ E;  2R92 G;  4A3D G;  4BBR H;  4DV6 L;  4HIM A;  3CQZ H;  4R4C A;  2HIV A;  2YTX A;  4LUZ A;  1XNQ Q;  5IP9 H;  2EQS A;  1E22 A;  1TWC H;  2AKW B;  3BJU A;  1FVI A;  4DUZ L;  1X9N A;  4DV1 L;  3A5Z B;  3M4P A;  3CP0 A;  4FDB A;  2JJQ A;  3S24 A;  2HJQ A;  1XMO Q;  4LFB Q;  1B8A A;  2ASB A;  1D7Q A;  4ALP A;  4LF5 L;  4OO1 G;  2Y0S G;  1A0I A;  4MZ9 A;  3H3V H;  4L5Q A;  2RHS B;  5IT9 c;  1HNW L;  4DV0 L;  3HOV G;  2MO1 A;  3OYY A;  3HFZ B;  4JI7 L;  4DV6 Q;  4IJL A;  3S1N H;  2E8G A;  2I0Q A;  3CCE A;  4MNO A;  2UUA L;  2Q2I A;  4OX9 Q;  4UP9 A;  4A3F H;  3HOW G;  4KI0 A;  4JCV E;  3EIV A;  3A0J A;  4PZ7 A;  4JOI C;  1VQP A;  2ALY B;  4YCV A;  2EIF A;  3RR5 A;  4DV1 Q;  3K7A H;  5BR8 L;  1KRS A;  1PH1 A;  1V9P A;  2ZTD A;  1OXU A;  4BA1 I;  4DNI A;  3AEV A;  4DR4 L;  1VQ8 A;  4LFC L;  1GD7 A;  3PO3 G;  1PH4 A;  4R1J A;  1JMC A;  3H0G H;  3ZJY C;  4OO1 I;  2ZJR A;  4BY1 H;  4AQY L;  1Q1B A;  2PNH A;  4K0K Q;  3GTG H;  3KF8 B;  4OWX B;  4JI7 Q;  3S1M H;  3MXN B;  5JJL A;  4GOP A;  4XTC S;  2XGT A;  3RZD H;  5FLX c;  1CKM A;  4B3M Q;  4P74 A;  2Q2U A;  1VQD A;  2HIX A;  3S17 H;  5JJI A;  4B3S L;  1OTC A;  4GNX C;  1IBM Q; 
#chains in the Genus database with same CATH topology
 5J3B A;  3CC4 A;  4DN4 M;  1H9E A;  5AJ3 L;  1EOT A;  4Q0F A;  5M3F H;  3L9A X;  5C4X H;  3JAM L;  1XX8 A;  3RN5 A;  3GTM H;  2AUK A;  4R4T A;  2FXQ A;  2CHB D;  1AZQ A;  4GKK Q;  4GN3 B;  1BR9 A;  1Y1W H;  1PTO H;  1PLF A;  3VYU A;  3PF4 A;  1BDO A;  3JAM E;  1GOZ A;  4KKS A;  1H9S B;  3GTK B;  3MXN A;  1XPR A;  2OTL A;  2V4D A;  1SNC A;  2RCN A;  3KLS A;  3HOU B;  4HCE A;  1SYG A;  4LW1 A;  4WJW A;  2JEA I;  3DUZ A;  1TT2 A;  2XN9 C;  1M90 C;  3T1H L;  4Z9C B;  4BS9 A;  1TWH B;  2I5M X;  1HXY D;  1SXT A;  4R8I A;  1HR0 L;  1XNR Q;  1H9F A;  5EAY A;  2JEB I;  4DF7 A;  3M3Y B;  4RA8 A;  4C1N K;  1Y1V B;  4R4Q A;  4ZUJ A;  2KEC A;  2JA5 H;  3LWU A;  4DUY L;  5IP7 H;  4XT1 B;  3K59 A;  5GRO A;  2OCE A;  3OPO A;  4OWT B;  3JC6 6;  2EYH A;  5ELD A;  1ET6 A;  4YY3 L;  1ONL A;  4CDC C;  4C3J B;  2QIL A;  5A2Q E;  4IFD H;  5COR A;  3ULP A;  2R7F A;  4AH6 A;  2TMP A;  4IZ8 A;  4OON A;  1M1K C;  2K01 A;  1VMP A;  4C2M B;  2K33 A;  1K83 H;  4A76 A;  4PMB A;  2DY8 A;  1Q3L A;  1DOK A;  2UXC Q;  1YHA A;  2KHJ A;  3JAM i;  3SR1 A;  2WAQ G;  2O5I C;  1W2B A;  4A3J H;  4O42 A;  1NUC A;  3BZK A;  2F0L A;  3CXC A;  2JA5 G;  2I46 A;  2J7Z A;  3HS0 C;  2K5D A;  4DK3 C;  3J7Y W;  1C8C A;  2F0V A;  4BBS B;  3K58 A;  5C0X J;  4BA2 I;  4ODG A;  4C3I H;  3F1Z A;  1N33 L;  4MN3 A;  3PUV A;  3J80 c;  2KEE A;  4KY6 A;  4C3H G;  1ET9 A;  1LV9 A;  5EKK A;  2LFN A;  4A3D H;  5GAH C;  2D9U A;  3S2H H;  2EJF C;  4JV5 L;  3PGZ A;  3M85 A;  2V1C C;  4JBW A;  3HOZ G;  1IL2 A;  5C3E B;  2F4V Q;  1R4P B;  3AFP A;  4IUP A;  1CQF A;  4MTN A;  4A4I A;  1HZB A;  1JEQ A;  2CH4 W;  3BDO A;  4GS3 A;  4OGQ C;  4TKO B;  4EQO A;  5EJW A;  3PIO A;  2A74 C;  2F0G A;  1Y8N B;  2LC3 A;  1HNZ Q;  3M9B A;  1HH2 P;  5C0X G;  3IKJ A;  3IRB A;  1EEF D;  1IXR A;  2RBM A;  2A6H C;  2M9V A;  3UI2 A;  4UAI A;  4JBK A;  1V1P B;  1WTP A;  4B3T Q;  3M7N A;  3T1Y Q;  2MP1 A;  4F88 A;  1YIJ A;  2YU9 H;  3TP8 A;  1SLJ A;  4OIK A;  2WFW A;  1C0A A;  2ZM6 L;  3A5U A;  1GM5 A;  1P16 A;  4LF4 L;  1CQV A;  4LWC A;  2E2H B;  5NUC A;  1XYI A;  2RSO A;  2R7Z H;  3G48 A;  3K81 C;  1A62 A;  1WTH A;  5FJ8 H;  1I50 B;  1PHJ A;  4I7A A;  3U9S A;  2D5D A;  4ABN A;  1EWI A;  4C3H H;  3J7Z C;  1NMF A;  3ERO A;  4K2L A;  2EDG A;  3STB C;  1TII D;  5G3L D;  2H5X A;  2DNE A;  4YCU A;  2WAC A;  1H95 A;  1MSG A;  2VW9 A;  4YIJ A;  4FP5 D;  1F9Q A;  3NEN A;  2F0K A;  5ELO A;  5FLX E;  5CV9 A;  1IKL A;  1YHB A;  1W6J A;  3I56 A;  2N78 A;  2C5C A;  4JI1 L;  1E7Z A;  1E2V A;  1C7Y A;  4XXE A;  4A3B H;  2IPK D;  2E5L Q;  4IAL A;  4O0A A;  1PMR A;  1O78 A;  1VQ6 A;  2WB1 E;  4IQZ A;  1A2T A;  2KCM A;  4APV A;  2F52 A;  2IHE A;  4DV4 Q;  4X3T A;  1LTR D;  3KF6 B;  3W5O A;  1TR5 A;  1UE6 A;  3OWF A;  2CQO A;  5EKI A;  4HJA A;  1ZXT A;  2VS1 A;  2L12 A;  4J1M A;  2F3I A;  4DV2 L;  2L4N A;  4NP5 A;  1PDQ A;  1E1O A;  2KFV A;  4KY7 A;  1LLR D;  3IL8 A;  5D65 A;  5BN4 A;  2JA7 G;  4KD3 A;  1X3P A;  1BOS A;  2VB2 X;  3M4Q A;  2F4V L;  3I72 A;  2VB3 X;  5E1F A;  3NE5 B;  5KYL A;  1ENC A;  1F2Z A;  1HZC A;  5LHY 1;  4R4I A;  4A3C H;  1SYB A;  4G57 A;  1ZYR D;  1MSH A;  1HNW Q;  1IBK Q;  1CT1 D;  4JYA Q;  3AFQ A;  5FO9 B;  2VUM B;  4A3E B;  5JEA G;  3UDX A;  4PZ6 A;  2HHH Q;  3KFU A;  3RLF A;  2X6L A;  4HSV A;  1GVP A;  4B3T L;  3OTO L;  2GA4 B;  1PFB A;  1PV4 A;  2F0H A;  1MGS A;  3LGJ A;  3MXP A;  4PNY A;  4TRD A;  1EQT A;  3NUC A;  5KIX A;  4E6I A;  1VQM A;  5HGQ A;  4UPA A;  5C4J H;  2HT1 A;  4DR3 Q;  1G6P A;  3MHB A;  4HED A;  5C5M A;  3WWV A;  3H91 A;  5CR3 A;  5IWA Q;  4DV7 Q;  1YIT A;  1OXV A;  5M3M B;  4L8J A;  2Q2T A;  2YV5 A;  1PTO B;  2XWB B;  1BVS A;  2WIN B;  1GJX A;  2IWH A;  4B3R Q;  2OEO A;  1JJC B;  5IE8 A;  1EY9 A;  2LS0 1;  1QNU A;  3C1F A;  3EA6 A;  2B63 B;  4A3G B;  2K03 A;  1AP0 A;  2ATW A;  4X3U A;  3DWQ A;  1ASY A;  4ME3 A;  5IOC A;  4GOP C;  4K5X A;  3X3N A;  5KGU A;  3PIP 3;  4N8F A;  4H02 A;  3UE1 A;  4IUT A;  5CV8 A;  2PMZ E;  3E6Z X;  3SK6 A;  2ZJQ A;  3MFG A;  3TQY A;  2JA6 G;  2XIW A;  3Q6S A;  1CZG A;  1GUG A;  4PMW A;  4Y7N H;  4B3S Q;  3I8Z A;  1XPO A;  4DV3 L;  4DV4 L;  4YWM A;  2HQL A;  2Q2H A;  3QB3 A;  2UXC L;  5DAU A;  3OSO A;  4QL5 A;  3RLO A;  3ULJ A;  2UUB Q;  4FF4 A;  3F2C A;  4G7Z C;  2AQ2 B;  2F0Q A;  1PFN A;  3ERQ A;  1D1I A;  4DR5 L;  4RHR A;  1GUS A;  3VYR A;  1IYV A;  2A1A A;  3TP7 A;  3CCQ A;  2RKS A;  2NTS A;  2KJX A;  3FPU B;  2L5T A;  2F0I A;  1Y8P B;  4N9T A;  2UU9 L;  2ZTE A;  1WCM H;  2K6A A;  1W6K A;  1ZKO A;  2NZO A;  4ILW A;  3BDL A;  4N9P A;  3PV0 A;  1JB3 A;  1K83 B;  3E0E A;  1JT8 A;  2PI2 E;  1K9M C;  1A3U A;  4OO1 H;  1TXY A;  2QNF A;  4JYA L;  2D62 A;  1QVG A;  4NXN Q;  1GHJ A;  3NEM A;  1IKM A;  5I6Y A;  3CCL A;  4QUF A;  3VR3 A;  1EYD A;  1DOM A;  2OTJ A;  1L1O B;  4P71 A;  4H7B A;  5I6W A;  4OHJ A;  1EOV A;  3FKI B;  1RD9 D;  2KQ3 A;  1CFM A;  4NW2 A;  5CIU A;  1Q46 A;  3PO2 G;  4HAE A;  4DR3 L;  4KV6 A;  4POF A;  2XRS D;  2ZM6 Q;  3PCO B;  3CPW A;  1BCP D;  2MPH A;  5EQ0 A;  4UHV A;  4XYO A;  3K0X A;  3GTO H;  4TVA B;  1BF4 A;  2L9H A;  1PYW D;  3MFY A;  2B2V C;  4FXK C;  4BBR H;  2PCF B;  2HIV A;  4RGO S;  4LUZ A;  3I4L A;  5IP9 H;  1SBB B;  5C5L A;  4FDB A;  3DM1 A;  1QOH A;  1B8A A;  2ASB A;  3MTS A;  2WAQ B;  4LF5 L;  4OO1 G;  1K8M A;  4DV0 L;  2MO1 A;  4DV6 Q;  2Z9H A;  5TSS A;  2Q2I A;  4PMC A;  4A3F H;  3GTG B;  2NZ1 D;  1VQP A;  4DV1 Q;  2EIF A;  4M1U B;  1PH1 A;  3TN2 A;  4DR4 L;  1VQ8 A;  1LTT D;  3QKJ A;  2F0J A;  1PH4 A;  1JMC A;  3H0G H;  2HDL A;  2QDB A;  4OO1 I;  1Q1B A;  2HUG A;  4EQP A;  4OWX B;  2EYP A;  4JI7 Q;  1F2L A;  1O80 A;  4J8Q A;  4GOP A;  4R9W A;  1CKM A;  4MTK A;  2Q2U A;  2HIX A;  3S17 H;  1OTC A;  4CKE A;  1IBM Q;  4X64 L;  1TY2 A;  1E2Z A;  3DMU A;  1TY0 A;  3CQZ B;  2IHF A;  3S2D H;  5JAV A;  5KNC A;  1B4O A;  4K14 A;  4XIG S;  1K3R A;  1PA6 A;  2ICE C;  4QGU A;  3S1M B;  2Z6B A;  1QVC A;  4A75 A;  1N32 Q;  4A3M H;  1UAP A;  2GVA A;  2DN8 A;  3A8I E;  3FKI G;  4JI3 Q;  2F0U A;  2UXD Q;  3GV6 A;  4RHS A;  2ID0 A;  5C3E G;  3KDF B;  1I6H B;  1JOR A;  1JOQ A;  1N36 L;  4CBV A;  3Q0A A;  4POG A;  5C4X G;  4F87 A;  1IBK L;  1M8A A;  2E2I B;  4WJ4 A;  4A3K G;  4DNT B;  1YNN C;  1E1T A;  1UEB A;  2IJ0 A;  2XRQ D;  2BH2 A;  3CW2 C;  1V1Q A;  5IP9 G;  1EU3 A;  1HQM C;  2UUC L;  4O1N A;  4CDE C;  1LT3 D;  3IFD A;  1RDP D;  1HUM A;  1EY0 A;  2K32 A;  1FYC A;  2AWO A;  4TQU S;  4DXG A;  4A3M G;  2JA5 B;  2NVQ B;  3NHH A;  2BDN A;  2KVD A;  4CJ0 B;  1SE2 A;  2EZV A;  2K28 A;  2B2T A;  3M4Y A;  1Y8O B;  5I2Y A;  2ZJP A;  3A7L A;  4RCO A;  5M5Y B;  1SDF A;  2R61 A;  1PH9 A;  4HIK A;  1IL8 A;  1LTL A;  4YCW A;  1AEX A;  2A68 C;  1XXG A;  3KJP A;  5FLM H;  4A3E H;  2MHV A;  1Q81 C;  1OXT A;  4HID A;  1UE5 A;  3LLR A;  1VQH A;  5KNB A;  1BNZ A;  3S1R H;  2A68 D;  1F2Y A;  1L2F A;  1UNS A;  4LUV A;  4JBM A;  2Z6K A;  1EFI D;  5FO8 B;  2KCT A;  3KYH C;  3HOW B;  3G6E A;  2LXJ A;  1IBL Q;  5IOD A;  3VR2 A;  1VQO A;  1MJE A;  3KBG A;  1DXM A;  1ZBH A;  2CWA A;  3SEB A;  2QKI C;  3CMA A;  3BDC A;  3S9W A;  4RFB A;  3RMH A;  3J80 E;  4CDF C;  4IFD G;  4DV3 Q;  5I4D A;  3NWT A;  3T53 B;  5IIF A;  4IOA A;  3BYY B;  5IGE A;  4IOC A;  4L6T B;  1Q7Y C;  3CC2 A;  3BU2 A;  3NXW A;  1X6O A;  4DGZ A;  1LO5 D;  1STN A;  3AB9 A;  3CCM A;  1IBM L;  1GUO A;  1VQJ A;  3F2B A;  3NK9 A;  3I4M G;  1WFQ A;  4H0L C;  2EVB A;  4OWW B;  4P72 A;  2UU9 Q;  2VQF Q;  2I5L X;  2RNO A;  2K50 A;  1SR3 A;  2NVX B;  3D4R A;  4QIW B;  4Y7N B;  4JI4 L;  2Q8R E;  1JQY D;  5CV5 A;  3SK4 A;  5H1S E;  1BCP B;  3NPP A;  1V1P A;  2CQA A;  2YU9 B;  4F8M A;  5C6A A;  5LMN Q;  1VF5 C;  2ZXP A;  2E75 C;  4YWK A;  1B9N A;  2PYK A;  3URY A;  1HFG A;  2ZXO A;  1C48 A;  1LT5 D;  4IFD J;  4EGV A;  4JI2 L;  2UUC Q;  4JI6 Q;  4NPS A;  2HCI A;  4DPG A;  1IYU A;  3W3A A;  2EYO A;  5IT9 E;  5C44 G;  4BBR G;  2LXK A;  4YWL A;  1I4R A;  3LNN A;  3STB D;  3PUZ A;  2B2T C;  1KL9 A;  4KKT A;  1TS5 A;  5M5W H;  5M3F G;  1KHI A;  1HA6 A;  4RKL A;  4KHP L;  3D31 A;  5L37 A;  1QZH A;  1D2B A;  1V43 A;  1SND A;  2B63 G;  5ISR A;  2RVL A;  2JYO A;  2WAQ E;  1EZ8 A;  4JW0 A;  1C9O A;  4ZUI A;  2F0M A;  4CDD C;  3HOU G;  1KAA A;  1J5E L;  4BXX G;  3RNU A;  3HGB A;  1S3O A;  1S5E D;  5ELF A;  1O7Z A;  1VQA A;  3TME A;  3H15 A;  1EUJ A;  3OW2 A;  4X3K A;  1LT4 D;  1SE4 A;  2ES2 A;  1F9S A;  1OO9 B;  4OX9 L;  1TS2 A;  2H1E A;  2Z4I A;  4JOI A;  5J39 A;  1GUT A;  3KF6 A;  1AH9 A;  3DEO A;  4B9W A;  2EE1 A;  1AFP A;  3LX0 A;  4LFC Q;  1ESR A;  2JN4 A;  3GTO B;  3SK5 A;  1TWG B;  2SDF A;  3L3O C;  2L15 A;  2KVM A;  4A3L G;  1PVO A;  2DGY A;  5JPM C;  1UWV A;  3TS0 A;  5DNF A;  1H1J S;  4K0K L;  1NY4 A;  5J22 A;  4WRD A;  3K7U C;  5LMU Q;  1HHV A;  1I4X A;  2C9O A;  2JA9 A;  1I4G A;  1VF7 A;  1WVL A;  2E74 C;  4PG3 A;  2YTY A;  1Y1V G;  3NTI A;  1S4Z A;  5K5P A;  4OXP A;  3KBX A;  3AYH B;  2R92 H;  1O7I A;  2K7V A;  1STE A;  1SNM A;  2PMZ B;  3I2Z A;  4QMG A;  2OXP A;  1ZYR C;  2Q8I B;  5M3F B;  4KJO A;  3CCU A;  5C4X B;  3PO3 B;  1JWU D;  2YYZ A;  1K73 C;  4A3F B;  2G80 A;  1JWS D;  3A55 A;  3VDY A;  4A3K H;  2JA8 B;  1Z47 A;  1YNS A;  3B6Y A;  5CC4 A;  1TVX A;  3QIA A;  1SJE D;  1H9R A;  1ROD A;  1Y14 B;  2K4K A;  3GTL H;  3D4D A;  3FHW A;  5EBD A;  1ENF A;  1BBW A;  2DY7 A;  5JPN C;  1Q8K A;  2A19 A;  3CRK C;  2A69 D;  3OIQ A;  1KDA A;  1KDB A;  3UE0 A;  4BY7 G;  4JI6 L;  4JV5 Q;  1KDC A;  3J7A V;  3EJI A;  3CCJ A;  5DEH A;  1QE6 A;  4NDX A;  3DLL A;  3UDI A;  4BXX H;  5EGT A;  1VQF A;  3J81 i;  3S2D B;  4DR2 Q;  5HGT A;  1QVF A;  1HNX Q;  1TWH H;  4IPC A;  1VQN A;  1HNZ L;  4KKU A;  3ULL A;  2D0O A;  4A3G H;  4KHP Q;  1ESF A;  4QY7 A;  1HRJ A;  2WII B;  3I73 A;  1SYD A;  2OQ0 A;  5E4X A;  4HJ9 A;  1EEI D;  2K05 A;  4DXF A;  3HOZ H;  5D3I B;  5JJZ A;  1I6H H;  5EBC A;  3KDF A;  1HZ9 A;  5ELC A;  1XMQ Q;  3FEW X;  1SE3 A;  2E2I H;  2K5W A;  2NWG A;  2WP8 J;  4RGM A;  3RN2 A;  4JK1 C;  2KCC A;  2BA0 A;  3SE0 A;  2A6H D;  2WQG A;  4U67 3;  2AQ3 B;  2B3G A;  4PZ8 A;  4RH6 A;  1NR2 A;  1B44 D;  1PH7 A;  1CKN A;  1GXD C;  4L5S A;  3U4Z A;  2NVT B;  2KUM A;  1BQQ T;  4L5T A;  3CME A;  1CUK A;  3U58 A;  4EX5 A;  2OT2 A;  4IJH A;  3NWS A;  3TZD A;  4FF1 A;  2GVB A;  1H9J A;  3I4M H;  2FIN B;  2QF7 A;  4LF7 Q;  3C46 A;  3K5O A;  5GAE C;  1TWF H;  3CPF A;  5C44 H;  4HMJ A;  2SEB D;  1AN8 A;  2IL8 A;  3NTK A;  2JXM B;  4RAU C;  4EQ5 A;  3BVG A;  1I5F A;  5FKA C;  1I4Q A;  4KMU C;  1E2W A;  1KTK A;  1G6Z A;  1TWC B;  1S5F D;  2MFI A;  2P5Z X;  3J81 c;  3A54 A;  2FJ2 A;  2PQA A;  4GNX B;  1TS4 A;  4A3I G;  1W3S A;  2YTV A;  1A15 A;  4HJ7 A;  1E7L A;  1MI2 A;  1X56 A;  1N34 Q;  4LFA L;  5J1Z A;  1I3Q H;  1L1O A;  1PH3 A;  3BYT B;  1IW7 D;  4BWG B;  3FKI H;  3CC7 A;  2JA6 B;  1DOL A;  4DR1 Q;  4GLX A;  3IAY A;  5LMN L;  2O4X A;  1HTL D;  4GKJ L;  1WTW A;  2LKV A;  3HOV H;  3K8A A;  2KED A;  4GLA C;  3TBI B;  1Q90 A;  2CKZ B;  4JI2 Q;  3G4S A;  4K5W A;  4OL7 A;  2PZT A;  2PZU A;  2QA4 A;  1WYD A;  1XMO L;  2AUJ D;  1GKH A;  4A3L H;  2DJF C;  2NVX H;  3GD7 A;  1XJV A;  2ICI A;  3KOJ A;  1VQG A;  2F0W A;  1SNO A;  1Z6H A;  1S5D D;  1ILQ A;  1EIG A;  1KD1 C;  1XPU A;  4A3D G;  1GL9 B;  2WV6 D;  1DON A;  1JOO A;  1MD2 D;  5D14 A;  1XNQ Q;  3A8J E;  2AKW B;  1X9N A;  3M4O B;  3A5Z B;  3CP0 A;  4K2K A;  2NBF A;  1G91 A;  2JSO A;  3S24 A;  3K5L A;  1HA5 A;  1SYE A;  1D7Q A;  2NTT A;  4ZKB B;  4MIU A;  5CMD A;  2A69 C;  1Y1W B;  4L5Q A;  2RHS B;  1LT6 D;  3BVZ A;  5IT9 c;  3S1Q B;  2EYM A;  2CW0 D;  5DM6 3;  3S1N H;  4V0B A;  2UUA L;  4OX9 Q;  3WDN A;  3Q23 A;  3HOW G;  2EY6 A;  1B1Z A;  4JCV E;  2B2U C;  4IUU A;  3PO2 B;  2ALY B;  3RR5 A;  2EPB A;  4BIT A;  5BR8 L;  1KRS A;  4A3I B;  4DNI A;  3R3O A;  3AEV A;  4LFC L;  3PO3 G;  1EIH A;  5JOB A;  2ZJR A;  4BY1 H;  2ENB A;  1T5E A;  2PNH A;  3MA2 B;  4K0K Q;  2NUC A;  1H9S A;  3S1M H;  3MXN B;  2A6E C;  3VYS A;  4QB4 A;  2BOS A;  4B3S L;  1JIC A;  4LMQ D;  5C0X H;  2K14 A;  4C1N I;  3WOE A;  1BO0 A;  1MBY A;  2IT1 A;  2UUB L;  1JWM D;  1FNW A;  1HJP A;  3K0Y A;  3H09 A;  5IYD H;  4AQY Q;  4FO2 A;  1EU4 A;  2G5D A;  5IGF A;  4DK0 A;  4ZLT F;  1PH8 A;  1YNN D;  5DM7 3;  1TWG H;  3P7J A;  3NEL A;  1B2T A;  1RKN A;  1NBW A;  2IW3 A;  2MPM A;  4A3F G;  1WTQ A;  1X65 A;  1U4R A;  3DM3 A;  2VUM H;  2PQE A;  2XWJ B;  4DAP A;  1A3V A;  4R4O A;  3V96 A;  3A7A B;  2NVQ H;  5FO7 B;  1XNR L;  3R8B A;  3GTQ H;  1CKO A;  1XTC D;  1KLG D;  2EXD A;  3D6W A;  3I70 A;  3K7A B;  3GQB A;  3BZC A;  4UP8 A;  3OMC A;  3NSW A;  1SMX A;  1CHQ D;  4KK7 A;  1YJN A;  2ODG C;  4BBS H;  1K3B C;  4NXN L;  3E9H A;  3PUY A;  5GAD C;  4A3K B;  2AMC B;  2JA8 H;  5M3M H;  3OIP A;  3S1R B;  3DXJ C;  1E24 A;  3TRE A;  1U0L A;  5KRU A;  1XNQ L;  2KA7 A;  1EQQ A;  1NJI C;  1B50 A;  1VQI A;  1K8O A;  2J4X A;  1NSN S;  2JA7 H;  1EYC A;  4LF9 Q;  2F1M A;  1YJW A;  1B3A A;  2B63 H;  1IW7 C;  2ZTC A;  1XMQ L;  1D8L A;  1HR0 W;  1LAB A;  1I94 Q;  2R93 H;  1YHQ A;  3BZD B;  3PUX A;  1B9M A;  2NN6 G;  4P75 A;  4KTA A;  2L11 A;  2NN6 I;  5FOB B;  2B39 A;  3I4N G;  3CU7 A;  3T13 A;  1QB5 D;  5C0X I;  2O5J C;  3GTP B;  1X3F A;  4UZW A;  2G9H D;  1N33 Q;  5G3L F;  2OF1 A;  3N6R A;  4U68 A;  4Y52 H;  2KVU A;  4KN7 C;  2OQK A;  3I90 A;  2M00 A;  4IUN A;  1QG7 A;  1PRT B;  3Q24 A;  3GTK H;  4JI8 L;  2B2W C;  5CV7 A;  3MAQ A;  4YY3 Q;  3NQI A;  1SNQ A;  3W2D A;  2EY1 A;  4IN3 A;  4RGN A;  3P1H A;  4DA2 A;  4A3E G;  1PRT D;  3OHX C;  3Q22 A;  2R93 G;  4KN4 C;  4DV0 Q;  5ELE A;  3K6O A;  4LF6 L;  3RZO H;  4C3H B;  1JE5 A;  5M3M G;  3QG1 A;  1X3Q A;  1KRT A;  2NVY H;  2VXW A;  4IO9 A;  2NZH A;  2L1B A;  2KOL A;  1BKB A;  1AE3 A;  3MZ5 A;  1GO3 E;  1TWA H;  2LY7 A;  5JVG 3;  2H4O A;  1CHP D;  1K8G A;  1AE2 A;  3PIO 3;  3T1Y L;  1VQ5 A;  1UEA B;  5M9O A;  2CW0 C;  3RD4 A;  5K36 H;  3PF5 A;  1S5B D;  2R3Z A;  2QGQ A;  5C3X A;  2X6G A;  1SN8 A;  4BY7 B;  1WJJ A;  3O13 A;  3HKZ B;  1QIL A;  4FXG C;  4X64 Q;  2VQE Q;  2EYL A;  3MXG A;  3GTJ H;  1WD0 A;  1Q86 C;  2Z0S A;  4IUQ A;  4HJ8 A;  2F4I A;  1G8Z D;  3G71 A;  4CHT B;  1N32 L;  3FMC A;  4DK1 A;  4JI5 L;  4A3J B;  1SE8 A;  4GN5 A;  1CZW A;  3CHB D;  3QWN A;  5D3D A;  3CAM A;  1N36 Q;  2F3V A;  3OOC A;  1K0R A;  3TZU A;  2ODC I;  2JP1 A;  2PQA B;  3EQL C;  1SSO A;  5I2X A;  3BS1 A;  1NNX A;  4UDU C;  1QZG A;  3HOX H;  2E2J H;  3PSI A;  1Q82 C;  4LF9 L;  2JA6 H;  1VS0 A;  2E5L L;  1YEZ A;  1V1O A;  1HQR D;  3MC0 B;  3OMG A;  2RCF A;  4IPG A;  2C35 B;  5A2Q L;  3OWE B;  5JVH 3;  4K8J A;  1STG A;  3OW7 A;  4LF4 Q;  4IPH A;  2N3S A;  5EPL A;  1V66 A;  3ERS X;  1LYL A;  3L7Z C;  1QUQ A;  5E4W C;  3HP3 A;  2KVE A;  1SFO H;  1RTO A;  3T51 B;  3NP8 A;  2SNS A;  2DJG C;  3ND8 A;  4N8X 1;  3HOY H;  1UE7 A;  1STY A;  2F0F A;  2UUA Q;  1EIF A;  1RCV D;  1T5X D;  1NE3 A;  1G2S A;  3HOX G;  4JI8 Q;  3TRZ A;  2MJ8 A;  5IP7 G;  3TEH B;  5HY6 A;  3ER0 A;  4ZAI A;  1G29 1;  4HN7 A;  1PFM A;  2N88 A;  4JVZ A;  2B2Y A;  3KUP A;  5K36 G;  1ML0 D;  3P20 A;  1LTI D;  4BBS G;  1UE1 A;  1JOK A;  4MHE A;  1VQ9 A;  3IFT A;  2CVR A;  3RZD B;  4DFA A;  2RDH A;  3GTL B;  2R7D A;  3SHL A;  2Z4H A;  3S1Q H;  2K75 A;  4IPD A;  4DU9 A;  2JVW A;  1KXL A;  4IFD I;  4GN4 B;  1KQS A;  4A3M B;  3H6M A;  3Q8D A;  4X62 L;  4GOP B;  1FJG L;  2SOB A;  3PO2 H;  4HR7 B;  4ZKC B;  2PW5 A;  4A3I H;  2BH8 A;  2Q8T A;  1WTR A;  4DR6 Q;  2EXZ A;  3G6J B;  4DK6 C;  1PRT F;  5C3W A;  5IGG A;  1A6X A;  1CTM A;  4DV2 Q;  2VQE L;  3CCR A;  1O7Y A;  4PQX A;  3DHQ A;  1A3T A;  2FFK B;  4DV7 L;  1RIP A;  1WOC A;  4O2D A;  2HCC A;  1IYJ B;  4ZCK A;  1QUQ B;  2A6E D;  5LMN W;  4OIJ A;  3LWE A;  2WKD A;  4JI4 Q;  1PH6 A;  2RQX A;  5COY A;  3QO2 A;  2IY5 B;  1KIX A;  1F9P A;  4LFB L;  2SNM A;  4J6H A;  4AIM A;  1NTG A;  2BE5 C;  3UDG A;  4RGT A;  5M5Y H;  3EN2 A;  3OTO Q;  1KHC A;  4QF4 A;  2BE5 D;  2FMM A;  1ENA A;  2N8N A;  2B2W A;  5IYB H;  1EYA A;  4M8A A;  1Y1V H;  1JCK B;  3S15 H;  4KHV A;  4JC0 A;  4KHZ A;  1WTV A;  3D6C A;  4H13 C;  1I94 L;  1K0S A;  1B3Q A;  2D2C C;  1STA A;  1EQR A;  1LUZ A;  4XQN A;  2F03 A;  3ITP A;  5IWA L;  3I4M B;  3J81 L;  4WFN 3;  1EZ6 A;  1EY5 A;  1FGU A;  1SAP A;  2EY5 A;  1R9T B;  2MO0 A;  3SVM A;  3CCV A;  2NB0 A;  3GDE A;  4C2M H;  5KYI A;  2EY2 A;  1SJH D;  3AQQ A;  1D5X C;  5BN5 A;  2Y0S B;  3S14 H;  5I9O A;  2KBN A;  1BCP F;  1SEB D;  4ID6 A;  3RLN A;  2JA7 B;  1PH2 A;  4ZK9 B;  1JJG A;  3FRP B;  3GV3 A;  4BY1 G;  4KJN A;  2HQE A;  1CI3 M;  1NMG A;  4GKK L;  2EJM A;  2L0C A;  4LF6 Q;  3D8G A;  2KW9 A;  1B7Y B;  4LK1 C;  4B3M L;  3VA7 A;  1NCV A;  4L63 B;  3TSS A;  5FLM G;  3KF8 A;  5FLX L;  3EBE A;  2JQO A;  2MGS A;  2VNU D;  4A3G G;  3GTP H;  4P2C B;  3S16 H;  3HG9 A;  4DR5 Q;  1HUN A;  5C4H A;  3HRZ C;  1T9H A;  5JEA J;  1Q12 A;  1Y69 U;  2B2Y C;  1D1K A;  3D0F A;  3WOF A;  3VR6 A;  1E3P A;  1HR0 Q;  2KHS A;  1QJO A;  1MIU A;  1NAP A;  1EL0 A;  4QJF A;  1LM0 A;  3H0G B;  1JE4 A;  1PFS A;  5I9P A;  3TDQ A;  5IT9 L;  3F2U A;  1QNK A;  3QOJ A;  4A3C G;  4JI5 Q;  3FVQ A;  2PI2 A;  1VQ7 A;  1BXT A;  4A93 G;  1EY7 A;  5AFW A;  4C56 C;  5CGK A;  3K57 A;  3I55 A;  3S17 B;  4PV1 C;  2A8V A;  1YNJ C;  1FD7 D;  1I50 H;  1DGS A;  1YI2 A;  1STB A;  3M7G A;  4DV6 L;  1GUW A;  3NTH A;  3CQZ H;  2F3W A;  4HIM A;  1F9R A;  1HTP A;  2WKC A;  2O2L D;  4C3I G;  4DV1 L;  3M4P A;  2JJQ A;  2HJQ A;  5CYU A;  3T4A C;  4ALP A;  1GJJ A;  1SYC A;  3KLR A;  2Y0S G;  1A0I A;  1TKW B;  4MZ9 A;  4IUR A;  3X3M A;  2EJG C;  3HOV G;  3OYY A;  2W51 A;  2K04 A;  3HFZ B;  5CV6 A;  4JI7 L;  2E8G A;  3CCE A;  3NQT A;  4MNO A;  4XT3 B;  4UP9 A;  3I4N B;  4TSS A;  4PZ7 A;  2QDL A;  4A3B B;  2B8F A;  3DEP A;  4AYB B;  4EQN A;  3VR4 A;  1OXU A;  2DNC A;  3GP7 A;  2E2J B;  3E3X A;  4QUC A;  1L0X B;  3KF8 B;  3J80 L;  1J8I A;  1Z7T A;  5JJL A;  3CKI B;  4EVO A;  5FLX c;  4B3M Q;  4P74 A;  1VQD A;  1WTO A;  1VQK A;  1D5Z C;  4QIW E;  1G51 A;  2QW7 A;  2R6G A;  1E7D A;  5FJ8 G;  4WJ3 M;  4A93 B;  1NR4 A;  3CCS A;  1KNA A;  3NBI A;  1II3 A;  3L2P A;  3SGI A;  2UXB Q;  3GTQ B;  1XTD A;  3U50 C;  2PNR C;  3HOW H;  1RJT A;  5IGB A;  2RDG A;  2K5V A;  3KJO A;  4JG2 A;  2RNN A;  4KLK A;  3E5S A;  1KAW A;  5C4Z A;  1WCM G;  3BVM A;  2BCO A;  5JJK A;  1MHW C;  1CA6 A;  2Y0S E;  4LF8 Q;  4B08 A;  2D0P A;  1UUP A;  4J15 A;  2E2D C;  3CD6 A;  4JI3 L;  4A3B G;  2UXD L;  4HJ5 A;  4ME5 A;  2K52 A;  1N9W A;  2A73 B;  5IYC G;  5IYB G;  5C4J B;  3PQI A;  1BBX C;  3TS2 A;  4RMF A;  5CBA E;  3EFX D;  4QQB X;  4GZY C;  3A8K E;  2XNA C;  2GN5 A;  5IY0 A;  4XQQ A;  1O7L A;  1I4P A;  2AQ1 B;  3KLW A;  1EQV A;  2BA1 A;  1Y02 A;  4G4K A;  4JI1 Q;  3UDF A;  1YZ6 A;  5ELB A;  1OXX K;  3I3C A;  2MUY A;  2EYJ A;  1A2U A;  1HCZ A;  3HOU H;  4Q5V A;  3V05 A;  3C2P A;  1MJC A;  3I91 A;  2RF4 A;  1JB7 A;  1DZ1 A;  1YVC A;  1Q8I A;  2I5H A;  3A56 A;  4K5V A;  5IGD A;  4DR7 L;  3CF5 A;  4DAY A;  5FK9 C;  1ZEQ X;  2RA4 A;  1DYQ A;  2N49 A;  1EN7 A;  2IX0 A;  4CKB A;  2NVT H;  3KK7 A;  2CH4 A;  2K5Q A;  3TP6 A;  1VCI A;  5T1I A;  2B29 A;  4K6D A;  1DCZ A;  3KLS X;  1ASZ A;  3RZO B;  3HZX A;  4DV5 L;  4X3S A;  4V19 0;  2JA8 G;  4NXM Q;  2L55 A;  3L0O A;  4X66 Q;  3I4O A;  4C3J H;  3MXU A;  1CSP A;  2XTI A;  4X65 L;  1J9O A;  1PZJ D;  1VQL A;  4K6L A;  1TWA B;  5IGC A;  2QEJ C;  3MEH A;  1YNJ D;  4G7H C;  5C44 B;  2CCZ A;  5M5W B;  1X32 A;  1EIY B;  1SNP A;  1B70 B;  2JE6 I;  3GO5 A;  1IBL L;  1GHK A;  2WB1 G;  3RUZ A;  1TS3 A;  1HZA A;  2VL6 A;  3QOL A;  3S15 B;  1HNW L;  4NB3 A;  4R8N A;  1U9R A;  1KAB A;  2RHQ B;  1D5M C;  2HHH L;  5BR8 Q;  2VZA A;  3W1B A;  4BY7 H;  2ZXR A;  1QWY A;  1KNE A;  4FNF A;  2F0T A;  1VQB A;  3HEJ A;  2UXB L;  2F0D A;  4ULL A;  5ELN A;  4C3I B;  1R9T H;  2DK4 A;  1I3Q B;  3R2I A;  3J81 j;  5DLQ E;  1A63 A;  4UY8 C;  4RWS C;  2X69 A;  3G7L A;  1BUV T;  4L5R C;  2B2V A;  3A74 A;  4A3D B;  2TSS A;  4JI0 Q;  1R4Q B;  2DUD A;  3D3R A;  2A5H A;  1CM9 A;  1LAC A;  2F0O A;  3NBH A;  4YHH L;  3HOV B;  2HDM A;  2VQF L;  1PZK D;  3VR5 A;  4CJ2 C;  4FVM A;  5T1G A;  3FP9 A;  2IX1 A;  2R7Z G;  4OEM B;  1OXS C;  1XWE A;  1TQO A;  4RCN A;  4B3R L;  5GAG C;  1J5E Q;  2CWP A;  1J6Q A;  1PYB A;  2RSN A;  3H0G G;  4XYQ A;  1EWH A;  2XVS A;  1WI5 A;  2KCN A;  1F2M A;  1FR3 A;  2Z1C A;  1BBU A;  5KEE A;  1MKH A;  3QR8 A;  1PH5 A;  2R92 B;  4ZQ3 A;  1L1O C;  4HIO A;  4XQJ A;  2PPB C;  4QCL A;  2G9D A;  5M5X H;  1EYG A;  3H3V C;  1SFO B;  4DAY B;  3PO3 H;  4BBR B;  1STH A;  4DUZ Q;  3M4O H;  4F7X A;  3VA5 A;  2E2H H;  1ZS9 A;  4JPB W;  4LJZ C;  4S3S A;  5BN3 A;  1VDZ A;  3HOY B;  1S5C D;  4C3J G;  4JBJ A;  2R7Z B;  4DR7 Q;  4H44 C;  3H94 A;  5LL6 S;  2MQH A;  3K5N A;  3T56 B;  3V2T A;  4FF3 A;  1CSQ A;  1S40 A;  1ICF B;  1L0W A;  1PTO D;  2E76 C;  3S1N B;  2LSS A;  4GLV B;  3MVV A;  4P73 A;  4DV5 Q;  3J80 i;  4NMZ A;  4A3J G;  3GTM B;  1U4L A;  2K5H A;  3PIP A;  4X65 Q;  1EY4 A;  2OWO A;  1VMC A;  1V8Q A;  2K5N A;  2NYZ D;  5EPJ A;  1IHZ A;  2FHT A;  2KEN A;  2VUM G;  5JEA H;  5F2D A;  1YBY A;  4GNX A;  1EY8 A;  3J81 E;  4FF2 A;  1H9K A;  2BDO A;  1VQE A;  1HFN A;  2PW7 A;  3N52 A;  5AJ3 Q;  1X3E A;  1SMY D;  2QEX A;  1BCP C;  4LUO A;  3E9I A;  3I4N H;  3NBH B;  5LMU L;  1LTS D;  3T16 A;  3AMU A;  2J0T D;  3FDT A;  4JI0 L;  1FL0 A;  1VQC A;  2PO4 A;  2N55 A;  4CKC A;  3M3Y H;  1F77 A;  1I4H A;  1YNX A;  3F2D A;  1HNX L;  1EWC A;  2QCP X;  3K80 C;  4FYD A;  5A35 A;  3ICE A;  3SK8 A;  1H9M A;  5E3F A;  1PRT C;  1EY6 A;  5LL6 X;  1U4M A;  2XSC A;  3VYT A;  3MEF A;  4G7O C;  3EVQ A;  4DAV A;  4LF8 L;  2NN6 H;  3PUW A;  3W1G A;  5KND A;  1TWF B;  5E7N A;  2QNC A;  1C4Q A;  4B9X A;  1PXU A;  3T1H Q;  4LF5 Q;  4A93 H;  1SRO A;  4K8I A;  1SYF A;  3FPP A;  1RTN A;  4IUV A;  1HPC A;  1M4V A;  1ICW A;  2WB1 B;  1N8R C;  1JEI A;  1GKU B;  2F0S A;  3DWP A;  2EYF A;  3D4W A;  2HD3 A;  4RG1 A;  2F0E A;  1YJ9 A;  1RF2 D;  4DUY Q;  4LAA A;  4LNQ A;  2R93 B;  4DR4 Q;  1E0B A;  1Y1W G;  4DR2 L;  3H3V I;  5EKL A;  2B8G A;  2PZW A;  2LD7 A;  4LF7 L;  1JJ2 A;  3SXH A;  2IX3 A;  3CRL C;  2FMC A;  4KD4 A;  3S2H B;  3S14 B;  2Z8L A;  3AU7 A;  1VQ4 A;  2VY3 A;  5C3E H;  4CGY B;  1K28 A;  1JJR A;  4ZRZ A;  4HSP A;  2B2U A;  4NXM L;  1EFW A;  4X66 L;  5HUR A;  3E0J A;  1G2T A;  1IZ6 A;  5IYD G;  1A8V A;  1AZP A;  2AWN A;  4I7Z C;  4ZYS A;  2EOT A;  3DWA A;  3BG3 A;  4WOR A;  3HKZ G;  4LFA Q;  1N34 L;  2NVY B;  3S16 B;  4DR1 L;  3K5M A;  3J7A F;  4X6A H;  2JK8 A;  1SRU A;  3ONA B;  1L0Y B;  5CBE E;  5CV4 A;  1X54 A;  4RKB A;  2MNA A;  3HOZ B;  3I7F A;  3J7A 5;  3C3L A;  2KHI A;  2CFM A;  1CKN B;  1LTB D;  1TU2 B;  4AYB E;  3SDZ A;  3FLG A;  1U4P A;  1KC8 C;  1PTO C;  2ZT9 C;  2F0P A;  3HOY G;  5GQO A;  4HTH A;  3JAM c;  1Q1E A;  4HMI A;  1K8A C;  1WCM B;  1U5K A;  4DKA C;  2F0N A;  4HCS A;  4NKL A;  1JC7 A;  3MWY W;  2K1B A;  1X3G A;  3GTJ B;  1DM0 B;  4YHH Q;  4OEL B;  1Z9F A;  1FJG Q;  4DNR B;  4X62 Q;  1QCB D;  1RL2 A;  2RDF A;  1KLU D;  3U4V A;  4DAM A;  4AYB G;  2Z6K C;  1D6E C;  1PYS B;  4KY5 A;  4BY1 B;  1FNV A;  1WD1 A;  4UP7 A;  2LMC B;  1P8L A;  5EPK A;  4DR6 L;  1S72 A;  3TP5 A;  3HKS A;  1GUN A;  1SMY C;  5IYC H;  4CJ1 B;  3HOX B;  2AHO B;  4GKJ Q;  1FNU A;  3F8T A;  1B53 A;  1X55 A;  3HKZ E;  2R92 G;  2I07 B;  3QJY A;  4R4C A;  2YTX A;  1LTA D;  2EQS A;  1E22 A;  1TWC H;  1FVI A;  3BJU A;  1CK1 A;  4DUZ L;  1PZI D;  1XMO Q;  4LFB Q;  1CA5 A;  1DJR D;  3H3V H;  1AW7 A;  1WTX A;  3U9O A;  1FGB D;  3PMF A;  4IJL A;  2I0Q A;  3R2T A;  3P75 A;  3ZYY X;  4KI0 A;  1I6V C;  3EIV A;  3A0J A;  4JOI C;  4YCV A;  3ND9 A;  4XDX A;  3K7A H;  3R93 A;  1V9P A;  2ZTD A;  4BA1 I;  1GD7 A;  4I65 A;  1RHP A;  2M2L A;  5M5X B;  1PTO F;  4R1J A;  1DD2 A;  3ZJY C;  1LTG D;  4AQY L;  4FXD A;  1JR0 D;  3GTG H;  3C1E A;  4XTC S;  2XGT A;  3RZD H;  5JJI A;  1ILP A;  4GNX C; 
#chains in the Genus database with same CATH homology
 5J3B A;  4QIW E;  2K14 A;  4X64 L;  3CC4 A;  1G51 A;  1H9E A;  5AJ3 L;  2IHF A;  3S2D H;  2IT1 A;  2UUB L;  2R6G A;  1E7D A;  5FJ8 G;  5M3F H;  4WJ3 M;  4XIG S;  5C4X H;  1K3R A;  1HJP A;  1PA6 A;  4QGU A;  3CCS A;  5IYD H;  1QVC A;  4A75 A;  4AQY Q;  3L2P A;  3RN5 A;  4A3M H;  3SGI A;  2GVA A;  3GTM H;  1N32 Q;  3FKI G;  1PH8 A;  2UXB Q;  4JI3 Q;  1XTD A;  2UXD Q;  4R4T A;  2FXQ A;  1TWG H;  2ID0 A;  3KDF B;  3NEL A;  3U50 C;  5C3E G;  1NBW A;  4GKK Q;  4A3F G;  3HOW H;  4GN3 B;  1X65 A;  1Y1W H;  3DM3 A;  1N36 L;  2VUM H;  2K5V A;  3KJO A;  4POG A;  3PF4 A;  4JG2 A;  5C4X G;  1IBK L;  4KLK A;  4R4O A;  1KAW A;  4WJ4 A;  4A3K G;  2NVQ H;  1WCM G;  1XNR L;  1E1T A;  3GTQ H;  1CKO A;  5JJK A;  1UEB A;  2EXD A;  1XPR A;  3CW2 C;  2Y0S E;  1V1Q A;  5IP9 G;  2OTL A;  4LF8 Q;  2BH2 A;  3BZC A;  2D0P A;  4J15 A;  4UP8 A;  1VQK A;  2UUC L;  2RCN A;  3CD6 A;  4JI3 L;  4A3B G;  2UXD L;  1SMX A;  1YJN A;  4LW1 A;  2AWO A;  2ODG C;  4TQU S;  4HJ5 A;  2K52 A;  4BBS H;  4A3M G;  2JEA I;  4NXN L;  1N9W A;  5IYC G;  3E9H A;  5IYB G;  3PUY A;  1M90 C;  3TS2 A;  4RMF A;  3T1H L;  4QQB X;  5GAD C;  1XNR Q;  2I5M X;  2JA8 H;  2AMC B;  5M3M H;  2GN5 A;  5IY0 A;  2ZJP A;  1E24 A;  1HR0 L;  3UDF A;  3KLW A;  3TRE A;  2BA1 A;  1H9F A;  1Y02 A;  5EAY A;  1U0L A;  1YZ6 A;  2JEB I;  1OXX K;  4JI1 Q;  4HIK A;  1EQQ A;  1NJI C;  1PH9 A;  1LTL A;  1VQI A;  1XNQ L;  3HOU H;  4YCW A;  2JA7 H;  4R4Q A;  4LF9 Q;  1YJW A;  3KJP A;  1MJC A;  2RF4 A;  5FLM H;  1JB7 A;  2JA5 H;  2B63 H;  1YVC A;  2ZTC A;  4A3E H;  1XMQ L;  1Q81 C;  1D8L A;  4DUY L;  1HR0 W;  1OXT A;  5IP7 H;  4HID A;  1I94 Q;  1UE5 A;  1VQH A;  2R93 H;  5GRO A;  2I5H A;  1YHQ A;  2OCE A;  4OWT B;  3JC6 6;  1L2F A;  3S1R H;  4DR7 L;  4YY3 L;  3PUX A;  4LUV A;  2NN6 G;  2Z6K A;  4P75 A;  3CF5 A;  4JBM A;  2NN6 I;  2N49 A;  2KCT A;  3KFU A;  1EN7 A;  2IX0 A;  2NVT H;  3KYH C;  3I4N G;  3G6E A;  1VCI A;  2LXJ A;  3ULP A;  2R7F A;  4AH6 A;  1IBL Q;  5C0X I;  2B29 A;  4OON A;  1X3F A;  1M1K C;  1VQO A;  1N33 Q;  1MJE A;  2CWA A;  4A76 A;  1K83 H;  1ASZ A;  4Y52 H;  3CMA A;  4DV5 L;  2JA8 G;  2UXC Q;  1YHA A;  2KHJ A;  2OQK A;  4NXM Q;  3L0O A;  3JAM i;  4IFD G;  2WAQ G;  3I4O A;  4X66 Q;  4DV3 Q;  4A3J H;  4C3J H;  1W2B A;  3GTK H;  1CSP A;  2XTI A;  4JI8 L;  4X65 L;  3BZK A;  3CXC A;  2JA5 G;  1VQL A;  4YY3 Q;  4IOA A;  4DK3 C;  4IOC A;  1Q7Y C;  4A3E G;  2CCZ A;  3CC2 A;  2R93 G;  3BU2 A;  4DV0 Q;  1EIY B;  1B70 B;  1X6O A;  2JE6 I;  4LF6 L;  3RZO H;  3GO5 A;  1IBL L;  5C0X J;  1JE5 A;  5M3M G;  4BA2 I;  4C3I H;  2WB1 G;  3F1Z A;  1HZA A;  2NVY H;  2VL6 A;  1KRT A;  3PUV A;  4IO9 A;  1N33 L;  3J80 c;  3CCM A;  1IBM L;  2NZH A;  4NB3 A;  1VQJ A;  3F2B A;  1BKB A;  1AE3 A;  3I4M G;  1GO3 E;  1WFQ A;  2RHQ B;  4OWW B;  2HHH L;  5BR8 Q;  2VZA A;  4A3D H;  1TWA H;  4P72 A;  3W1B A;  5GAH C;  2VQF Q;  2UU9 Q;  4BY7 H;  3S2H H;  2I5L X;  2K50 A;  1SR3 A;  4JV5 L;  3PGZ A;  1K8G A;  1AE2 A;  3M85 A;  1VQB A;  3T1Y L;  1VQ5 A;  2V1C C;  2UXB L;  4JBW A;  3HOZ G;  1IL2 A;  5ELN A;  1R9T H;  4JI4 L;  2DK4 A;  3J81 j;  3PF5 A;  5DLQ E;  2F4V Q;  5H1S E;  1A63 A;  2QGQ A;  3AFP A;  4MTN A;  4A4I A;  4UY8 C;  1HZB A;  4L5R C;  3A74 A;  4GS3 A;  1SN8 A;  5LMN Q;  4JI0 Q;  1WJJ A;  2DUD A;  3PIO A;  1HNZ Q;  2LC3 A;  3M9B A;  1HH2 P;  4YWK A;  4X64 Q;  3IRB A;  5C0X G;  4YHH L;  1IXR A;  2VQF L;  2VQE Q;  3GTJ H;  1Q86 C;  2Z0S A;  4JBK A;  4IFD J;  4HJ8 A;  4B3T Q;  3FP9 A;  3M7N A;  2IX1 A;  2R7Z G;  4JI2 L;  3T1Y Q;  2UUC Q;  3G71 A;  4JI6 Q;  1YIJ A;  2YU9 H;  1OXS C;  4NPS A;  4DPG A;  1N32 L;  4B3R L;  1SLJ A;  4JI5 L;  2WFW A;  1SE8 A;  5GAG C;  5C44 G;  1J5E Q;  1C0A A;  2CWP A;  1J6Q A;  1PYB A;  4BBR G;  4GN5 A;  2ZM6 L;  2LXK A;  3A5U A;  1GM5 A;  3H0G G;  4YWL A;  1P16 A;  3STB D;  4LF4 L;  4LWC A;  3CAM A;  1N36 Q;  3PUZ A;  1K0R A;  1WI5 A;  1KL9 A;  2ODC I;  1BBU A;  1PH5 A;  1MKH A;  2PQA B;  5M5W H;  3G48 A;  3K81 C;  1A62 A;  5FJ8 H;  5M3F G;  2R7Z H;  1KHI A;  1PHJ A;  1L1O C;  4HIO A;  4C3H H;  3J7Z C;  1EWI A;  1QZG A;  1NMF A;  3D31 A;  4KHP L;  3HOX H;  1QZH A;  5M5X H;  1EYG A;  3PSI A;  1Q82 C;  2E2J H;  1V43 A;  1VS0 A;  4LF9 L;  4DAY B;  2JA6 H;  3PO3 H;  2B63 G;  2E5L L;  4DUZ Q;  3STB C;  1YEZ A;  3M4O H;  2H5X A;  2WAQ E;  2E2H H;  4IPG A;  1ZS9 A;  1C9O A;  2C35 B;  4YCU A;  3HOU G;  4BXX G;  1J5E L;  3RNU A;  4JBJ A;  1H95 A;  4DR7 Q;  2VW9 A;  4LF4 Q;  1S3O A;  4IPH A;  2N3S A;  1VQA A;  3H15 A;  1EUJ A;  3OW2 A;  2MQH A;  3ERS X;  1LYL A;  3L7Z C;  1QUQ A;  3NEN A;  5ELO A;  2ES2 A;  1CSQ A;  1SFO H;  1S40 A;  1YHB A;  1L0W A;  3I56 A;  2N78 A;  4OX9 L;  2LSS A;  4JOI A;  4JI1 L;  4GLV B;  1E7Z A;  1C7Y A;  3KF6 A;  4A3B H;  3HOY H;  1UE7 A;  4P73 A;  3J80 i;  4DV5 Q;  4O0A A;  2E5L Q;  1AH9 A;  2UUA Q;  1EIF A;  4A3J G;  1NE3 A;  2WB1 E;  1VQ6 A;  3HOX G;  2KCM A;  4APV A;  2F52 A;  2IHE A;  2K5H A;  4JI8 Q;  4X65 Q;  3PIP A;  4LFC Q;  3TRZ A;  4DV4 Q;  5IP7 G;  2L15 A;  2OWO A;  3TEH B;  4A3L G;  1PVO A;  2DGY A;  5HY6 A;  1UWV A;  3ER0 A;  2K5N A;  3TS0 A;  1G29 1;  4K0K L;  1NY4 A;  3KF6 B;  3W5O A;  3K7U C;  2KEN A;  5LMU Q;  5K36 G;  1UE6 A;  2VUM G;  2CQO A;  2JA9 A;  1YBY A;  4PG3 A;  4GNX A;  2YTY A;  1Y1V G;  4HJA A;  4OXP A;  4BBS G;  1UE1 A;  3AYH B;  2R92 H;  2VS1 A;  1O7I A;  1VQE A;  1VQ9 A;  3I2Z A;  2F3I A;  5AJ3 Q;  1X3E A;  4DV2 L;  2R7D A;  2QEX A;  1E1O A;  2KFV A;  3S1Q H;  2K75 A;  4IPD A;  3CCU A;  1KXL A;  2JA7 G;  4IFD I;  4GN4 B;  4LUO A;  3M4Q A;  1KQS A;  2YYZ A;  3E9I A;  3Q8D A;  4X62 L;  4GOP B;  3NBH B;  2G80 A;  1K73 C;  1FJG L;  2F4V L;  3I4N H;  5LMU L;  3VDY A;  4A3K H;  1Z47 A;  1YNS A;  1HZC A;  3PO2 H;  4R4I A;  3B6Y A;  4A3I H;  4A3C H;  2BH8 A;  4JI0 L;  1FL0 A;  1VQC A;  1Y14 B;  3M3Y H;  4DR6 Q;  2K4K A;  3GTL H;  1HNW Q;  4DK6 C;  1IBK Q;  3FHW A;  1YNX A;  1BBW A;  3F2D A;  1HNX L;  4JYA Q;  1Q8K A;  3AFQ A;  2A19 A;  4DV2 Q;  5JEA G;  3K80 C;  4PZ6 A;  3UDX A;  2VQE L;  3RLF A;  3CCR A;  2HHH Q;  3ICE A;  1GVP A;  3UE0 A;  3OTO L;  4DV7 L;  1RIP A;  1WOC A;  4O2D A;  4B3T L;  4BY7 G;  1IYJ B;  1PV4 A;  4JI6 L;  4JV5 Q;  1QUQ B;  3LGJ A;  3MEF A;  5LMN W;  3CCJ A;  4JI4 Q;  1PH6 A;  3DLL A;  3UDI A;  4LF8 L;  4BXX H;  1VQM A;  2IY5 B;  1KIX A;  1VQF A;  5HGQ A;  3PUW A;  4UPA A;  3W1G A;  3J81 i;  5C4J H;  4LFB L;  4DR2 Q;  2HT1 A;  5E7N A;  2QNC A;  4DR3 Q;  3T1H Q;  1G6P A;  4LF5 Q;  1HNX Q;  1QVF A;  1TWH H;  4IPC A;  1SRO A;  4A93 H;  1VQN A;  3WWV A;  4AIM A;  1HNZ L;  1NTG A;  3ULL A;  2D0O A;  4A3G H;  3UDG A;  4KHP Q;  4QY7 A;  5M5Y H;  3EN2 A;  2OQ0 A;  5IWA Q;  3OTO Q;  4DV7 Q;  1YIT A;  4HJ9 A;  3HOZ H;  1OXV A;  1N8R C;  1JEI A;  1GKU B;  1I6H H;  2Q2T A;  3KDF A;  1HZ9 A;  2YV5 A;  1BVS A;  4RG1 A;  1YJ9 A;  2N8N A;  1XMQ Q;  5IYB H;  4B3R Q;  4DUY Q;  1JJC B;  1Y1V H;  5IE8 A;  2WP8 J;  2E2I H;  3RN2 A;  4LNQ A;  4DR4 Q;  1Y1W G;  4DR2 L;  3S15 H;  2ATW A;  2BA0 A;  4JC0 A;  4KHZ A;  4ME3 A;  1I94 L;  1ASY A;  3H3V I;  4GOP C;  1EQR A;  1LUZ A;  2B3G A;  2LD7 A;  4PZ8 A;  4LF7 L;  1JJ2 A;  3UE1 A;  4H02 A;  5IWA L;  1PH7 A;  1CKN A;  4L5S A;  2PMZ E;  2ZJQ A;  3U4Z A;  1VQ4 A;  3TQY A;  2JA6 G;  2VY3 A;  4L5T A;  3CME A;  1FGU A;  1CUK A;  3U58 A;  4Y7N H;  4PMW A;  4EX5 A;  5C3E H;  4B3S Q;  2MO0 A;  1XPO A;  4IJH A;  3CCV A;  4DV3 L;  3GDE A;  4DV4 L;  4C2M H;  4YWM A;  2HQL A;  2Q2H A;  3AQQ A;  2UXC L;  2GVB A;  4QL5 A;  4NXM L;  3RLO A;  1EFW A;  3ULJ A;  2UUB Q;  4X66 L;  3F2C A;  3S14 H;  2KBN A;  1IZ6 A;  3I4M H;  5IYD G;  3RLN A;  1A8V A;  1PH2 A;  4LF7 Q;  2AWN A;  4DR5 L;  1JJG A;  5GAE C;  2A1A A;  4LFA Q;  3HKZ G;  4BY1 G;  1N34 L;  3CCQ A;  1TWF H;  3CPF A;  5C44 H;  1NMG A;  4GKK L;  4DR1 L;  4EQ5 A;  4LF6 Q;  4X6A H;  1I5F A;  1SRU A;  2JK8 A;  1B7Y B;  2UU9 L;  2ZTE A;  4B3M L;  1X54 A;  2MNA A;  3I7F A;  1WCM H;  3J7A 5;  2MFI A;  5FLM G;  3EBE A;  2JQO A;  2KHI A;  3J81 c;  2VNU D;  2CFM A;  2NZO A;  4A3G G;  1CKN B;  4AYB E;  3GTP H;  2PQA A;  4GNX B;  3S16 H;  3PV0 A;  1KC8 C;  4A3I G;  1W3S A;  2YTV A;  3E0E A;  4HJ7 A;  4DR5 Q;  2PI2 E;  1E7L A;  1JT8 A;  1K9M C;  3HOY G;  1X56 A;  1N34 Q;  4LFA L;  5GQO A;  1T9H A;  1I3Q H;  1L1O A;  3JAM c;  1PH3 A;  1Q1E A;  1TXY A;  2QNF A;  5JEA J;  3FKI H;  3CC7 A;  1K8A C;  4DR1 Q;  4JYA L;  1Q12 A;  2D62 A;  1QVG A;  4NXN Q;  3NEM A;  1U5K A;  4DKA C;  4GLX A;  5LMN L;  3CCL A;  1X3G A;  3D0F A;  4GKJ L;  1E3P A;  4YHH Q;  1HR0 Q;  3HOV H;  3K8A A;  2OTJ A;  1L1O B;  1Z9F A;  4GLA C;  1FJG Q;  1MIU A;  4P71 A;  4X62 Q;  1RL2 A;  1EOV A;  4QJF A;  1LM0 A;  2CKZ B;  3U4V A;  1PFS A;  4DAM A;  4JI2 Q;  4AYB G;  2Z6K C;  1PYS B;  1Q46 A;  3PO2 G;  3G4S A;  4UP7 A;  2QA4 A;  4A3C G;  4A93 G;  1P8L A;  4DR3 L;  2PI2 A;  1WYD A;  1XMO L;  1VQ7 A;  4JI5 Q;  4POF A;  4DR6 L;  1S72 A;  2ZM6 Q;  1GKH A;  3PCO B;  4A3L H;  2NVX H;  3GD7 A;  3HKS A;  3CPW A;  3I55 A;  1XJV A;  2MPH A;  3KOJ A;  5IYC H;  3K0X A;  3GTO H;  4TVA B;  2A8V A;  2AHO B;  1VQG A;  4GKJ Q;  1KD1 C;  1XPU A;  1I50 H;  1DGS A;  3F8T A;  1X55 A;  1YI2 A;  3HKZ E;  2R92 G;  4A3D G;  4BBR H;  4DV6 L;  4HIM A;  1GL9 B;  3CQZ H;  4R4C A;  2HIV A;  2YTX A;  4LUZ A;  1XNQ Q;  5IP9 H;  2EQS A;  1E22 A;  1TWC H;  2AKW B;  3BJU A;  1FVI A;  4DUZ L;  1X9N A;  4DV1 L;  3A5Z B;  3M4P A;  3CP0 A;  4FDB A;  2JJQ A;  3S24 A;  2HJQ A;  1XMO Q;  4LFB Q;  1B8A A;  2ASB A;  1D7Q A;  4ALP A;  1GJJ A;  4LF5 L;  4OO1 G;  2Y0S G;  1A0I A;  4MZ9 A;  3H3V H;  4L5Q A;  2RHS B;  5IT9 c;  1HNW L;  4DV0 L;  3HOV G;  2MO1 A;  3OYY A;  2W51 A;  3HFZ B;  4JI7 L;  4DV6 Q;  4IJL A;  3S1N H;  2E8G A;  2I0Q A;  3CCE A;  4MNO A;  2UUA L;  2Q2I A;  4OX9 Q;  4UP9 A;  4A3F H;  3HOW G;  4KI0 A;  4JCV E;  3EIV A;  3A0J A;  4PZ7 A;  4JOI C;  1VQP A;  2ALY B;  4YCV A;  2EIF A;  3RR5 A;  4DV1 Q;  3K7A H;  5BR8 L;  1KRS A;  1PH1 A;  1V9P A;  2ZTD A;  1OXU A;  4BA1 I;  4DNI A;  3AEV A;  4DR4 L;  1VQ8 A;  4LFC L;  1GD7 A;  3PO3 G;  1PH4 A;  4R1J A;  1JMC A;  3H0G H;  3ZJY C;  4OO1 I;  2ZJR A;  4BY1 H;  4AQY L;  1Q1B A;  2PNH A;  4K0K Q;  3GTG H;  3KF8 B;  4OWX B;  4JI7 Q;  3S1M H;  3MXN B;  5JJL A;  4GOP A;  4XTC S;  2XGT A;  3RZD H;  5FLX c;  1CKM A;  4B3M Q;  4P74 A;  2Q2U A;  1VQD A;  2HIX A;  3S17 H;  5JJI A;  4B3S L;  1OTC A;  4GNX C;  1IBM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...