1A62A

Crystal structure of the rna-binding domain of the transcriptional terminator protein rho
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO
publication title Crystal structure of the RNA-binding domain from transcription termination factor rho.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transcription termination
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07497 Rho_RNA_bind Rho termination factor, RNA-binding domain
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a62A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a62A02
2MFIA 1K3RA 3J80c 2ATWA 4DV2L 3D0FA 3CCVA 2R7FA 2HT1A 4GKJQ 3PO2G 1QVFA 1N34L 1Z9FA 3M9BA 4JBMA 1IZ6A 3TS2A 1B70B 1X55A 4LW1A 1E7DA 1NY4A 2KBNA 3K7AH 4B3SL 2AHOB 2JA6H 3HOWH 3PO3G 1CKNB 4DK3C 1E3PA 4DV0Q 1JJGA 2ZTCA 4IFDG 4PZ6A 4NB3A 1A0IA 4NXMQ 1N32Q 2JE6I 2UUBQ 4YY3Q 4DV6L 3CAMA 4XTCS 1XPRA 2IHEA 1HR0Q 4IJLA 1K8AC 5IE8A 1QVCA 3K0XA 3I2ZA 2MQHA 4C3IH 3DM3A 5HY6A 4BA1I 3KF6B 2B63H 1CUKA 4NXNQ 4DR4Q 1A62A 2B29A 2NN6I 1GO3E 4GNXA 1FJGQ 3HOVH 4R4IA 1MIUA 1D8LA 3AFQA 2WFWA 2E2HH 1Q8KA 3EBEA 1V9PA 4DR1Q 4DR6Q 1P16A 4A75A 2UUBL 1EIYB 4POGA 4GNXC 1EOVA 2K5HA 2OQ0A 3AEVA 2IT1A 1G51A 4JI5L 1K9MC 1UWVA 4DKAC 1V1QA 4LNQA 3BZKA 1Y1VG 5LMNW 4JI0L 4Y7NH 2BH2A 1XJVA 1XMOQ 1I3QH 5EAYA 5AJ3L 1YHBA 4DR2Q 5GQOA 3RN5A 4JV5Q 1PHJA 4AQYQ 2UXDL 5FLMG 1XPOA 4DV3Q 1N36Q 2EIFA 3I4NG 4A3GH 1C7YA 5FLXc 2FXQA 1LUZA 3F8TA 4LF6L 4QJFA 4DV5L 1PH9A 2Z6KC 1OXUA 1EYGA 1HNZL 4AYBG 1WOCA 4L5RC 3GTOH 2B3GA 3JAMc 3HOZG 1TWAH 2AKWB 3I4MH 2EQSA 1E24A 2XTIA 3PF4A 4GOPB 5IY0A 5ELOA 4JI6Q 4RMFA 3M3YH 4X64Q 3S24A 3G71A 3RR5A 3D31A 1E1OA 1ASZA 1YJNA 1E22A 5C0XI 2HJQA 2JA7H 4B3RL 4A93G 2BA1A 4YHHQ 5M3FG 3RNUA 3U58A 2CKZB 3RLNA 4LF5L 3DLLA 1NMGA 3GTJH 5LMNQ 1Q7YC 1E7LA 1CSQA 1T9HA 2R92H 2UXBL 1TWCH 1KRTA 2ZJPA 4JI3Q 4K0KL 2IHFA 5IP9G 1UE6A 4HIDA 1JT8A 4OWXB 2JK8A 2VS1A 4HJ7A 4DUZQ 4UY8C 4JI4L 1G6PA 3GO5A 1YIJA 2VQEQ 1HH2P 4LFCQ 3ZJYC 4A3BG 4A3JG 2BH8A 2HHHQ 1KQSA 3M4OH 1KIXA 3MEFA 4R4TA 3M85A 4BA2I 5M5YH 5C44H 1Q1EA 1SRUA 5GROA 3K8AA 1YNXA 2AWNA 4JYAQ 1HZBA 4JI7L 1L2FA 4ME3A 4YWMA 2UUAL 4PZ8A 1K8GA 1BKBA 1PA6A 3GTGH 3BZCA 4QIWE 1EIFA 4JI2Q 5FJ8H 4X62Q 2YTVA 3T1YL 1IBKQ 1RL2A 3S2HH 4A3FH 4KI0A 4P71A 3NENA 4GN5A 1VQEA 3CCJA 1I94Q 4LFBL 4AIMA 4A3KH 4C3HH 4BXXH 1JJ2A 1SLJA 2RCNA 4IPCA 3CC7A 1GVPA 4L5TA 3OTOQ 1CKNA 1VCIA 4OONA 4HJ5A 1NBWA 1VQAA 3E0EA 2QA4A 3MXNB 1HZAA 3HOWG 3EIVA 3CCEA 3S15H 3A5UA 2VNUD 3K80C 2C35B 3CC2A 2QNFA 4QL5A 1PH1A 1Y14B 4X66Q 2GVAA 1UE7A 3CF5A 3WWVA 4YCWA 2ZTEA 3G48A 4LF7L 3K81C 2LXKA 5IWAL 4OWWB 5JEAJ 3KF6A 1YZ6A 4JI1L 2VUMH 4HIOA 2UXCL 4OWTB 3PUWA 2ASBA 2B63G 1FGUA 1VQ9A 3CCMA 3S14H 4LFAQ 3HOUH 4DR3Q 5C4XH 2ZTDA 3LGJA 4PG3A 1PH3A 4A3MH 5GADC 1MJEA 3RZOH 2HIXA 2I0QA 2ID0A 4GLXA 1X6OA 3S1QH 2UUCL 3KF8B 5IYDG 1VQOA 3FHWA 1WCMH 3T1HQ 4IOAA 4YWKA 4AH6A 3BU2A 2CWPA 2WP8J 4GLVB 2VW9A 4IOCA 2YU9H 1PYSB 1WYDA 4AYBE 2F3IA 3J80i 1B8AA 1VQPA 4UP8A 1W2BA 5M3MG 3I4OA 4NPSA 1VQCA 3U4ZA 1X3GA 1JB7A 3RLOA 1O7IA 3Q8DA 3KDFB 1C0AA 1X3FA 4A3GG 3M7NA 4BBSG 3ICEA 4DR7L 5C4JH 2GN5A 3HOVG 4A3CH 4BY7G 4A4IA 3CW2C 5HGQA 3K7UC 3H15A 4GOPA 4DV1Q 2PNHA 4OO1I 4GKJL 1VQHA 4GKKQ 1L1OB 2N8NA 2UU9Q 2CFMA 3F2BA 4GOPC 4A3LG 3IRBA 1JE5A 2A1AA 2HIVA 4JC0A 3TS0A 3CQZH 3TREA 1FVIA 2OQKA 2K5NA 2RHQB 4IPHA 3GTQH 2R7ZH 4JI5Q 4DR6L 3S1RH 4KLKA 5J3BA 2VQFQ 2KHJA 1FL0A 4NXML 1VQLA 1QUQB 4C2MH 3KJOA 1VQ8A 1W3SA 1AE2A 1X65A 4YY3L 3J81j 3PIPA 5JEAG 4DV7Q 1VQ6A 2R92G 2K4KA 1VQGA 3CXCA 5IYCH 4B3ML 5C3EG 2ZM6Q 3ER0A 2CWAA 4JI8Q 4EX5A 2ES2A 4A3DG 2JA5H 1TWGH 3M4QA 1VQIA 4A3EG 4A3IH 4BBRH 1Q86C 1N33Q 1HZCA 3W5OA 3F2CA 2N78A 4NXNL 4QGUA 4DV5Q 4DR4L 1FJGL 4IPDA 3RLFA 4J15A 1M90C 1K83H 3I55A 3A5ZB 4P73A 1PH4A 4LUVA 4DR1L 1IBLQ 3F1ZA 3TQYA 5LMUQ 2NVTH 3PO2H 3I56A 1XPUA 4DR5L 3STBD 3HOXH 1PV4A 1Q46A 2WB1G 2LSSA 2D62A 2NVYH 4LUZA 5FJ8G 3U50C 4QQBX 3PO3H 1J5EL 3HFZB 3HKZG 5IP7H 4A3FG 1S72A 1XMOL 1PH5A 2CCZA 1K0RA 4LF9Q 2F4VQ 2VL6A 3TRZA 4DR2L 4LF5Q 3JAMi 4OX9L 3NEMA 4GLAC 4JBWA 4AQYL 1VQNA 4BXXG 1QZGA 3CD6A 2MNAA 2OWOA 4LUOA 2JA8G 3CMAA 1HNXQ 3UE0A 5IT9c 2QNCA 1LM0A 3U4VA 1E1TA 2E2JH 4IPGA 4X65Q 1EQRA 1SROA 1VS0A 5K36G 2Q2TA 5DLQE 2JEBI 4DUYQ 2H5XA 1PH6A 1JMCA 2KCMA 3VDYA 4OXPA 4X64L 4IJHA 2I5MX 3GTMH 5C0XJ 4JCVE 2R93H 3HKSA 3L2PA 3CCSA 4JI7Q 3RZDH 1BVSA 4YHHL 3GD7A 2F52A 3PIOA 1XMQQ 1BBUA 3E9IA 4IFDI 1HNWL 2V1CC 3HOUG 1UE1A 4KHPL 3FKIG 5LMNL 3CPFA 5C4XG 2JJQA 4L5SA 1D7QA 4LF4L 1PFSA 2K14A 2R6GA 4JI3L 1S3OA 2NN6G 1LYLA 5FLMH 1M1KC 4B3TQ 3UE1A 3H0GH 3I4NH 3GTKH 2VQEL 4LFCL 1NMFA 4DV4L 3RN2A 2JA6G 1VQ7A 4TQUS 2HHHL 5BR8Q 3CCRA 3M4PA 3HOZH 3EN2A 4LF8Q 2MO1A 2KENA 3KDFA 1YBYA 4JYAL 4MTNA 1ASYA 4IFDJ 1Q12A 2K5VA 1PH2A 4ALPA 1KRSA 4R4CA 3UDGA 1X3EA 1KC8C 2OTLA 2E5LL 1XNQQ 4X62L 4JI2L 1XNRQ 2A19A 4JI1Q 1BBWA 4A3CG 3G4SA 1NE3A 2WAQG 5M3FH 1K73C 1I94L 4IO9A 1CKOA 1UEBA 1L1OA 1QVGA 3S1MH 3PCOB 1IYJB 4XIGS 1N9WA 3AFPA 1MKHA 4P75A 1GKHA 4POFA 1Y1WH 1PH7A 1PH8A 1YEZA 1YHAA 2CQOA 2Z0SA 3JC66 3OTOL 4HIKA 2E2IH 4JBJA 2MO0A 4H02A 1WJJA 4O2DA 4DV2Q 3S16H 2OTJA 2HQLA 1IBML 1SMXA 1QUQA 1N34Q 4HIMA 1WI5A 4GN4B 1EWIA 4R4OA 1YVCA 5C0XG 1NJIC 3HOYH 2NZHA 4X66L 4A3BH 4B3SQ 1KHIA 3CP0A 3NELA 2N3SA 1YJ9A 5IYCG 2K52A 2R7DA 3STBC 3ERSX 4HJAA 4MNOA 3S2DH 4DV6Q 5IYBH 1Q1BA 4A3IG 2WB1E 1Z47A 1KL9A 2Y0SG 2K50A 1HZ9A 4JOIA 3PUVA 3PSIA 4UP9A 2AWOA 3ULJA 4DR3L 4LFAL 2JA9A 1VQJA 3HKZE 2ZJRA 4BY1H 2N49A 3AQQA 1A8VA 1MJCA 4JOIC 1P8LA 2ZJQA 3I4MG 2Q2IA 2RF4A 1SN8A 1S40A 3HOXG 2QEXA 5GAGC 1PYBA 3UDIA 5E7NA 1RIPA 3TEHB 5M5WH 5IP7G 3T1HL 4A76A 2L15A 2JA7G 2IX0A 2YYZA 4DV0L 3OYYA 2YTXA 4R4QA 1YJWA 2DUDA 1N32L 1KD1C 4JI0Q 1VQMA 1AH9A 2D0PA 4L5QA 1XTDA 2DGYA 2GVBA 4B3MQ 1LTLA 4P74A 4Y52H 5AJ3Q 1HR0L 1YHQA 2UXDQ 5M5XH 3PUZA 1R9TH 1KAWA 2A8VA 2Q2UA 4DV1L 2PQAA 1G291 3CCUA 1IL2A 4LF6Q 2IX1A 3SGIA 3F2DA 1KXLA 4GKKL 3GTLH 3A0JA 2UU9L 1HNZQ 5GAEC 2D0OA 3OW2A 1H95A 2PMZE 2R93G 2XGTA 3KJPA 1UE5A 4DR5Q 5GAHC 5C44G 1V43A 2I5HA 3I7FA 3KOJA 3PUXA 3A74A 2VQFL 4HJ9A 4DK6C 5IYDH 1OXSC 1TXYA 1J5EQ 2E5LQ 3H3VH 1QZHA 5H1SE 1OXXK 3CPWA 4DV7L 4B3RQ 1HJPA 2YV5A 4OX9Q 2VY3A 1I50H 1X54A 3J7ZC 4JV5L 2I5LX 5M3MH 2ZM6L 4DAMA 1YITA 3H0GG 4JI8L 4A3KG 4JBKA 2UXBQ 4FDBA 1IXRA 2Z6KA 4YCVA 4DV3L 1N36L 1CKMA 1VQBA 4BBSH 1EUJA 4LWCA 4K0KQ 1N33L 3L0OA 3W1GA 3AYHB 4JI4Q 4BY7H 3CCLA 2WAQE 3S1NH 5JJLA 1IBLL 2ALYB 2NZOA 5LMUL 4O0AA 1X9NA 3GDEA 4UPAA 2PI2E 4A3LH 1B7YB 2QGQA 4JI6L 2PQAB 1Q81C 5ELNA 1VQDA 4HJ8A 4GNXB 2IY5B 1VQ4A 4LF9L 1A63A 3H3VI 1C9OA 1VQFA 2F4VL 2VUMG 2UUAQ 1HNWQ 4P72A 1WFQA 4KHPQ 1OTCA 1VQKA 2E8GA 1Y1VH 3T1YQ 3G6EA 1N8RC 1Y1WG 4LF4Q 4OO1G 4C3JH 4RG1A 4LFBQ 1HNXL 5C3EH 4UP7A 1SFOH 2LXJA 4A3MG 3J7A5 4A3DH 1X56A 4DUZL 3ULLA 4X65L 4DV4Q 4A3EH 1DGSA 3HOYG 1U5KA 2Y0SE 1GM5A 1VQ5A 1WCMG 4DUYL 4EQ5A 3BJUA 2K75A 2OCEA 1TWHH 2NVXH 1Q82C 2JEAI 3B6YA 3PGZA 2BA0A 3UDFA 1NTGA 1OXVA 1OXTA 1TWFH 5IYBG 1CSPA 4LF7Q 4R1JA 4PZ7A 4APVA 2JQOA 2VZAA 3ULPA 4TVAB 1XMQL 4GS3A 1J6QA 4YWLA 4DNIA 3E9HA 2NVQH 5IWAQ 3KLWA 1PVOA 1SR3A 4BY1G 1IBKL 1JJCB 4A93H 4KHZA 2UXCQ 3NBHB 1AE3A 5JJKA 2Q2HA 1EFWA 3S17H 4B3TL 4PMWA 3PV0A 3W1BA 3CCQA 4WJ3M 4X6AH 4DAYB 1E7ZA 4MZ9A 2JA8H 1L1OC 1IBMQ 5IP9H 1U0LA 2R7ZG 5BR8L 4QY7A 4JG2A 4WJ4A 2AMCB 3FP9A 3UDXA 3J81c 2UUCQ 2YTYA 2KCTA 4LF8L 1YI2A 1I6HH 1I5FA 1GD7A 3KYHC 4A3JH 1HR0W 5JJIA 3CMEA 4DPGA 1SE8A 1XNQL 2RHSB 1XNRL 3PUYA 2JA5G 2EXDA 3CC4A 4YCUA 3GTPH 1L0WA 3J81i 4BBRG 2KHIA 1EQQA 1EN7A 3KFUA 3FKIH 3L7ZC 2PI2A 4GN3B 4DR7Q 3PF5A
chains in the Genus database with same CATH superfamily
3J80c 2ATWA 2XN9C 1Y8PB 4CDEC 4A3MB 2X6LA 1X55A 5CV8A 3DWAA 1E7DA 2KBNA 5CV9A 3M7NA 2AHOB 3OWFA 3S1QB 1CKNB 3U9OA 1HUNA 2SEBD 4NB3A 1A0IA 4NXMQ 2JE6I 2UUBQ 2MP1A 1YNNC 1FGBD 1JCKB 2IHEA 4DK0A 2PYKA 1II3A 2K5DA 1B3AA 5CORA 3DM3A 5HY6A 4BA1I 1F2LA 2B63H 1FJGQ 3K57A 4GNXA 4JK1C 4R4IA 1CQVA 3EBEA 3KUPA 2KVEA 4POGA 4GNXC 1G51A 2R7ZB 5C0XH 4LNQA 1LACA 2MHVA 3DEOA 3T4AC 2EDGA 3SR1A 5JPNC 4L6TB 4FXGC 1C7YA 1TWGB 1LUZA 4LF6L 2Y0SB 1EYGA 4DV5L 1PH9A 2Z6KC 1NR2A 3GTOH 5EGTA 2K6AA 2KCNA 1F2MA 3PQIA 3NTIA 4RMFA 3PO2B 4XT3B 1EFID 1GHJA 1YJNA 4B3RL 3NTKA 4A93G 1BDOA 3TP6A 1CI3M 4YHHQ 3U58A 2CKZB 2XSCA 1MHWC 4ILWA 3I3CA 5LMNQ 1HFNA 1E7LA 1CSQA 1H9JA 1T9HA 2OXPA 4ABNA 2R92H 1WTPA 3P7JA 1TS4A 5IP9G 1LTRD 3QOJA 2VS1A 2XRSD 1G6PA 4JI4L 1PTOD 3GO5A 1YIJA 4IUPA 1CHPD 2G9DA 2E2JB 1T5EA 3ZJYC 3NPPA 2BH8A 2HD3A 1ENAA 1KQSA 3M4OH 4R4TA 4BWGB 2ODCI 3M85A 4BA2I 5M5YH 2A74C 2F0UA 1PRTD 2L1BA 3K8AA 1KHCA 1J8IA 4ME3A 4YWMA 1K8GA 2E5LQ 5FJ8H 2YTVA 3RMHA 3NENA 4GN5A 3CCJA 3KF8A 1SFOB 3FVQA 3U9SA 1GVPA 4L5TA 3H0GB 1VCIA 1Q8IA 1NBWA 1VQAA 4RAUC 5BN5A 3HOWG 1JR0D 3EIVA 2VNUD 1T5XD 4KD4A 3K80C 1VF5C 1TWHB 1Y14B 1WVLA 4LF7L 1JOKA 3G48A 2B2TA 4YCWA 3K81C 1WTVA 1RKNA 4JVZA 3MHBA 2B2TC 2FHTA 4JI1L 4CDDC 4NKLA 4OWTB 3PUWA 4CJ2C 4C3IG 1VQ9A 3S1MB 2NTTA 2LC3A 1Y1WB 4A3MH 2E2IB 3RZOH 2I0QA 5D3DA 2ID0A 1AZPA 1X6OA 3S1QH 5IYDG 3R2IA 4BITA 2SNMA 3MWYW 4AH6A 1NNXA 1QCBD 4IOCA 2EY6A 4CJ1B 2F0PA 1VQPA 4UP8A 4NPSA 3U4ZA 3KDFB 1ESFA 3T51B 4CJ0B 4A3GG 3S2DB 2F0IA 4UHVA 4J8QA 2GN5A 1SAPA 4BY7G 4A4IA 4GOPA 2BE5D 1BCPF 5BN3A 5EJWA 1VQHA 1NCVA 2UU9Q 4C1NK 4GOPC 3TS0A 2KVMA 3MFGA 1JORA 2K5NA 2R7ZH 2D2CC 5J3BA 2VQFQ 1BUVT 3KJOA 1W3SA 1VQ6A 5BN4A 1CFMA 2CWAA 4EX5A 2AQ2B 3TDQA 1TWGH 2RBMA 5KIXA 1Q86C 1HZCA 4K2LA 2N78A 3H09A 2RNNA 2D9UA 3I55A 3GTLB 4P73A 4DNTB 2HCIA 1IBLQ 4DR6L 3F1ZA 3TQYA 3PO2H 1VMCA 4RGTA 2FINB 1Q46A 1QNUA 2LSSA 2NVYH 2WB1G 4ZYSA 1J5EL 2CCZA 4IFDH 3KBXA 2VL6A 3TRZA 4LF5Q 4OX9L 3E0JA 4AQYL 1VQNA 4C3HG 1M4VA 5C6AA 2IJ0A 2PZWA 3PIP3 1HNXQ 2QNCA 1LM0A 3U4VA 3OMCA 3QB3A 2E2JH 3QJYA 1EQRA 1SROA 1IW7D 3S1NB 4CHTB 2H5XA 2EY5A 5C0XJ 2OF1A 1I4HA 3HKSA 5C5LA 3CCSA 4JI7Q 1SDFA 4FYDA 1HUMA 3PIOA 3E9IA 1UE1A 1QNKA 2JJQA 2K1BA 4L5SA 3M7GA 3OIQA 4X3SA 3R2TA 3UE1A 3H0GH 4B9XA 2PO4A 4K8IA 4OL7A 4LFCL 1ZYRC 3M4PA 4LF8Q 1E0BA 2NVXB 1ASYA 3SHLA 1Q12A 3O13A 3MXUA 4R4CA 3UDGA 4U673 4X62L 1XNRQ 1EYAA 4IO9A 3S1MH 1L1OA 4A93B 1IYJB 1E2ZA 3AFPA 3DEPA 4P75A 1GKHA 1Y1WH 2Z0SA 2E2IH 4JBJA 4DV2Q 3KLSX 1EY5A 1N34Q 4RA8A 3JAME 4K8JA 2Q8RE 5C0XG 2NZHA 1YJ9A 1BOSA 3I8ZA 5IYCG 3A8KE 3P1HA 3R3OA 1JEIA 1K0SA 3STBC 4DN4M 4HJAA 3S2DH 4DV6Q 2JYOA 1PYWD 5EKLA 2A6HD 5EBDA 2VXWA 3PUVA 3ULJA 4LFAL 4BY1H 2ZJRA 3FKIB 3AQQA 1A8VA 1MJCA 2ZJQA 1FYCA 2PMZB 1SN8A 2QEXA 2F0WA 3EVQA 2ODGC 3NE5B 5LL6S 1GUNA 3T1HL 3MXPA 2L15A 3HOWB 2YYZA 2PCFB 3OYYA 4R4QA 1KNEA 1PMRA 2DGYA 5KNBA 3TZDA 1NUCA 1PRTC 5JPMC 2Q2UA 4OEMB 3MTSA 1STEA 2LMCB 2K01A 3NXWA 4DV1L 1QE6A 1G291 4C3IB 1KXLA 1BCPB 3GTLH 3A0JA 1HNZQ 5GAEC 2D0OA 3OW2A 1H95A 2PMZE 2XGTA 1UE5A 3OOCA 4PV1C 1XYIA 1X32A 4HJ9A 1PTOF 2AQ1B 1C8CA 1UUPA 3TP8A 4DV7L 1HJPA 2Z4HA 1BNZA 2M9VA 2VY3A 4TRDA 2ZM6L 5CYUA 1PFBA 2PQEA 1N36L 1N33L 3L0OA 1JEQA 3DXJC 3W1GA 5I4DA 4FXDA 4A3GB 4HMJA 4FF3A 1SXTA 2WAQE 3NBIA 1TY2A 3S1NH 5JJLA 1ILQA 2ALYB 5LMUL 4O0AA 1QG7A 3I4MB 3GDEA 4UPAA 1W6JA 5ELNA 3NBHA 1S5BD 3M3YB 1LTAD 2XRQD 2IY5B 1RDPD 5DM73 1HNWQ 4P72A 2JA7B 1ML0D 1AP0A 4KHPQ 1VQKA 2E8GA 4MTKA 3T1YQ 4LF4Q 1VF7A 3NQIA 3FDTA 4OO1G 1SYBA 4LFBQ 1QB5D 4UP7A 3URYA 1EL0A 4A3MG 3ONAB 1X56A 1L0XB 1DGSA 1U5KA 4FP5D 5DNFA 4L63B 3BJUA 4KHVA 2NVXH 4OELB 1Q82C 4G4KA 1Y8OB 1M8AA 1OXTA 4R1JA 4APVA 1XMQL 1GXDC 4YWLA 3E9HA 2KVUA 5IWAQ 2WB1B 4A93H 2Z1CA 2UXCQ 2J7ZA 3S2HB 3OHXC 1JE4A 3WDNA 1EFWA 1CM9A 3PV0A 4WJ3M 4C3HB 5IP9H 1TQOA 1PLFA 2E2DC 2R7ZG 5BR8L 4QY7A 5ELFA 1RODA 2AMCB 2UUCQ 2KCTA 1VMPA 2F0SA 4JW0A 4HTHA 2AQ3B 1YNJD 2AUJD 4DPGA 2EXDA 2TSSA 1L0WA 2O5IC 2VB3X 4DR7Q 3KFUA 3FKIH 4GN3B 1S5FD 2NB0A 3GP7A 2B2YA 4O1NA 2MFIA 1K3RA 4J6HA 2HT1A 2B2YC 3PO2G 1LT6D 1SBBB 1U4LA 1WTRA 1IZ6A 4EGVA 3OMGA 5C5MA 1C4QA 1NY4A 4B3SL 3HOWH 1JJGA 4DK3C 4DV0Q 2ZTCA 4IFDG 3VA7A 1N32Q 2FMMA 3E3XA 1HR0Q 4IJLA 2QDBA 5KNDA 4KK7A 5IE8A 1QVCA 5EKKA 3K0XA 4PMBA 2RDHA 2G80A 1X3PA 4C3IH 3KF6B 3MXGA 3ND8A 1A62A 3SDZA 2F03A 4DR4Q 1JOQA 1D8LA 3AFQA 2WFWA 2E2HH 4S3SA 2ICIA 3VR4A 4FXKC 3WOEA 1P16A 4DR1Q 2O5JC 1O7YA 1SJED 1EIYB 1CZGA 1EEFD 4JI5L 1K9MC 1LTSD 2A5HA 1KABA 5FO9B 5LMNW 4Y7NH 2BH2A 2L5TA 4C2MB 1XMOQ 5AJ3L 4DR2Q 4KJNA 1PHJA 2UXDL 1JWMD 5IOCA 4DV3Q 1R9TB 2EIFA 1O7LA 4A3GH 5FLXc 1ENFA 1D5XC 2F0JA 3F8TA 4L5RC 1OXUA 3BZDB 1TWAH 3I4MH 1E24A 2XTIA 4R8IA 3PF4A 1VDZA 3J81E 4JI6Q 3M3YH 1BR9A 1TR5A 4XXEA 1PTOB 1E1OA 1CQFA 1E22A 5HURA 2HJQA 1CK1A 2JA7H 2EYOA 3PO3B 1SNCA 2DJFC 4KV6A 4DAYA 3RLNA 1NMGA 3GTJH 1Q7YC 4QMGA 1H9SB 1KRTA 5E3FA 1JT8A 2K5WA 5COYA 4DUZQ 4UY8C 1B4OA 2EYPA 2A6HC 3J81L 1GUWA 1S4ZA 3NQTA 5HGTA 4JYAQ 1Q90A 1YNXA 2SDFA 3KBGA 1CA6A 4PZ8A 5I6YA 1EYDA 4QIWE 4JI2Q 3S2HH 2IPKD 1RL2A 2QW7A 1I94Q 3J80L 3K58A 4AIMA 3CHBD 1STHA 2E76C 1B1ZA 4C3HH 1JJ2A 4IUNA 3QO2A 1PFNA 1K8MA 1GUGA 3OTOQ 3I4NB 2PW5A 4DA2A 2QA4A 3MXNB 1HZAA 5JVG3 2C9OA 3D8GA 3V2TA 2MPMA 2BDNA 2C35B 4RGNA 2QNFA 4AYBB 1PH1A 4X66Q 1SNPA 4K5WA 5FOBB 3CF5A 1ET9A 2O4XA 2ZXPA 2ENBA 2MJ8A 2ZXRA 2ZXOA 4KY7A 4Q0FA 1FGUA 3CCMA 5M3FB 1WD1A 1EU4A 3FPUB 2Q8IB 3T53B 3LGJA 1O80A 4ODGA 5IIFA 1MJEA 5FO7B 2F3WA 1A3VA 5CIUA 2EYLA 1MD2D 1HFGA 3FHWA 1VQOA 4IOAA 4A3BB 2CWPA 2VW9A 4AYBE 1WYDA 3J80i 1B8AA 4ZKBB 1JB7A 1X3GA 3GV3A 1O7IA 3Q8DA 1GUSA 4KKTA 4ZUJA 1ZYRD 4G57A 2B2VA 4OGQC 1IKMA 5HGQA 3M4YA 4GZYC 3SE0A 1LTGD 2B2VC 2MUYA 2IW3A 2Z8LA 2IX3A 1LLRD 2K33A 3F2BA 1JE5A 2A1AA 4R9WA 4ZK9B 4KLKA 5LHY1 2PZTA 2B2WA 2KHJA 4NXML 1VQLA 1QUQB 4C2MH 2UUBL 4FF4A 1XTCD 1F9QA 3J81j 3PIPA 1LTTD 3A54A 2B2WC 1CHQD 1VQGA 5IYCH 1IKLA 4MHEA 1SYDA 4JI8Q 2ES2A 2KFVA 5M5XB 5DEHA 4Z9CB 1WTXA 3W5OA 2F0QA 4DV5Q 2OEOA 1FJGL 2G5DA 5KNCA 3RLFA 3A5ZB 1V1OA 1PH4A 3I56A 4DR5L 3STBD 2WINB 3A55A 1PV4A 1PTOH 1JB3A 4LUZA 1DZ1A 1MSHA 5E4WC 3PO3H 3HFZB 5CGKA 1YNSA 2F0LA 1K0RA 3Q22A 4RFBA 2QDLA 3NEMA 5EPLA 1D6EC 3CD6A 5FO8B 1YNJC 3MFYA 4LUOA 1U4MA 3CMAA 5D65A 3KLSA 5IT9c 4BBSB 2A6EC 1KDCA 1I4QA 4X65Q 2KVDA 5K36G 2Q2TA 1JMCA 2RVLA 2KCMA 3IL8A 5EPJA 2I5MX 1I4RA 4JCVE 2WQGA 1ZEQX 3VR5A 2RQXA 1BVSA 1DM0B 4YHHL 2F52A 3HOUG 3J7AF 3FKIG 5LMNL 3OWEB 1D7QA 1WTOA 2K14A 2Q8TA 2NN6G 5FLMH 1M1KC 2RSOA 3Q0AA 5C3EB 3I4NH 1H9KA 5I2YA 1NMFA 5LL6X 3RN2A 3A7AB 3CCRA 4V0BA 4ZUIA 1SEBD 1YBYA 4MTNA 2KHSA 1KRSA 1EWCA 4EVOA 4KTAA 2K28A 1SJHD 3N52A 2A19A 4JI1Q 1BBWA 2E5LL 4A3CG 2DK4A 3G4SA 2WAQG 5M3FH 3HKZB 4XQNA 1D1IA 1QVGA 3PCOB 1N9WA 5E1FA 1QJOA 1Y02A 1YEZA 4OO1H 2WKDA 2MO0A 1WJJA 3FPPA 2JA8B 1SMXA 1WI5A 4R4OA 1YVCA 1NJIC 2JSOA 4A3BH 2F0HA 4N9TA 3W2DA 1S5CD 4ZRZA 3BS1A 2K52A 4R8NA 5A2QE 4IALA 4MNOA 2IWHA 1Z47A 4WJWA 3C2PA 4JOIA 2K05A 3PSIA 2AWOA 1STGA 2JA9A 3HKZE 4QUFA 5C4XB 3C46A 4JOIC 1P8LA 3I4MG 2OT2A 1TIID 5ELCA 2F0TA 1TT2A 4EQOA 1S40A 2F0EA 4KY5A 5GAGC 3UDIA 1RIPA 5A2QL 1UNSA 5IP7G 2JA7G 2IX0A 3K7AB 1KLUD 1QILA 1E2VA 5J1ZA 4JI0Q 2KA7A 1STYA 1Y8NB 1LTLA 3RUZA 2E75C 5DAUA 4QUCA 1YHQA 2H1EA 3PUZA 5CV6A 5M5XH 4V190 2A68D 3AB9A 1J9OA 1JICA 4I7ZC 3CCUA 3QR8A 2IX1A 2UU9L 2RA4A 4HR7B 5EPKA 1LT3D 5GAHC 1V43A 4HMIA 2VQFL 2FJ2A 1EZ6A 1S5DD 3IKJA 1TXYA 1J5EQ 3H3VH 1LV9A 1OXXK 5IGDA 3CPWA 1EEID 4OX9Q 3T56B 4JV5L 1F2YA 4DAMA 4NW2A 1HTPA 4FF1A 2UXBQ 1IXRA 4YCVA 1CKMA 4BBSH 4K0KQ 3AYHB 1SNOA 1XX8A 1EY6A 1ICFB 1IBLL 1X9NA 3F2UA 3NP8A 2KQ3A 2L12A 2PI2E 4A3LH 2NBFA 3EROA 3HOXB 1VQDA 5M9OA 1DYQA 2PW7A 4GNXB 4HJ8A 1VQ4A 4H0LC 5JJZA 5CMDA 3E6ZX 1C9OA 2UUAQ 2Z4IA 2JVWA 2HQEA 1B50A 1A2TA 1V1PA 5T1IA 3PMFA 2LY7A 1U4RA 2RSNA 2JXMB 1HNXL 5C3EH 1SFOH 3BG3A 1DOLA 1PFMA 1K28A 2DNEA 1GM5A 1VQ5A 1SMYC 1MGSA 2H4OA 4X3UA 1TWHH 3IFTA 2BA0A 3IAYA 2HDLA 5C44B 2VZAA 1SE3A 4TVAB 4ME5A 2R3ZA 4X3KA 1PVOA 3I90A 1MSGA 4HAEA 1IBKL 4KN7C 4KHZA 1AE3A 5JJKA 2Q2HA 1WTQA 3GQBA 4X6AH 5NUCA 4MZ9A 2JA8H 3D4RA 4CKBA 1L1OC 1EY0A 2A69C 1U0LA 1FNWA 5IGBA 3HEJA 2XNAC 4K6DA 3S15B 1IHZA 1GJXA 4LF8L 2YTYA 1I5FA 4DGZA 1GD7A 3KYHC 4LMQD 1JOOA 1HR0W 3OSOA 2RHSB 1XNRL 4HCEA 2EJMA 3H6MA 1SYEA 1AFPA 1RTOA 2KHIA 4FVMA 3L7ZC 4G7ZC 1I4PA 3S14B 2F0NA 2EY2A 3HOUB 1LABA 4DV2L 3CCVA 1B9MA 4GKJQ 5CC4A 1N34L 3T13A 2I07B 2EXZA 4JBMA 1R4QB 3TS2A 1B70B 4LW1A 4K5VA 3K7AH 3HOYB 3PO3G 1E3PA 1WCMB 4M1UB 3VR2A 4F88A 4YY3Q 2EYJA 4DV6L 3CAMA 5D14A 1XPRA 1EY8A 1K8AC 3AU7A 1IYUA 1CZWA 3DM1A 4KMUC 4RCNA 2B39A 3I2ZA 2MQHA 5CV5A 2WAQB 2DY8A 4NXNQ 2B29A 1GKUB 1GO3E 3SEBA 1MIUA 3HRZC 1Q8KA 3Q24A 1AZQA 1EOVA 2K5HA 2OQ0A 2IT1A 2L0CA 1EY7A 1UWVA 4DKAC 5C4HA 1V1QA 4B9WA 3TP7A 1XJVA 1H9EA 1YHBA 3RN5A 5GQOA 5C3WA 5CV4A 5FLMG 1D2BA 1CA5A 1N36Q 3I4NG 1JQYD 1PRTF 3DUZA 1MBYA 2CQAA 5EKIA 2JA5B 1F9PA 1D5ZC 2F4IA 4YIJA 1HTLD 1H9RA 3HG9A 4QJFA 2L9HA 1F2ZA 1SNMA 1HNZL 4AYBG 1WOCA 2B3GA 3JAMc 1D5MC 2F3VA 1A2UA 4GOPB 5IY0A 5ELOA 4LJZC 5CV7A 4X64Q 2QKIC 3V96A 3G71A 3RR5A 5C0XI 2BA1A 5M3FG 3BDLA 1U4PA 1Y69U 4ZCKA 3DLLA 4XYOA 1BQQT 2NTSA 2DJGC 4JI3Q 2QF7A 3VR3A 1UE6A 2JK8A 1SYGA 2VQEQ 2NUCA 3SK5A 2J4XA 4K6LA 4A3BG 1NAPA 2HHHQ 5DM63 4CGYB 3MEFA 3HS0C 2LKVA 5C44H 1SRUA 5GROA 3H91A 2AWNA 1HZBA 4M8AA 5ELEA 3IFDA 3RZDB 2KOLA 1EIFA 3T1YL 2CW0C 4KI0A 1KAAA 2DNCA 3TSSA 4LFBL 1SLJA 2PNRC 3CC7A 1CKNA 3E0EA 2A68C 3S15H 3A5UA 5TSSA 3S9WA 1JC7A 4QL5A 5K36H 1I4GA 3HOZB 2CH4A 1UE7A 4I65A 4H13C 3WWVA 1LTID 5IWAL 2EYHA 5JEAJ 1YZ6A 2WV6D 2UXCL 3G7LA 2A6ED 3I70A 2ASBA 3S14H 4XQQA 3ND9A 4DR3Q 3HOUH 2EJFC 2QILA 2QCPX 1PH3A 2NN6H 1PXUA 4CDFC 3S16B 1PDQA 4GLXA 3VYTA 1B44D 3MVVA 2UUCL 1WCMH 1G91A 1RCVD 2HCCA 3OW7A 4YWKA 4FNFA 4GLVB 2WP8J 2BOSA 1EYCA 4BS9A 3I4OA 2KW9A 3RLOA 1L0YB 4BBSG 1ZBHA 3FMCA 3D6CA 5ELDA 3ICEA 4DR7L 1UAPA 4A3CH 1HHVA 4DAVA 1EY4A 3BVGA 3H15A 2PNHA 4OO1I 2F0MA 4GKKQ 3EQLC 1L1OB 2CFMA 4EQPA 4A3LG 4RWSC 2HIVA 3TREA 2RHQB 4IPHA 4JI5Q 2CH4W 5D3IB 2XIWA 1MI2A 1VQ8A 1AE2A 5JEAG 3HP3A 1TS5A 4CBVA 4B3ML 4HCSA 2CVRA 1XWEA 3D4WA 5C3EG 1U9RA 2TMPA 4B08A 2JA5H 1G2TA 1EWHA 3ZYYX 1HA6A 3F2CA 2EE1A 2K32A 4DR4L 2HDMA 2C5CA 4IPDA 4IURA 5C4ZA 1M90C 1TS2A 4DR1L 1HA5A 2LFNA 1XPUA 1B53A 5IP7H 3HKZG 4A3FG 1S72A 1KLGD 1XMOL 4LF9Q 4QIWB 2F4VQ 1BCPD 4DR2L 3MA2B 4GLAC 4JBWA 2K5QA 4BXXG 1QZGA 1I50B 5M3MB 1SNDA 2JA8G 1GJJA 1PRTB 2EYFA 3J80E 4IPGA 3TMEA 2EZVA 4DUYQ 5A35A 1HPCA 1SE4A 3VDYA 4OXPA 1STNA 3QOLA 2XVSA 2LS01 3RZDH 3Q23A 2P5ZX 4LAAA 4IFDI 2V1CC 5C4XG 3CPFA 5CBEE 1LT4D 1PFSA 2R6GA 2IL8A 2R92B 5E4XA 4FF2A 4B3TQ 1XXGA 2M2LA 4A3DB 3LX0A 1GUOA 4DV4L 4A3EB 3SK8A 4K2KA 3HOZH 5ISRA 3EN2A 4LK1C 2MO1A 3KDFA 4JYAL 1PH2A 3K5NA 4ALPA 1EZ8A 1TWFB 1DONA 1KC8C 1SSOA 1RJTA 2RKSA 1XNQQ 4JI2L 4QB4A 2NVQB 1NE3A 3K5MA 2FFKB 4J1MA 1I94L 1CKOA 5I2XA 4XIGS 1MKHA 3MZ5A 1G2SA 4POFA 1PH7A 3S17B 1YHAA 2CQOA 3JC66 4XDXA 3OTOL 3BYYB 4HIKA 3S16H 3EA6A 1IL8A 1AH9A 4O2DA 2L55A 1IBML 2F0DA 4G7HC 4GN4B 4ULLA 4X3TA 5KGUA 2CHBD 4HSVA 4X66L 3H94A 2JN4A 1F9SA 1I6HB 1ET6A 1EQVA 3ERSX 3QG1A 5T1GA 4A3IG 1KL9A 2K50A 3GTPB 1SMYD 1VQJA 2SNSA 2N49A 4N8X1 5IT9E 4DK1A 4XQJA 3K59A 3X3NA 1AW7A 1S5ED 2Q2IA 1SYFA 2A73B 3G6JB 3HOXG 3RZOB 2E74C 1PYBA 1DD2A 5E7NA 3QKJA 4A76A 1LTBD 2JA6B 2YTXA 3A7LA 2DUDA 4KJOA 1KD1C 1VQMA 2D0PA 2JP1A 1XTDA 4Y52H 4CKEA 5IT9L 1R9TH 1KAWA 2A69D 3FRPB 1ICWA 1DXMA 4LF6Q 3F2DA 1SNQA 1ZS9A 2R93G 3HOVB 4DR5Q 5C44G 2I5HA 3PUXA 2DN8A 3VA5A 2KCCA 1QZHA 4B3RQ 2N88A 1I50H 1X54A 1I3QB 5I9PA 5M3MH 1YITA 4JBKA 4JI8L 3ERQA 2Z6KA 4LWCA 1ENCA 1FD7D 4JI4Q 3CCLA 5G3LD 4PMCA 4NDXA 3K6OA 4DXFA 1B7YB 2PQAB 1Q81C 1BBXC 2NVYB 4CDCC 1DCZA 1Z7TA 3NHHA 1A63A 1VQFA 1A6XA 2AUKA 3CKIB 3HGBA 4RGOS 5EQ0A 3G6EA 1EOTA 1TY0A 2F0KA 2XWJB 1FNUA 1TWCB 4RKBA 2F1MA 4A3DH 1HRJA 4RKLA 3DWPA 4CKCA 2M00A 3ULLA 4X65L 4A3EH 4IUTA 3K5OA 2Y0SE 3HOYG 1WCMG 3PGZA 4ZKCB 1PZID 1TWFH 2KEEA 5IGGA 5IGEA 5IYBG 4LF7Q 4PZ7A 3ULPA 4GS3A 1J6QA 4DNIA 2NVQH 3NUCA 2PPBC 1SR3A 3GTGB 4A3FB 1ZXTA 3LLRA 3S17H 3W1BA 3CCQA 4DAYB 4A3KB 1EY9A 2R61A 4N8FA 1B9NA 5K5PA 4HSPA 3FP9A 3I72A 3UDXA 1TS3A 1I6HH 3KK7A 1YI2A 4EQNA 5JJIA 3KLRA 3CMEA 1SE8A 3PUYA 2JA5G 2MGSA 3GTPH 2VUMB 1EN7A 1Z6HA 1BCPC 4P2CB 3D0FA 4PQXA 2R7FA 1QVFA 1ESRA 1Z9FA 3M9BA 2JA6H 1AEXA 2CW0D 3RD4A 4PZ6A 3V05A 2ICEC 4NP5A 2YU9B 1W6KA 3ITPA 1ONLA 3I73A 4XTCS 4ID6A 1CTMA 1EQTA 4WRDA 4L8JA 4OHJA 2D5DA 1LO5D 3A56A 5L37A 5C4JB 4BY1B 1HQRD 1CUKA 1RF2D 3MAQA 2FMCA 3BVZA 2NN6I 3HOVH 3DHQA 1H9MA 4DR6Q 1V9PA 4A75A 3OIPA 1UEAB 3AEVA 1Q3LA 3CQZB 3GTQB 3S1RB 3BZKA 1Y1VG 4JI0L 2EJGC 4NMZA 1JWSD 1I3QH 1SYCA 1NSNS 4C3JG 5EAYA 4JV5Q 3D3RA 4AQYQ 2J0TD 1NR4A 1XPOA 1QOHA 4HEDA 4U68A 3L3OC 2FXQA 4A3IB 4BBRB 3T16A 4QCLA 3HOZG 2AKWB 2EOTA 2EQSA 1K83B 2NVTB 1KDAA 3S24A 3D31A 1E2WA 1ASZA 3RNUA 4I7AA 4LF5L 4IUQA 5JEAH 2UXBL 1TWCH 2ZJPA 4DNRB 4K0KL 1EU3A 2IHFA 4HIDA 4OWXB 4HJ7A 2VB2X 2Z6BA 5EBCA 1HH2P 3A8IE 4LFCQ 5CBAE 5IODA 5JVH3 1PZJD 1TVXA 1EIHA 3SVMA 4A3JG 1V8QA 1BF4A 1KIXA 1GOZA 4IQZA 1Q1EA 3GTMB 1HQMC 2R93B 1IYVA 4JI7L 1L2FA 1KDBA 2UUAL 1BKBA 1PA6A 3K0YA 4FO2A 3BZCA 4O42A 4X62Q 3GTGH 3SK6A 3TZUA 1IBKQ 4Q5VA 4A3FH 2WACA 2Z9HA 4P71A 1VQEA 1I4XA 1GHKA 3C1FA 2K7VA 4A3KH 4BXXH 2RCNA 4IPCA 3GTKB 4OONA 4HJ5A 3CRKC 3CCEA 5FKAC 3CC2A 4E6IA 2F0GA 3OPOA 4G7OC 2GVAA 1STBA 1BXTA 3TN2A 2ZTEA 4H7BA 2LXKA 2G9HD 3NTHA 4IZ8A 3DMUA 4OWWB 3KF6A 2VUMH 2WIIB 4HIOA 2B63G 3GV6A 5KYIA 4KY6A 4LFAQ 2MPHA 5C4XH 2ZTDA 4PG3A 4DFAA 5J22A 4DF7A 4RCOA 5GADC 2HIXA 4TKOB 3I91A 1HXYD 3VYSA 4K5XA 3KF8B 4DXGA 3T1HQ 3D6WA 2YU9H 3BU2A 2RNOA 1PYSB 2F3IA 3BDOA 1W2BA 5M3MG 1VQCA 1C0AA 1A3UA 1X3FA 4RH6A 5C4JH 5I9OA 1C48A 1D1KA 2B8GA 1F77A 3JAML 3CW2C 1RTNA 3K7UC 1OO9B 1X3QA 4DV1Q 4TSSA 1V66A 4GKJL 2LD7A 3I4LA 2N8NA 1LT5D 3Q6SA 3IRBA 4KN4C 3MC0B 4JC0A 3CQZH 1FVIA 2OQKA 2O2LD 4OIJA 1PTOC 3GTQH 3S1RH 5M5WB 5G3LF 1FL0A 1H9SA 1WD0A 1X65A 4YY3L 4MN3A 4DV7Q 2R92G 2K4KA 3CXCA 5F2DA 1K3BC 2ZM6Q 2DY7A 2QEJC 3ER0A 3N6RA 4A3DG 3BVMA 2EYMA 4UZWA 3M4QA 1VQIA 4RGMA 4A3EG 4A3IH 4BBRH 4JPBW 1N33Q 2X69A 1SE2A 4NXNL 4QGUA 3D4DA 5AFWA 4IUUA 4J15A 4F8MA 1K83H 4N9PA 4LUVA 2NVTH 5LMUQ 2E2HB 3VYUA 3HOXH 1F9RA 2D62A 5FJ8G 4UDUC 3U50C 4KKSA 1WTWA 4QQBX 4KKUA 1WTHA 1PH5A 4Y7NB 3R8BA 3JAMi 3CU7A 1I6VC 4UAIA 3MXNA 1RD9D 2MNAA 4C1NI 1FR3A 1HCZA 4ZQ3A 2OWOA 3UE0A 2F0FA 5IGFA 1E1TA 2B8FA 1H9FA 5J39A 1VS0A 4BY7B 5DLQE 1TWAB 2X6GA 2JEBI 1PH6A 1PZKD 1YNND 4X64L 4IJHA 2NZ1D 1JWUD 3GTMH 2R93H 4RHSA 3L2PA 2BCOA 3GD7A 2L4NA 1XMQQ 1BBUA 1HNWL 2L11A 1ZKOA 4KHPL 3GTJB 1EIGA 1Y1VB 3TP5A 4LF4L 3NWSA 4JI3L 1DOMA 1S3OA 3W3AA 1LYLA 4C3JB 3GTKH 4QF4A 2ZT9C 3NK9A 2VQEL 2NYZD 2W51A 2RDGA 2JA6G 1VQ7A 4TQUS 4DU9A 2HHHL 5BR8Q 4F7XA 2BE5C 1A15A 1B3QA 2KENA 4IFDJ 2HUGA 2K5VA 2WKCA 4XYQA 2OTLA 1X3EA 1K8OA 5JAVA 1K73C 4WORA 1UEBA 4C56C 3WOFA 3PIO3 1PH8A 3HOVG 5FLXE 1V1PB 4H02A 2HQLA 3SK4A 1QUQA 2EPBA 2F0VA 4HIMA 4KD3A 1EWIA 3A8JE 3HOYH 3FEWX 2KECA 4B3SQ 1KHIA 3CP0A 3NSWA 3NELA 2N3SA 3HZXA 4H44C 2N55A 4A3JB 3C1EA 3EJIA 2R7DA 2K03A 1AN8A 5KRUA 3BYTB 3L9AX 2KJXA 1STAA 5IYBH 1Q1BA 4OIKA 2GA4B 2WB1E 2Y0SG 1QWYA 1HZ9A 5FLXL 2OTJA 4UP9A 2F0OA 4DR3L 2RF4A 3EFXD 2K04A 3BDCA 1B2TA 3C3LA 3LNNA 5ELBA 5JOBA 3TEHB 5M5WH 3J7YW 5C3XA 5FK9C 4DV0L 1IW7C 3H3VC 1YJWA 3NWTA 1N32L 3J7AV 3LWUA 1TKWB 4L5QA 2GVBA 4B3MQ 4P74A 5AJ3Q 2RCFA 1HR0L 2UXDQ 1BO0A 2A8VA 1CT1D 1DJRD 1A3TA 3K5LA 3MEHA 1KTKA 2PQAA 2PZUA 1IL2A 1ILPA 3SGIA 2B63B 4GKKL 1FNVA 3QIAA 3KJPA 1H1JS 4WFN3 3X3MA 1O78A 3KOJA 3I7FA 3A74A 4DK6C 5IYDH 4IUVA 1OXSC 1GUTA 1DOKA 5H1SE 2EY1A 2YV5A 3UI2A 3J7ZC 2I5LX 4F87A 3FLGA 2SOBA 3H0GG 3LWEA 4A3KG 2B2UA 5KEEA 4FDBA 4DV3L 3DWQA 1VQBA 1EUJA 1KNAA 3TBIB 2BDOA 2B2UC 4BY7H 3SXHA 4PNYA 3P75A 3GTOB 2NZOA 2NWGA 4ZAIA 4IN3A 2QGQA 4JI6L 4LF9L 3H3VI 3R93A 2F4VL 2VUMG 1WFQA 3QWNA 1OTCA 1Y1VH 1N8RC 5CR3A 1Y1WG 1GL9B 4ZLTF 4C3JH 4RG1A 1G8ZD 1RHPA 2LXJA 3J7A5 4DUZL 4DAPA 2I46A 4DV4Q 4DUYL 4XT1B 4EQ5A 2K75A 2KEDA 2OCEA 2JEAI 3VR6A 3B6YA 3M4OB 3UDFA 1NTGA 3AMUA 1OXVA 1CSPA 5M5YB 2JQOA 5IGCA 3KLWA 4BY1G 1JJCB 3NBHB 1JJRA 3VYRA 4PMWA 4B3TL 2RDFA 4K14A 1E7ZA 1G6ZA 1IBMQ 3P20A 4HN7A 4JG2A 4WJ4A 3J81c 5I6WA 4A3JH 1TU2B 2XWBB 2V4DA 4MIUA 1XNQL 3CRLC 3CC4A 5KYLA 4YCUA 2EVBA 3J81i 1O7ZA 4BBRG 1EQQA 2KUMA 3E5SA 2PI2A 1R4PB 3PF5A 4RHRA
chains in the Genus database with same CATH topology
2MFIA 1K3RA 3J80c 2ATWA 4DV2L 3D0FA 3CCVA 2R7FA 2HT1A 4GKJQ 3PO2G 1QVFA 1N34L 1Z9FA 3M9BA 4JBMA 1IZ6A 3TS2A 1B70B 1X55A 4LW1A 1E7DA 1NY4A 2KBNA 3K7AH 4B3SL 2AHOB 2JA6H 3HOWH 3PO3G 1CKNB 4DK3C 1E3PA 4DV0Q 1JJGA 2ZTCA 4IFDG 4PZ6A 4NB3A 1A0IA 4NXMQ 1N32Q 2JE6I 2UUBQ 4YY3Q 4DV6L 3CAMA 4XTCS 1XPRA 2IHEA 1HR0Q 4IJLA 1K8AC 5IE8A 1QVCA 3K0XA 3I2ZA 2MQHA 2G80A 4C3IH 3DM3A 5HY6A 4BA1I 3KF6B 2B63H 1CUKA 4NXNQ 4DR4Q 1A62A 2B29A 1GKUB 1GO3E 2NN6I 4GNXA 1FJGQ 3HOVH 4R4IA 1MIUA 1D8LA 3AFQA 2WFWA 2E2HH 1Q8KA 3EBEA 1V9PA 4DR1Q 4DR6Q 1P16A 4A75A 2UUBL 1EIYB 4POGA 4GNXC 1EOVA 2K5HA 2OQ0A 3AEVA 2IT1A 1G51A 4JI5L 1K9MC 1UWVA 4DKAC 1V1QA 4LNQA 3BZKA 1Y1VG 5LMNW 4JI0L 4Y7NH 2BH2A 1XJVA 1XMOQ 1I3QH 1H9EA 5EAYA 5AJ3L 1YHBA 4DR2Q 5GQOA 3RN5A 4JV5Q 1PHJA 4AQYQ 2UXDL 5FLMG 1XPOA 4DV3Q 1N36Q 2EIFA 3I4NG 4A3GH 1C7YA 5FLXc 2FXQA 1LUZA 3F8TA 4LF6L 4QJFA 4DV5L 1PH9A 2Z6KC 1OXUA 1EYGA 1HNZL 4AYBG 1WOCA 4L5RC 3GTOH 2B3GA 3JAMc 3HOZG 1TWAH 2AKWB 3I4MH 2EQSA 1E24A 2XTIA 3PF4A 4GOPB 5IY0A 5ELOA 4JI6Q 4RMFA 3M3YH 4X64Q 3S24A 3G71A 3RR5A 3D31A 1E1OA 1ASZA 1YJNA 1E22A 5C0XI 2HJQA 2JA7H 4B3RL 4A93G 2BA1A 4YHHQ 5M3FG 3RNUA 3U58A 2CKZB 3RLNA 4LF5L 3DLLA 1NMGA 3GTJH 5LMNQ 1Q7YC 1E7LA 1CSQA 1T9HA 2R92H 2UXBL 1TWCH 1KRTA 2ZJPA 4JI3Q 4K0KL 2IHFA 5IP9G 1UE6A 4HIDA 1JT8A 4OWXB 2JK8A 2VS1A 4HJ7A 4DUZQ 4UY8C 4JI4L 1G6PA 3GO5A 1YIJA 2VQEQ 1HH2P 4LFCQ 3ZJYC 4A3BG 4A3JG 2BH8A 2HHHQ 1KQSA 3M4OH 1KIXA 3MEFA 4R4TA 2ODCI 3M85A 4BA2I 5M5YH 5C44H 1Q1EA 1SRUA 5GROA 3K8AA 1YNXA 2AWNA 4JYAQ 1HZBA 4JI7L 1L2FA 4ME3A 4YWMA 2UUAL 4PZ8A 1K8GA 1BKBA 1PA6A 3GTGH 3BZCA 4QIWE 1EIFA 4JI2Q 5FJ8H 4X62Q 2YTVA 3T1YL 1IBKQ 1RL2A 3S2HH 4A3FH 4KI0A 4P71A 3NENA 4GN5A 1VQEA 3CCJA 1I94Q 4LFBL 4AIMA 4A3KH 4C3HH 4BXXH 1JJ2A 1SLJA 2RCNA 4IPCA 3CC7A 1GVPA 4L5TA 3OTOQ 1CKNA 1VCIA 4OONA 4HJ5A 1NBWA 1VQAA 3E0EA 2QA4A 3MXNB 1HZAA 3HOWG 3EIVA 3CCEA 3S15H 3A5UA 2VNUD 3K80C 2C35B 3CC2A 2QNFA 4QL5A 1PH1A 1Y14B 4X66Q 2GVAA 1UE7A 3CF5A 3WWVA 4YCWA 2ZTEA 3G48A 4LF7L 3K81C 2LXKA 5IWAL 4OWWB 5JEAJ 3KF6A 1YZ6A 4JI1L 2VUMH 4HIOA 2UXCL 4OWTB 3PUWA 2ASBA 2B63G 1FGUA 1VQ9A 3CCMA 3S14H 4LFAQ 3HOUH 2MPHA 5C4XH 2ZTDA 4DR3Q 3LGJA 4PG3A 2LC3A 1PH3A 4A3MH 5GADC 1MJEA 3RZOH 2HIXA 2I0QA 2ID0A 4GLXA 1X6OA 3S1QH 2UUCL 3KF8B 5IYDG 1VQOA 3FHWA 1WCMH 3T1HQ 4IOAA 4YWKA 4AH6A 3BU2A 2CWPA 2WP8J 4GLVB 2VW9A 4IOCA 2YU9H 1PYSB 1WYDA 4AYBE 2F3IA 3J80i 1B8AA 1VQPA 4UP8A 1W2BA 5M3MG 3I4OA 4NPSA 1VQCA 3U4ZA 1X3GA 1JB7A 3RLOA 1O7IA 3Q8DA 3KDFB 1C0AA 1X3FA 4A3GG 3M7NA 4BBSG 3ICEA 4DR7L 5C4JH 2GN5A 3HOVG 4A3CH 4BY7G 4A4IA 3CW2C 5HGQA 3K7UC 3H15A 4GOPA 4DV1Q 2PNHA 4OO1I 4GKJL 1VQHA 4GKKQ 2LD7A 1L1OB 2N8NA 2UU9Q 2CFMA 3F2BA 4GOPC 4A3LG 3IRBA 1JE5A 2A1AA 2HIVA 4JC0A 3TS0A 3CQZH 3TREA 1FVIA 2OQKA 2K5NA 2RHQB 4IPHA 3GTQH 2R7ZH 4JI5Q 4DR6L 3S1RH 4KLKA 5J3BA 2VQFQ 2KHJA 1FL0A 4NXML 1VQLA 1QUQB 4C2MH 3KJOA 1VQ8A 1W3SA 1AE2A 1X65A 4YY3L 3J81j 3PIPA 5JEAG 4DV7Q 1VQ6A 2R92G 2K4KA 1VQGA 3CXCA 5IYCH 4B3ML 5C3EG 2ZM6Q 3ER0A 2CWAA 4JI8Q 4EX5A 2KFVA 2ES2A 2JA5H 4A3DG 1TWGH 3M4QA 1VQIA 4A3EG 4A3IH 4BBRH 1Q86C 1N33Q 1HZCA 3W5OA 3F2CA 2N78A 4NXNL 4QGUA 4DV5Q 4DR4L 1FJGL 4IPDA 3RLFA 4J15A 1M90C 1K83H 3I55A 3A5ZB 4P73A 1PH4A 4LUVA 4DR1L 1IBLQ 3F1ZA 3TQYA 5LMUQ 2NVTH 3PO2H 3I56A 1XPUA 4DR5L 3STBD 3HOXH 1PV4A 1Q46A 2WB1G 2LSSA 2D62A 2NVYH 4LUZA 5FJ8G 3U50C 4QQBX 3PO3H 1J5EL 3HFZB 3HKZG 5IP7H 1YNSA 4A3FG 1XMOL 1S72A 1PH5A 1K0RA 2CCZA 4LF9Q 2VL6A 2F4VQ 3TRZA 4DR2L 4LF5Q 3JAMi 4OX9L 3NEMA 4GLAC 4JBWA 4AQYL 1VQNA 4BXXG 1QZGA 3CD6A 2MNAA 2OWOA 4LUOA 2JA8G 3CMAA 1HNXQ 1GJJA 3UE0A 5IT9c 2QNCA 1LM0A 3U4VA 1E1TA 1H9FA 2E2JH 4IPGA 4X65Q 1EQRA 1SROA 1VS0A 5K36G 2Q2TA 5DLQE 2JEBI 4DUYQ 2H5XA 1PH6A 1JMCA 2KCMA 3VDYA 4OXPA 4X64L 4IJHA 2I5MX 3GTMH 5C0XJ 4JCVE 2R93H 3HKSA 3L2PA 3CCSA 4JI7Q 3RZDH 1BVSA 4YHHL 3GD7A 2F52A 3PIOA 1XMQQ 1BBUA 3E9IA 4IFDI 1HNWL 2V1CC 3HOUG 1UE1A 4KHPL 3FKIG 5LMNL 3CPFA 5C4XG 2JJQA 4L5SA 1D7QA 4LF4L 1PFSA 2K14A 2R6GA 4JI3L 1S3OA 2NN6G 1LYLA 5FLMH 1M1KC 4B3TQ 3UE1A 3H0GH 3I4NH 3GTKH 2VQEL 4LFCL 1NMFA 2W51A 4DV4L 3RN2A 2JA6G 1VQ7A 4TQUS 2HHHL 5BR8Q 3CCRA 3M4PA 3HOZH 3EN2A 4LF8Q 2MO1A 2KENA 3KDFA 1YBYA 4JYAL 4MTNA 1ASYA 4IFDJ 1Q12A 2K5VA 1PH2A 4ALPA 1KRSA 4R4CA 3UDGA 1X3EA 1KC8C 2OTLA 2E5LL 1XNQQ 4X62L 4JI2L 1XNRQ 2A19A 4JI1Q 1BBWA 4A3CG 2DK4A 3G4SA 1NE3A 2WAQG 5M3FH 1K73C 1I94L 4IO9A 1CKOA 1UEBA 1L1OA 1QVGA 3S1MH 3PCOB 1IYJB 4XIGS 1N9WA 3AFPA 1MKHA 4P75A 1GKHA 1Y02A 4POFA 1Y1WH 1PH7A 1PH8A 1YEZA 1YHAA 2CQOA 2Z0SA 3JC66 3OTOL 4HIKA 2E2IH 4JBJA 2MO0A 4H02A 1WJJA 4O2DA 4DV2Q 3S16H 2OTJA 2HQLA 1IBML 1SMXA 1QUQA 1N34Q 4HIMA 1WI5A 4GN4B 1EWIA 4R4OA 1YVCA 5C0XG 1NJIC 3HOYH 2NZHA 4X66L 4A3BH 4B3SQ 1KHIA 3CP0A 3NELA 2N3SA 1YJ9A 5IYCG 2K52A 2R7DA 1JEIA 3STBC 3ERSX 4HJAA 4MNOA 3S2DH 4DV6Q 5IYBH 1Q1BA 4A3IG 2WB1E 1Z47A 1KL9A 2Y0SG 2K50A 1HZ9A 4JOIA 3PUVA 3PSIA 4UP9A 2AWOA 3ULJA 4DR3L 4LFAL 2JA9A 1VQJA 3HKZE 2ZJRA 4BY1H 2N49A 3AQQA 1A8VA 1MJCA 4JOIC 1P8LA 2ZJQA 3I4MG 2Q2IA 2RF4A 1SN8A 1S40A 3HOXG 2QEXA 5GAGC 1PYBA 3UDIA 2ODGC 5E7NA 1RIPA 3TEHB 5M5WH 5IP7G 3T1HL 4A76A 2L15A 2JA7G 2IX0A 2YYZA 4DV0L 3OYYA 2YTXA 4R4QA 1YJWA 2DUDA 1N32L 1KD1C 4JI0Q 1VQMA 1AH9A 2D0PA 4L5QA 1XTDA 2DGYA 2GVBA 4B3MQ 1LTLA 4P74A 4Y52H 5AJ3Q 1HR0L 1YHQA 2UXDQ 5M5XH 3PUZA 1R9TH 1KAWA 2A8VA 2Q2UA 4DV1L 2PQAA 1G291 3CCUA 1IL2A 4LF6Q 2IX1A 3SGIA 3F2DA 1KXLA 4GKKL 3GTLH 3A0JA 2UU9L 1HNZQ 5GAEC 2D0OA 1ZS9A 3OW2A 1H95A 2PMZE 2R93G 2XGTA 3KJPA 1UE5A 4DR5Q 5GAHC 5C44G 1V43A 2I5HA 3I7FA 3KOJA 3PUXA 3A74A 2VQFL 4HJ9A 4DK6C 5IYDH 1OXSC 1TXYA 1J5EQ 2E5LQ 3H3VH 1QZHA 5H1SE 1OXXK 3CPWA 4DV7L 4B3RQ 1HJPA 2YV5A 4OX9Q 2VY3A 1I50H 1X54A 3J7ZC 4JV5L 2I5LX 5M3MH 2ZM6L 4DAMA 1YITA 3H0GG 4JI8L 4A3KG 4JBKA 2UXBQ 4FDBA 1IXRA 2Z6KA 4YCVA 4DV3L 1N36L 1CKMA 1VQBA 4BBSH 1EUJA 4LWCA 4K0KQ 1N33L 3L0OA 3W1GA 3AYHB 4JI4Q 4BY7H 3CCLA 2WAQE 3S1NH 5JJLA 1IBLL 2ALYB 2NZOA 5LMUL 4O0AA 1X9NA 3GDEA 4UPAA 2PI2E 4A3LH 1B7YB 2QGQA 4JI6L 2PQAB 1Q81C 5ELNA 1VQDA 4HJ8A 4GNXB 2IY5B 1VQ4A 4LF9L 1A63A 3H3VI 1C9OA 1VQFA 2F4VL 2VUMG 2UUAQ 1HNWQ 4P72A 1WFQA 4KHPQ 1OTCA 1VQKA 2E8GA 1Y1VH 3T1YQ 3G6EA 1N8RC 1Y1WG 1GL9B 4LF4Q 4OO1G 4C3JH 4RG1A 4LFBQ 1HNXL 5C3EH 4UP7A 1SFOH 2LXJA 4A3MG 3J7A5 4A3DH 1X56A 4DUZL 3ULLA 4X65L 4DV4Q 4A3EH 1DGSA 3HOYG 1U5KA 2Y0SE 1GM5A 1VQ5A 1WCMG 4DUYL 4EQ5A 3BJUA 2K75A 2OCEA 1TWHH 2NVXH 1Q82C 2JEAI 3B6YA 3PGZA 2BA0A 3UDFA 1NTGA 1OXVA 1OXTA 1TWFH 5IYBG 1CSPA 4LF7Q 4R1JA 4PZ7A 4APVA 2JQOA 2VZAA 3ULPA 4TVAB 1XMQL 4GS3A 1J6QA 4YWLA 4DNIA 3E9HA 2NVQH 5IWAQ 3KLWA 1PVOA 1SR3A 4BY1G 1IBKL 1JJCB 4A93H 4KHZA 2UXCQ 3NBHB 1AE3A 5JJKA 2Q2HA 1EFWA 3S17H 4B3TL 4PMWA 3PV0A 3W1BA 3CCQA 4WJ3M 4X6AH 4DAYB 1E7ZA 4MZ9A 2JA8H 1L1OC 1IBMQ 5IP9H 1U0LA 2R7ZG 5BR8L 4QY7A 4JG2A 4WJ4A 2AMCB 3FP9A 3UDXA 3J81c 2UUCQ 2YTYA 2KCTA 4LF8L 1YI2A 1I6HH 1I5FA 1GD7A 3KYHC 4A3JH 1HR0W 5JJIA 3CMEA 4DPGA 1SE8A 1XNQL 2RHSB 1XNRL 3PUYA 2JA5G 2EXDA 3CC4A 4YCUA 3GTPH 1L0WA 3J81i 4BBRG 2KHIA 1EQQA 1EN7A 3KFUA 3FKIH 3L7ZC 2PI2A 4GN3B 4DR7Q 3PF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFI A;  1K3R A;  3J80 c;  2ATW A;  4DV2 L;  3D0F A;  3CCV A;  2R7F A;  2HT1 A;  4GKJ Q;  3PO2 G;  1QVF A;  1N34 L;  1Z9F A;  3M9B A;  4JBM A;  1IZ6 A;  3TS2 A;  1B70 B;  1X55 A;  4LW1 A;  1E7D A;  1NY4 A;  2KBN A;  3K7A H;  4B3S L;  2AHO B;  2JA6 H;  3HOW H;  3PO3 G;  1CKN B;  4DK3 C;  1E3P A;  4DV0 Q;  1JJG A;  2ZTC A;  4IFD G;  4PZ6 A;  4NB3 A;  1A0I A;  4NXM Q;  1N32 Q;  2JE6 I;  2UUB Q;  4YY3 Q;  4DV6 L;  3CAM A;  4XTC S;  1XPR A;  2IHE A;  1HR0 Q;  4IJL A;  1K8A C;  5IE8 A;  1QVC A;  3K0X A;  3I2Z A;  2MQH A;  4C3I H;  3DM3 A;  5HY6 A;  4BA1 I;  3KF6 B;  2B63 H;  1CUK A;  4NXN Q;  4DR4 Q;  1A62 A;  2B29 A;  2NN6 I;  1GO3 E;  4GNX A;  1FJG Q;  3HOV H;  4R4I A;  1MIU A;  1D8L A;  3AFQ A;  2WFW A;  2E2H H;  1Q8K A;  3EBE A;  1V9P A;  4DR1 Q;  4DR6 Q;  1P16 A;  4A75 A;  2UUB L;  1EIY B;  4POG A;  4GNX C;  1EOV A;  2K5H A;  2OQ0 A;  3AEV A;  2IT1 A;  1G51 A;  4JI5 L;  1K9M C;  1UWV A;  4DKA C;  1V1Q A;  4LNQ A;  3BZK A;  1Y1V G;  5LMN W;  4JI0 L;  4Y7N H;  2BH2 A;  1XJV A;  1XMO Q;  1I3Q H;  5EAY A;  5AJ3 L;  1YHB A;  4DR2 Q;  5GQO A;  3RN5 A;  4JV5 Q;  1PHJ A;  4AQY Q;  2UXD L;  5FLM G;  1XPO A;  4DV3 Q;  1N36 Q;  2EIF A;  3I4N G;  4A3G H;  1C7Y A;  5FLX c;  2FXQ A;  1LUZ A;  3F8T A;  4LF6 L;  4QJF A;  4DV5 L;  1PH9 A;  2Z6K C;  1OXU A;  1EYG A;  1HNZ L;  4AYB G;  1WOC A;  4L5R C;  3GTO H;  2B3G A;  3JAM c;  3HOZ G;  1TWA H;  2AKW B;  3I4M H;  2EQS A;  1E24 A;  2XTI A;  3PF4 A;  4GOP B;  5IY0 A;  5ELO A;  4JI6 Q;  4RMF A;  3M3Y H;  4X64 Q;  3S24 A;  3G71 A;  3RR5 A;  3D31 A;  1E1O A;  1ASZ A;  1YJN A;  1E22 A;  5C0X I;  2HJQ A;  2JA7 H;  4B3R L;  4A93 G;  2BA1 A;  4YHH Q;  5M3F G;  3RNU A;  3U58 A;  2CKZ B;  3RLN A;  4LF5 L;  3DLL A;  1NMG A;  3GTJ H;  5LMN Q;  1Q7Y C;  1E7L A;  1CSQ A;  1T9H A;  2R92 H;  2UXB L;  1TWC H;  1KRT A;  2ZJP A;  4JI3 Q;  4K0K L;  2IHF A;  5IP9 G;  1UE6 A;  4HID A;  1JT8 A;  4OWX B;  2JK8 A;  2VS1 A;  4HJ7 A;  4DUZ Q;  4UY8 C;  4JI4 L;  1G6P A;  3GO5 A;  1YIJ A;  2VQE Q;  1HH2 P;  4LFC Q;  3ZJY C;  4A3B G;  4A3J G;  2BH8 A;  2HHH Q;  1KQS A;  3M4O H;  1KIX A;  3MEF A;  4R4T A;  3M85 A;  4BA2 I;  5M5Y H;  5C44 H;  1Q1E A;  1SRU A;  5GRO A;  3K8A A;  1YNX A;  2AWN A;  4JYA Q;  1HZB A;  4JI7 L;  1L2F A;  4ME3 A;  4YWM A;  2UUA L;  4PZ8 A;  1K8G A;  1BKB A;  1PA6 A;  3GTG H;  3BZC A;  4QIW E;  1EIF A;  4JI2 Q;  5FJ8 H;  4X62 Q;  2YTV A;  3T1Y L;  1IBK Q;  1RL2 A;  3S2H H;  4A3F H;  4KI0 A;  4P71 A;  3NEN A;  4GN5 A;  1VQE A;  3CCJ A;  1I94 Q;  4LFB L;  4AIM A;  4A3K H;  4C3H H;  4BXX H;  1JJ2 A;  1SLJ A;  2RCN A;  4IPC A;  3CC7 A;  1GVP A;  4L5T A;  3OTO Q;  1CKN A;  1VCI A;  4OON A;  4HJ5 A;  1NBW A;  1VQA A;  3E0E A;  2QA4 A;  3MXN B;  1HZA A;  3HOW G;  3EIV A;  3CCE A;  3S15 H;  3A5U A;  2VNU D;  3K80 C;  2C35 B;  3CC2 A;  2QNF A;  4QL5 A;  1PH1 A;  1Y14 B;  4X66 Q;  2GVA A;  1UE7 A;  3CF5 A;  3WWV A;  4YCW A;  2ZTE A;  3G48 A;  4LF7 L;  3K81 C;  2LXK A;  5IWA L;  4OWW B;  5JEA J;  3KF6 A;  1YZ6 A;  4JI1 L;  2VUM H;  4HIO A;  2UXC L;  4OWT B;  3PUW A;  2ASB A;  2B63 G;  1FGU A;  1VQ9 A;  3CCM A;  3S14 H;  4LFA Q;  3HOU H;  4DR3 Q;  5C4X H;  2ZTD A;  3LGJ A;  4PG3 A;  1PH3 A;  4A3M H;  5GAD C;  1MJE A;  3RZO H;  2HIX A;  2I0Q A;  2ID0 A;  4GLX A;  1X6O A;  3S1Q H;  2UUC L;  3KF8 B;  5IYD G;  1VQO A;  3FHW A;  1WCM H;  3T1H Q;  4IOA A;  4YWK A;  4AH6 A;  3BU2 A;  2CWP A;  2WP8 J;  4GLV B;  2VW9 A;  4IOC A;  2YU9 H;  1PYS B;  1WYD A;  4AYB E;  2F3I A;  3J80 i;  1B8A A;  1VQP A;  4UP8 A;  1W2B A;  5M3M G;  3I4O A;  4NPS A;  1VQC A;  3U4Z A;  1X3G A;  1JB7 A;  3RLO A;  1O7I A;  3Q8D A;  3KDF B;  1C0A A;  1X3F A;  4A3G G;  3M7N A;  4BBS G;  3ICE A;  4DR7 L;  5C4J H;  2GN5 A;  3HOV G;  4A3C H;  4BY7 G;  4A4I A;  3CW2 C;  5HGQ A;  3K7U C;  3H15 A;  4GOP A;  4DV1 Q;  2PNH A;  4OO1 I;  4GKJ L;  1VQH A;  4GKK Q;  1L1O B;  2N8N A;  2UU9 Q;  2CFM A;  3F2B A;  4GOP C;  4A3L G;  3IRB A;  1JE5 A;  2A1A A;  2HIV A;  4JC0 A;  3TS0 A;  3CQZ H;  3TRE A;  1FVI A;  2OQK A;  2K5N A;  2RHQ B;  4IPH A;  3GTQ H;  2R7Z H;  4JI5 Q;  4DR6 L;  3S1R H;  4KLK A;  5J3B A;  2VQF Q;  2KHJ A;  1FL0 A;  4NXM L;  1VQL A;  1QUQ B;  4C2M H;  3KJO A;  1VQ8 A;  1W3S A;  1AE2 A;  1X65 A;  4YY3 L;  3J81 j;  3PIP A;  5JEA G;  4DV7 Q;  1VQ6 A;  2R92 G;  2K4K A;  1VQG A;  3CXC A;  5IYC H;  4B3M L;  5C3E G;  2ZM6 Q;  3ER0 A;  2CWA A;  4JI8 Q;  4EX5 A;  2ES2 A;  4A3D G;  2JA5 H;  1TWG H;  3M4Q A;  1VQI A;  4A3E G;  4A3I H;  4BBR H;  1Q86 C;  1N33 Q;  1HZC A;  3W5O A;  3F2C A;  2N78 A;  4NXN L;  4QGU A;  4DV5 Q;  4DR4 L;  1FJG L;  4IPD A;  3RLF A;  4J15 A;  1M90 C;  1K83 H;  3I55 A;  3A5Z B;  4P73 A;  1PH4 A;  4LUV A;  4DR1 L;  1IBL Q;  3F1Z A;  3TQY A;  5LMU Q;  2NVT H;  3PO2 H;  3I56 A;  1XPU A;  4DR5 L;  3STB D;  3HOX H;  1PV4 A;  1Q46 A;  2WB1 G;  2LSS A;  2D62 A;  2NVY H;  4LUZ A;  5FJ8 G;  3U50 C;  4QQB X;  3PO3 H;  1J5E L;  3HFZ B;  3HKZ G;  5IP7 H;  4A3F G;  1S72 A;  1XMO L;  1PH5 A;  2CCZ A;  1K0R A;  4LF9 Q;  2F4V Q;  2VL6 A;  3TRZ A;  4DR2 L;  4LF5 Q;  3JAM i;  4OX9 L;  3NEM A;  4GLA C;  4JBW A;  4AQY L;  1VQN A;  4BXX G;  1QZG A;  3CD6 A;  2MNA A;  2OWO A;  4LUO A;  2JA8 G;  3CMA A;  1HNX Q;  3UE0 A;  5IT9 c;  2QNC A;  1LM0 A;  3U4V A;  1E1T A;  2E2J H;  4IPG A;  4X65 Q;  1EQR A;  1SRO A;  1VS0 A;  5K36 G;  2Q2T A;  5DLQ E;  2JEB I;  4DUY Q;  2H5X A;  1PH6 A;  1JMC A;  2KCM A;  3VDY A;  4OXP A;  4X64 L;  4IJH A;  2I5M X;  3GTM H;  5C0X J;  4JCV E;  2R93 H;  3HKS A;  3L2P A;  3CCS A;  4JI7 Q;  3RZD H;  1BVS A;  4YHH L;  3GD7 A;  2F52 A;  3PIO A;  1XMQ Q;  1BBU A;  3E9I A;  4IFD I;  1HNW L;  2V1C C;  3HOU G;  1UE1 A;  4KHP L;  3FKI G;  5LMN L;  3CPF A;  5C4X G;  2JJQ A;  4L5S A;  1D7Q A;  4LF4 L;  1PFS A;  2K14 A;  2R6G A;  4JI3 L;  1S3O A;  2NN6 G;  1LYL A;  5FLM H;  1M1K C;  4B3T Q;  3UE1 A;  3H0G H;  3I4N H;  3GTK H;  2VQE L;  4LFC L;  1NMF A;  4DV4 L;  3RN2 A;  2JA6 G;  1VQ7 A;  4TQU S;  2HHH L;  5BR8 Q;  3CCR A;  3M4P A;  3HOZ H;  3EN2 A;  4LF8 Q;  2MO1 A;  2KEN A;  3KDF A;  1YBY A;  4JYA L;  4MTN A;  1ASY A;  4IFD J;  1Q12 A;  2K5V A;  1PH2 A;  4ALP A;  1KRS A;  4R4C A;  3UDG A;  1X3E A;  1KC8 C;  2OTL A;  2E5L L;  1XNQ Q;  4X62 L;  4JI2 L;  1XNR Q;  2A19 A;  4JI1 Q;  1BBW A;  4A3C G;  3G4S A;  1NE3 A;  2WAQ G;  5M3F H;  1K73 C;  1I94 L;  4IO9 A;  1CKO A;  1UEB A;  1L1O A;  1QVG A;  3S1M H;  3PCO B;  1IYJ B;  4XIG S;  1N9W A;  3AFP A;  1MKH A;  4P75 A;  1GKH A;  4POF A;  1Y1W H;  1PH7 A;  1PH8 A;  1YEZ A;  1YHA A;  2CQO A;  2Z0S A;  3JC6 6;  3OTO L;  4HIK A;  2E2I H;  4JBJ A;  2MO0 A;  4H02 A;  1WJJ A;  4O2D A;  4DV2 Q;  3S16 H;  2OTJ A;  2HQL A;  1IBM L;  1SMX A;  1QUQ A;  1N34 Q;  4HIM A;  1WI5 A;  4GN4 B;  1EWI A;  4R4O A;  1YVC A;  5C0X G;  1NJI C;  3HOY H;  2NZH A;  4X66 L;  4A3B H;  4B3S Q;  1KHI A;  3CP0 A;  3NEL A;  2N3S A;  1YJ9 A;  5IYC G;  2K52 A;  2R7D A;  3STB C;  3ERS X;  4HJA A;  4MNO A;  3S2D H;  4DV6 Q;  5IYB H;  1Q1B A;  4A3I G;  2WB1 E;  1Z47 A;  1KL9 A;  2Y0S G;  2K50 A;  1HZ9 A;  4JOI A;  3PUV A;  3PSI A;  4UP9 A;  2AWO A;  3ULJ A;  4DR3 L;  4LFA L;  2JA9 A;  1VQJ A;  3HKZ E;  2ZJR A;  4BY1 H;  2N49 A;  3AQQ A;  1A8V A;  1MJC A;  4JOI C;  1P8L A;  2ZJQ A;  3I4M G;  2Q2I A;  2RF4 A;  1SN8 A;  1S40 A;  3HOX G;  2QEX A;  5GAG C;  1PYB A;  3UDI A;  5E7N A;  1RIP A;  3TEH B;  5M5W H;  5IP7 G;  3T1H L;  4A76 A;  2L15 A;  2JA7 G;  2IX0 A;  2YYZ A;  4DV0 L;  3OYY A;  2YTX A;  4R4Q A;  1YJW A;  2DUD A;  1N32 L;  1KD1 C;  4JI0 Q;  1VQM A;  1AH9 A;  2D0P A;  4L5Q A;  1XTD A;  2DGY A;  2GVB A;  4B3M Q;  1LTL A;  4P74 A;  4Y52 H;  5AJ3 Q;  1HR0 L;  1YHQ A;  2UXD Q;  5M5X H;  3PUZ A;  1R9T H;  1KAW A;  2A8V A;  2Q2U A;  4DV1 L;  2PQA A;  1G29 1;  3CCU A;  1IL2 A;  4LF6 Q;  2IX1 A;  3SGI A;  3F2D A;  1KXL A;  4GKK L;  3GTL H;  3A0J A;  2UU9 L;  1HNZ Q;  5GAE C;  2D0O A;  3OW2 A;  1H95 A;  2PMZ E;  2R93 G;  2XGT A;  3KJP A;  1UE5 A;  4DR5 Q;  5GAH C;  5C44 G;  1V43 A;  2I5H A;  3I7F A;  3KOJ A;  3PUX A;  3A74 A;  2VQF L;  4HJ9 A;  4DK6 C;  5IYD H;  1OXS C;  1TXY A;  1J5E Q;  2E5L Q;  3H3V H;  1QZH A;  5H1S E;  1OXX K;  3CPW A;  4DV7 L;  4B3R Q;  1HJP A;  2YV5 A;  4OX9 Q;  2VY3 A;  1I50 H;  1X54 A;  3J7Z C;  4JV5 L;  2I5L X;  5M3M H;  2ZM6 L;  4DAM A;  1YIT A;  3H0G G;  4JI8 L;  4A3K G;  4JBK A;  2UXB Q;  4FDB A;  1IXR A;  2Z6K A;  4YCV A;  4DV3 L;  1N36 L;  1CKM A;  1VQB A;  4BBS H;  1EUJ A;  4LWC A;  4K0K Q;  1N33 L;  3L0O A;  3W1G A;  3AYH B;  4JI4 Q;  4BY7 H;  3CCL A;  2WAQ E;  3S1N H;  5JJL A;  1IBL L;  2ALY B;  2NZO A;  5LMU L;  4O0A A;  1X9N A;  3GDE A;  4UPA A;  2PI2 E;  4A3L H;  1B7Y B;  2QGQ A;  4JI6 L;  2PQA B;  1Q81 C;  5ELN A;  1VQD A;  4HJ8 A;  4GNX B;  2IY5 B;  1VQ4 A;  4LF9 L;  1A63 A;  3H3V I;  1C9O A;  1VQF A;  2F4V L;  2VUM G;  2UUA Q;  1HNW Q;  4P72 A;  1WFQ A;  4KHP Q;  1OTC A;  1VQK A;  2E8G A;  1Y1V H;  3T1Y Q;  3G6E A;  1N8R C;  1Y1W G;  4LF4 Q;  4OO1 G;  4C3J H;  4RG1 A;  4LFB Q;  1HNX L;  5C3E H;  4UP7 A;  1SFO H;  2LXJ A;  4A3M G;  3J7A 5;  4A3D H;  1X56 A;  4DUZ L;  3ULL A;  4X65 L;  4DV4 Q;  4A3E H;  1DGS A;  3HOY G;  1U5K A;  2Y0S E;  1GM5 A;  1VQ5 A;  1WCM G;  4DUY L;  4EQ5 A;  3BJU A;  2K75 A;  2OCE A;  1TWH H;  2NVX H;  1Q82 C;  2JEA I;  3B6Y A;  3PGZ A;  2BA0 A;  3UDF A;  1NTG A;  1OXV A;  1OXT A;  1TWF H;  5IYB G;  1CSP A;  4LF7 Q;  4R1J A;  4PZ7 A;  4APV A;  2JQO A;  2VZA A;  3ULP A;  4TVA B;  1XMQ L;  4GS3 A;  1J6Q A;  4YWL A;  4DNI A;  3E9H A;  2NVQ H;  5IWA Q;  3KLW A;  1PVO A;  1SR3 A;  4BY1 G;  1IBK L;  1JJC B;  4A93 H;  4KHZ A;  2UXC Q;  3NBH B;  1AE3 A;  5JJK A;  2Q2H A;  1EFW A;  3S17 H;  4B3T L;  4PMW A;  3PV0 A;  3W1B A;  3CCQ A;  4WJ3 M;  4X6A H;  4DAY B;  1E7Z A;  4MZ9 A;  2JA8 H;  1L1O C;  1IBM Q;  5IP9 H;  1U0L A;  2R7Z G;  5BR8 L;  4QY7 A;  4JG2 A;  4WJ4 A;  2AMC B;  3FP9 A;  3UDX A;  3J81 c;  2UUC Q;  2YTY A;  2KCT A;  4LF8 L;  1YI2 A;  1I6H H;  1I5F A;  1GD7 A;  3KYH C;  4A3J H;  1HR0 W;  5JJI A;  3CME A;  4DPG A;  1SE8 A;  1XNQ L;  2RHS B;  1XNR L;  3PUY A;  2JA5 G;  2EXD A;  3CC4 A;  4YCU A;  3GTP H;  1L0W A;  3J81 i;  4BBR G;  2KHI A;  1EQQ A;  1EN7 A;  3KFU A;  3FKI H;  3L7Z C;  2PI2 A;  4GN3 B;  4DR7 Q;  3PF5 A; 
#chains in the Genus database with same CATH topology
 3J80 c;  2ATW A;  2XN9 C;  1Y8P B;  4CDE C;  4A3M B;  2X6L A;  1X55 A;  5CV8 A;  3DWA A;  1E7D A;  2KBN A;  5CV9 A;  3M7N A;  2AHO B;  3OWF A;  3S1Q B;  1CKN B;  3U9O A;  1HUN A;  2SEB D;  4NB3 A;  1A0I A;  4NXM Q;  2JE6 I;  2UUB Q;  2MP1 A;  1YNN C;  1FGB D;  1JCK B;  2IHE A;  4DK0 A;  2PYK A;  1II3 A;  2K5D A;  1B3A A;  5COR A;  3DM3 A;  5HY6 A;  4BA1 I;  1F2L A;  2B63 H;  1FJG Q;  3K57 A;  4GNX A;  4JK1 C;  4R4I A;  1CQV A;  3EBE A;  3KUP A;  2KVE A;  4POG A;  4GNX C;  1G51 A;  2R7Z B;  5C0X H;  4LNQ A;  1LAC A;  2MHV A;  3DEO A;  3T4A C;  2EDG A;  3SR1 A;  5JPN C;  4L6T B;  4FXG C;  1C7Y A;  1TWG B;  1LUZ A;  4LF6 L;  2Y0S B;  1EYG A;  4DV5 L;  1PH9 A;  2Z6K C;  1NR2 A;  3GTO H;  5EGT A;  2K6A A;  2KCN A;  1F2M A;  3PQI A;  3NTI A;  4RMF A;  3PO2 B;  4XT3 B;  1EFI D;  1GHJ A;  1YJN A;  4B3R L;  3NTK A;  4A93 G;  1BDO A;  3TP6 A;  1CI3 M;  4YHH Q;  3U58 A;  2CKZ B;  2XSC A;  1MHW C;  4ILW A;  3I3C A;  5LMN Q;  1HFN A;  1E7L A;  1CSQ A;  1H9J A;  1T9H A;  2OXP A;  4ABN A;  2R92 H;  1WTP A;  3P7J A;  1TS4 A;  5IP9 G;  1LTR D;  3QOJ A;  2VS1 A;  2XRS D;  1G6P A;  4JI4 L;  1PTO D;  3GO5 A;  1YIJ A;  4IUP A;  1CHP D;  2G9D A;  2E2J B;  1T5E A;  3ZJY C;  3NPP A;  2BH8 A;  2HD3 A;  1ENA A;  1KQS A;  3M4O H;  4R4T A;  4BWG B;  2ODC I;  3M85 A;  4BA2 I;  5M5Y H;  2A74 C;  2F0U A;  1PRT D;  2L1B A;  3K8A A;  1KHC A;  1J8I A;  4ME3 A;  4YWM A;  1K8G A;  2E5L Q;  5FJ8 H;  2YTV A;  3RMH A;  3NEN A;  4GN5 A;  3CCJ A;  3KF8 A;  1SFO B;  3FVQ A;  3U9S A;  1GVP A;  4L5T A;  3H0G B;  1VCI A;  1Q8I A;  1NBW A;  1VQA A;  4RAU C;  5BN5 A;  3HOW G;  1JR0 D;  3EIV A;  2VNU D;  1T5X D;  4KD4 A;  3K80 C;  1VF5 C;  1TWH B;  1Y14 B;  1WVL A;  4LF7 L;  1JOK A;  3G48 A;  2B2T A;  4YCW A;  3K81 C;  1WTV A;  1RKN A;  4JVZ A;  3MHB A;  2B2T C;  2FHT A;  4JI1 L;  4CDD C;  4NKL A;  4OWT B;  3PUW A;  4CJ2 C;  4C3I G;  1VQ9 A;  3S1M B;  2NTT A;  2LC3 A;  1Y1W B;  4A3M H;  2E2I B;  3RZO H;  2I0Q A;  5D3D A;  2ID0 A;  1AZP A;  1X6O A;  3S1Q H;  5IYD G;  3R2I A;  4BIT A;  2SNM A;  3MWY W;  4AH6 A;  1NNX A;  1QCB D;  4IOC A;  2EY6 A;  4CJ1 B;  2F0P A;  1VQP A;  4UP8 A;  4NPS A;  3U4Z A;  3KDF B;  1ESF A;  3T51 B;  4CJ0 B;  4A3G G;  3S2D B;  2F0I A;  4UHV A;  4J8Q A;  2GN5 A;  1SAP A;  4BY7 G;  4A4I A;  4GOP A;  2BE5 D;  1BCP F;  5BN3 A;  5EJW A;  1VQH A;  1NCV A;  2UU9 Q;  4C1N K;  4GOP C;  3TS0 A;  2KVM A;  3MFG A;  1JOR A;  2K5N A;  2R7Z H;  2D2C C;  5J3B A;  2VQF Q;  1BUV T;  3KJO A;  1W3S A;  1VQ6 A;  5BN4 A;  1CFM A;  2CWA A;  4EX5 A;  2AQ2 B;  3TDQ A;  1TWG H;  2RBM A;  5KIX A;  1Q86 C;  1HZC A;  4K2L A;  2N78 A;  3H09 A;  2RNN A;  2D9U A;  3I55 A;  3GTL B;  4P73 A;  4DNT B;  2HCI A;  1IBL Q;  4DR6 L;  3F1Z A;  3TQY A;  3PO2 H;  1VMC A;  4RGT A;  2FIN B;  1Q46 A;  1QNU A;  2LSS A;  2NVY H;  2WB1 G;  4ZYS A;  1J5E L;  2CCZ A;  4IFD H;  3KBX A;  2VL6 A;  3TRZ A;  4LF5 Q;  4OX9 L;  3E0J A;  4AQY L;  1VQN A;  4C3H G;  1M4V A;  5C6A A;  2IJ0 A;  2PZW A;  3PIP 3;  1HNX Q;  2QNC A;  1LM0 A;  3U4V A;  3OMC A;  3QB3 A;  2E2J H;  3QJY A;  1EQR A;  1SRO A;  1IW7 D;  3S1N B;  4CHT B;  2H5X A;  2EY5 A;  5C0X J;  2OF1 A;  1I4H A;  3HKS A;  5C5L A;  3CCS A;  4JI7 Q;  1SDF A;  4FYD A;  1HUM A;  3PIO A;  3E9I A;  1UE1 A;  1QNK A;  2JJQ A;  2K1B A;  4L5S A;  3M7G A;  3OIQ A;  4X3S A;  3R2T A;  3UE1 A;  3H0G H;  4B9X A;  2PO4 A;  4K8I A;  4OL7 A;  4LFC L;  1ZYR C;  3M4P A;  4LF8 Q;  1E0B A;  2NVX B;  1ASY A;  3SHL A;  1Q12 A;  3O13 A;  3MXU A;  4R4C A;  3UDG A;  4U67 3;  4X62 L;  1XNR Q;  1EYA A;  4IO9 A;  3S1M H;  1L1O A;  4A93 B;  1IYJ B;  1E2Z A;  3AFP A;  3DEP A;  4P75 A;  1GKH A;  1Y1W H;  2Z0S A;  2E2I H;  4JBJ A;  4DV2 Q;  3KLS X;  1EY5 A;  1N34 Q;  4RA8 A;  3JAM E;  4K8J A;  2Q8R E;  5C0X G;  2NZH A;  1YJ9 A;  1BOS A;  3I8Z A;  5IYC G;  3A8K E;  3P1H A;  3R3O A;  1JEI A;  1K0S A;  3STB C;  4DN4 M;  4HJA A;  3S2D H;  4DV6 Q;  2JYO A;  1PYW D;  5EKL A;  2A6H D;  5EBD A;  2VXW A;  3PUV A;  3ULJ A;  4LFA L;  4BY1 H;  2ZJR A;  3FKI B;  3AQQ A;  1A8V A;  1MJC A;  2ZJQ A;  1FYC A;  2PMZ B;  1SN8 A;  2QEX A;  2F0W A;  3EVQ A;  2ODG C;  3NE5 B;  5LL6 S;  1GUN A;  3T1H L;  3MXP A;  2L15 A;  3HOW B;  2YYZ A;  2PCF B;  3OYY A;  4R4Q A;  1KNE A;  1PMR A;  2DGY A;  5KNB A;  3TZD A;  1NUC A;  1PRT C;  5JPM C;  2Q2U A;  4OEM B;  3MTS A;  1STE A;  2LMC B;  2K01 A;  3NXW A;  4DV1 L;  1QE6 A;  1G29 1;  4C3I B;  1KXL A;  1BCP B;  3GTL H;  3A0J A;  1HNZ Q;  5GAE C;  2D0O A;  3OW2 A;  1H95 A;  2PMZ E;  2XGT A;  1UE5 A;  3OOC A;  4PV1 C;  1XYI A;  1X32 A;  4HJ9 A;  1PTO F;  2AQ1 B;  1C8C A;  1UUP A;  3TP8 A;  4DV7 L;  1HJP A;  2Z4H A;  1BNZ A;  2M9V A;  2VY3 A;  4TRD A;  2ZM6 L;  5CYU A;  1PFB A;  2PQE A;  1N36 L;  1N33 L;  3L0O A;  1JEQ A;  3DXJ C;  3W1G A;  5I4D A;  4FXD A;  4A3G B;  4HMJ A;  4FF3 A;  1SXT A;  2WAQ E;  3NBI A;  1TY2 A;  3S1N H;  5JJL A;  1ILQ A;  2ALY B;  5LMU L;  4O0A A;  1QG7 A;  3I4M B;  3GDE A;  4UPA A;  1W6J A;  5ELN A;  3NBH A;  1S5B D;  3M3Y B;  1LTA D;  2XRQ D;  2IY5 B;  1RDP D;  5DM7 3;  1HNW Q;  4P72 A;  2JA7 B;  1ML0 D;  1AP0 A;  4KHP Q;  1VQK A;  2E8G A;  4MTK A;  3T1Y Q;  4LF4 Q;  1VF7 A;  3NQI A;  3FDT A;  4OO1 G;  1SYB A;  4LFB Q;  1QB5 D;  4UP7 A;  3URY A;  1EL0 A;  4A3M G;  3ONA B;  1X56 A;  1L0X B;  1DGS A;  1U5K A;  4FP5 D;  5DNF A;  4L63 B;  3BJU A;  4KHV A;  2NVX H;  4OEL B;  1Q82 C;  4G4K A;  1Y8O B;  1M8A A;  1OXT A;  4R1J A;  4APV A;  1XMQ L;  1GXD C;  4YWL A;  3E9H A;  2KVU A;  5IWA Q;  2WB1 B;  4A93 H;  2Z1C A;  2UXC Q;  2J7Z A;  3S2H B;  3OHX C;  1JE4 A;  3WDN A;  1EFW A;  1CM9 A;  3PV0 A;  4WJ3 M;  4C3H B;  5IP9 H;  1TQO A;  1PLF A;  2E2D C;  2R7Z G;  5BR8 L;  4QY7 A;  5ELF A;  1ROD A;  2AMC B;  2UUC Q;  2KCT A;  1VMP A;  2F0S A;  4JW0 A;  4HTH A;  2AQ3 B;  1YNJ D;  2AUJ D;  4DPG A;  2EXD A;  2TSS A;  1L0W A;  2O5I C;  2VB3 X;  4DR7 Q;  3KFU A;  3FKI H;  4GN3 B;  1S5F D;  2NB0 A;  3GP7 A;  2B2Y A;  4O1N A;  2MFI A;  1K3R A;  4J6H A;  2HT1 A;  2B2Y C;  3PO2 G;  1LT6 D;  1SBB B;  1U4L A;  1WTR A;  1IZ6 A;  4EGV A;  3OMG A;  5C5M A;  1C4Q A;  1NY4 A;  4B3S L;  3HOW H;  1JJG A;  4DK3 C;  4DV0 Q;  2ZTC A;  4IFD G;  3VA7 A;  1N32 Q;  2FMM A;  3E3X A;  1HR0 Q;  4IJL A;  2QDB A;  5KND A;  4KK7 A;  5IE8 A;  1QVC A;  5EKK A;  3K0X A;  4PMB A;  2RDH A;  2G80 A;  1X3P A;  4C3I H;  3KF6 B;  3MXG A;  3ND8 A;  1A62 A;  3SDZ A;  2F03 A;  4DR4 Q;  1JOQ A;  1D8L A;  3AFQ A;  2WFW A;  2E2H H;  4S3S A;  2ICI A;  3VR4 A;  4FXK C;  3WOE A;  1P16 A;  4DR1 Q;  2O5J C;  1O7Y A;  1SJE D;  1EIY B;  1CZG A;  1EEF D;  4JI5 L;  1K9M C;  1LTS D;  2A5H A;  1KAB A;  5FO9 B;  5LMN W;  4Y7N H;  2BH2 A;  2L5T A;  4C2M B;  1XMO Q;  5AJ3 L;  4DR2 Q;  4KJN A;  1PHJ A;  2UXD L;  1JWM D;  5IOC A;  4DV3 Q;  1R9T B;  2EIF A;  1O7L A;  4A3G H;  5FLX c;  1ENF A;  1D5X C;  2F0J A;  3F8T A;  4L5R C;  1OXU A;  3BZD B;  1TWA H;  3I4M H;  1E24 A;  2XTI A;  4R8I A;  3PF4 A;  1VDZ A;  3J81 E;  4JI6 Q;  3M3Y H;  1BR9 A;  1TR5 A;  4XXE A;  1PTO B;  1E1O A;  1CQF A;  1E22 A;  5HUR A;  2HJQ A;  1CK1 A;  2JA7 H;  2EYO A;  3PO3 B;  1SNC A;  2DJF C;  4KV6 A;  4DAY A;  3RLN A;  1NMG A;  3GTJ H;  1Q7Y C;  4QMG A;  1H9S B;  1KRT A;  5E3F A;  1JT8 A;  2K5W A;  5COY A;  4DUZ Q;  4UY8 C;  1B4O A;  2EYP A;  2A6H C;  3J81 L;  1GUW A;  1S4Z A;  3NQT A;  5HGT A;  4JYA Q;  1Q90 A;  1YNX A;  2SDF A;  3KBG A;  1CA6 A;  4PZ8 A;  5I6Y A;  1EYD A;  4QIW E;  4JI2 Q;  3S2H H;  2IPK D;  1RL2 A;  2QW7 A;  1I94 Q;  3J80 L;  3K58 A;  4AIM A;  3CHB D;  1STH A;  2E76 C;  1B1Z A;  4C3H H;  1JJ2 A;  4IUN A;  3QO2 A;  1PFN A;  1K8M A;  1GUG A;  3OTO Q;  3I4N B;  2PW5 A;  4DA2 A;  2QA4 A;  3MXN B;  1HZA A;  5JVG 3;  2C9O A;  3D8G A;  3V2T A;  2MPM A;  2BDN A;  2C35 B;  4RGN A;  2QNF A;  4AYB B;  1PH1 A;  4X66 Q;  1SNP A;  4K5W A;  5FOB B;  3CF5 A;  1ET9 A;  2O4X A;  2ZXP A;  2ENB A;  2MJ8 A;  2ZXR A;  2ZXO A;  4KY7 A;  4Q0F A;  1FGU A;  3CCM A;  5M3F B;  1WD1 A;  1EU4 A;  3FPU B;  2Q8I B;  3T53 B;  3LGJ A;  1O80 A;  4ODG A;  5IIF A;  1MJE A;  5FO7 B;  2F3W A;  1A3V A;  5CIU A;  2EYL A;  1MD2 D;  1HFG A;  3FHW A;  1VQO A;  4IOA A;  4A3B B;  2CWP A;  2VW9 A;  4AYB E;  1WYD A;  3J80 i;  1B8A A;  4ZKB B;  1JB7 A;  1X3G A;  3GV3 A;  1O7I A;  3Q8D A;  1GUS A;  4KKT A;  4ZUJ A;  1ZYR D;  4G57 A;  2B2V A;  4OGQ C;  1IKM A;  5HGQ A;  3M4Y A;  4GZY C;  3SE0 A;  1LTG D;  2B2V C;  2MUY A;  2IW3 A;  2Z8L A;  2IX3 A;  1LLR D;  2K33 A;  3F2B A;  1JE5 A;  2A1A A;  4R9W A;  4ZK9 B;  4KLK A;  5LHY 1;  2PZT A;  2B2W A;  2KHJ A;  4NXM L;  1VQL A;  1QUQ B;  4C2M H;  2UUB L;  4FF4 A;  1XTC D;  1F9Q A;  3J81 j;  3PIP A;  1LTT D;  3A54 A;  2B2W C;  1CHQ D;  1VQG A;  5IYC H;  1IKL A;  4MHE A;  1SYD A;  4JI8 Q;  2ES2 A;  2KFV A;  5M5X B;  5DEH A;  4Z9C B;  1WTX A;  3W5O A;  2F0Q A;  4DV5 Q;  2OEO A;  1FJG L;  2G5D A;  5KNC A;  3RLF A;  3A5Z B;  1V1O A;  1PH4 A;  3I56 A;  4DR5 L;  3STB D;  2WIN B;  3A55 A;  1PV4 A;  1PTO H;  1JB3 A;  4LUZ A;  1DZ1 A;  1MSH A;  5E4W C;  3PO3 H;  3HFZ B;  5CGK A;  1YNS A;  2F0L A;  1K0R A;  3Q22 A;  4RFB A;  2QDL A;  3NEM A;  5EPL A;  1D6E C;  3CD6 A;  5FO8 B;  1YNJ C;  3MFY A;  4LUO A;  1U4M A;  3CMA A;  5D65 A;  3KLS A;  5IT9 c;  4BBS B;  2A6E C;  1KDC A;  1I4Q A;  4X65 Q;  2KVD A;  5K36 G;  2Q2T A;  1JMC A;  2RVL A;  2KCM A;  3IL8 A;  5EPJ A;  2I5M X;  1I4R A;  4JCV E;  2WQG A;  1ZEQ X;  3VR5 A;  2RQX A;  1BVS A;  1DM0 B;  4YHH L;  2F52 A;  3HOU G;  3J7A F;  3FKI G;  5LMN L;  3OWE B;  1D7Q A;  1WTO A;  2K14 A;  2Q8T A;  2NN6 G;  5FLM H;  1M1K C;  2RSO A;  3Q0A A;  5C3E B;  3I4N H;  1H9K A;  5I2Y A;  1NMF A;  5LL6 X;  3RN2 A;  3A7A B;  3CCR A;  4V0B A;  4ZUI A;  1SEB D;  1YBY A;  4MTN A;  2KHS A;  1KRS A;  1EWC A;  4EVO A;  4KTA A;  2K28 A;  1SJH D;  3N52 A;  2A19 A;  4JI1 Q;  1BBW A;  2E5L L;  4A3C G;  2DK4 A;  3G4S A;  2WAQ G;  5M3F H;  3HKZ B;  4XQN A;  1D1I A;  1QVG A;  3PCO B;  1N9W A;  5E1F A;  1QJO A;  1Y02 A;  1YEZ A;  4OO1 H;  2WKD A;  2MO0 A;  1WJJ A;  3FPP A;  2JA8 B;  1SMX A;  1WI5 A;  4R4O A;  1YVC A;  1NJI C;  2JSO A;  4A3B H;  2F0H A;  4N9T A;  3W2D A;  1S5C D;  4ZRZ A;  3BS1 A;  2K52 A;  4R8N A;  5A2Q E;  4IAL A;  4MNO A;  2IWH A;  1Z47 A;  4WJW A;  3C2P A;  4JOI A;  2K05 A;  3PSI A;  2AWO A;  1STG A;  2JA9 A;  3HKZ E;  4QUF A;  5C4X B;  3C46 A;  4JOI C;  1P8L A;  3I4M G;  2OT2 A;  1TII D;  5ELC A;  2F0T A;  1TT2 A;  4EQO A;  1S40 A;  2F0E A;  4KY5 A;  5GAG C;  3UDI A;  1RIP A;  5A2Q L;  1UNS A;  5IP7 G;  2JA7 G;  2IX0 A;  3K7A B;  1KLU D;  1QIL A;  1E2V A;  5J1Z A;  4JI0 Q;  2KA7 A;  1STY A;  1Y8N B;  1LTL A;  3RUZ A;  2E75 C;  5DAU A;  4QUC A;  1YHQ A;  2H1E A;  3PUZ A;  5CV6 A;  5M5X H;  4V19 0;  2A68 D;  3AB9 A;  1J9O A;  1JIC A;  4I7Z C;  3CCU A;  3QR8 A;  2IX1 A;  2UU9 L;  2RA4 A;  4HR7 B;  5EPK A;  1LT3 D;  5GAH C;  1V43 A;  4HMI A;  2VQF L;  2FJ2 A;  1EZ6 A;  1S5D D;  3IKJ A;  1TXY A;  1J5E Q;  3H3V H;  1LV9 A;  1OXX K;  5IGD A;  3CPW A;  1EEI D;  4OX9 Q;  3T56 B;  4JV5 L;  1F2Y A;  4DAM A;  4NW2 A;  1HTP A;  4FF1 A;  2UXB Q;  1IXR A;  4YCV A;  1CKM A;  4BBS H;  4K0K Q;  3AYH B;  1SNO A;  1XX8 A;  1EY6 A;  1ICF B;  1IBL L;  1X9N A;  3F2U A;  3NP8 A;  2KQ3 A;  2L12 A;  2PI2 E;  4A3L H;  2NBF A;  3ERO A;  3HOX B;  1VQD A;  5M9O A;  1DYQ A;  2PW7 A;  4GNX B;  4HJ8 A;  1VQ4 A;  4H0L C;  5JJZ A;  5CMD A;  3E6Z X;  1C9O A;  2UUA Q;  2Z4I A;  2JVW A;  2HQE A;  1B50 A;  1A2T A;  1V1P A;  5T1I A;  3PMF A;  2LY7 A;  1U4R A;  2RSN A;  2JXM B;  1HNX L;  5C3E H;  1SFO H;  3BG3 A;  1DOL A;  1PFM A;  1K28 A;  2DNE A;  1GM5 A;  1VQ5 A;  1SMY C;  1MGS A;  2H4O A;  4X3U A;  1TWH H;  3IFT A;  2BA0 A;  3IAY A;  2HDL A;  5C44 B;  2VZA A;  1SE3 A;  4TVA B;  4ME5 A;  2R3Z A;  4X3K A;  1PVO A;  3I90 A;  1MSG A;  4HAE A;  1IBK L;  4KN7 C;  4KHZ A;  1AE3 A;  5JJK A;  2Q2H A;  1WTQ A;  3GQB A;  4X6A H;  5NUC A;  4MZ9 A;  2JA8 H;  3D4R A;  4CKB A;  1L1O C;  1EY0 A;  2A69 C;  1U0L A;  1FNW A;  5IGB A;  3HEJ A;  2XNA C;  4K6D A;  3S15 B;  1IHZ A;  1GJX A;  4LF8 L;  2YTY A;  1I5F A;  4DGZ A;  1GD7 A;  3KYH C;  4LMQ D;  1JOO A;  1HR0 W;  3OSO A;  2RHS B;  1XNR L;  4HCE A;  2EJM A;  3H6M A;  1SYE A;  1AFP A;  1RTO A;  2KHI A;  4FVM A;  3L7Z C;  4G7Z C;  1I4P A;  3S14 B;  2F0N A;  2EY2 A;  3HOU B;  1LAB A;  4DV2 L;  3CCV A;  1B9M A;  4GKJ Q;  5CC4 A;  1N34 L;  3T13 A;  2I07 B;  2EXZ A;  4JBM A;  1R4Q B;  3TS2 A;  1B70 B;  4LW1 A;  4K5V A;  3K7A H;  3HOY B;  3PO3 G;  1E3P A;  1WCM B;  4M1U B;  3VR2 A;  4F88 A;  4YY3 Q;  2EYJ A;  4DV6 L;  3CAM A;  5D14 A;  1XPR A;  1EY8 A;  1K8A C;  3AU7 A;  1IYU A;  1CZW A;  3DM1 A;  4KMU C;  4RCN A;  2B39 A;  3I2Z A;  2MQH A;  5CV5 A;  2WAQ B;  2DY8 A;  4NXN Q;  2B29 A;  1GKU B;  1GO3 E;  3SEB A;  1MIU A;  3HRZ C;  1Q8K A;  3Q24 A;  1AZQ A;  1EOV A;  2K5H A;  2OQ0 A;  2IT1 A;  2L0C A;  1EY7 A;  1UWV A;  4DKA C;  5C4H A;  1V1Q A;  4B9W A;  3TP7 A;  1XJV A;  1H9E A;  1YHB A;  3RN5 A;  5GQO A;  5C3W A;  5CV4 A;  5FLM G;  1D2B A;  1CA5 A;  1N36 Q;  3I4N G;  1JQY D;  1PRT F;  3DUZ A;  1MBY A;  2CQA A;  5EKI A;  2JA5 B;  1F9P A;  1D5Z C;  2F4I A;  4YIJ A;  1HTL D;  1H9R A;  3HG9 A;  4QJF A;  2L9H A;  1F2Z A;  1SNM A;  1HNZ L;  4AYB G;  1WOC A;  2B3G A;  3JAM c;  1D5M C;  2F3V A;  1A2U A;  4GOP B;  5IY0 A;  5ELO A;  4LJZ C;  5CV7 A;  4X64 Q;  2QKI C;  3V96 A;  3G71 A;  3RR5 A;  5C0X I;  2BA1 A;  5M3F G;  3BDL A;  1U4P A;  1Y69 U;  4ZCK A;  3DLL A;  4XYO A;  1BQQ T;  2NTS A;  2DJG C;  4JI3 Q;  2QF7 A;  3VR3 A;  1UE6 A;  2JK8 A;  1SYG A;  2VQE Q;  2NUC A;  3SK5 A;  2J4X A;  4K6L A;  4A3B G;  1NAP A;  2HHH Q;  5DM6 3;  4CGY B;  3MEF A;  3HS0 C;  2LKV A;  5C44 H;  1SRU A;  5GRO A;  3H91 A;  2AWN A;  1HZB A;  4M8A A;  5ELE A;  3IFD A;  3RZD B;  2KOL A;  1EIF A;  3T1Y L;  2CW0 C;  4KI0 A;  1KAA A;  2DNC A;  3TSS A;  4LFB L;  1SLJ A;  2PNR C;  3CC7 A;  1CKN A;  3E0E A;  2A68 C;  3S15 H;  3A5U A;  5TSS A;  3S9W A;  1JC7 A;  4QL5 A;  5K36 H;  1I4G A;  3HOZ B;  2CH4 A;  1UE7 A;  4I65 A;  4H13 C;  3WWV A;  1LTI D;  5IWA L;  2EYH A;  5JEA J;  1YZ6 A;  2WV6 D;  2UXC L;  3G7L A;  2A6E D;  3I70 A;  2ASB A;  3S14 H;  4XQQ A;  3ND9 A;  4DR3 Q;  3HOU H;  2EJF C;  2QIL A;  2QCP X;  1PH3 A;  2NN6 H;  1PXU A;  4CDF C;  3S16 B;  1PDQ A;  4GLX A;  3VYT A;  1B44 D;  3MVV A;  2UUC L;  1WCM H;  1G91 A;  1RCV D;  2HCC A;  3OW7 A;  4YWK A;  4FNF A;  4GLV B;  2WP8 J;  2BOS A;  1EYC A;  4BS9 A;  3I4O A;  2KW9 A;  3RLO A;  1L0Y B;  4BBS G;  1ZBH A;  3FMC A;  3D6C A;  5ELD A;  3ICE A;  4DR7 L;  1UAP A;  4A3C H;  1HHV A;  4DAV A;  1EY4 A;  3BVG A;  3H15 A;  2PNH A;  4OO1 I;  2F0M A;  4GKK Q;  3EQL C;  1L1O B;  2CFM A;  4EQP A;  4A3L G;  4RWS C;  2HIV A;  3TRE A;  2RHQ B;  4IPH A;  4JI5 Q;  2CH4 W;  5D3I B;  2XIW A;  1MI2 A;  1VQ8 A;  1AE2 A;  5JEA G;  3HP3 A;  1TS5 A;  4CBV A;  4B3M L;  4HCS A;  2CVR A;  1XWE A;  3D4W A;  5C3E G;  1U9R A;  2TMP A;  4B08 A;  2JA5 H;  1G2T A;  1EWH A;  3ZYY X;  1HA6 A;  3F2C A;  2EE1 A;  2K32 A;  4DR4 L;  2HDM A;  2C5C A;  4IPD A;  4IUR A;  5C4Z A;  1M90 C;  1TS2 A;  4DR1 L;  1HA5 A;  2LFN A;  1XPU A;  1B53 A;  5IP7 H;  3HKZ G;  4A3F G;  1S72 A;  1KLG D;  1XMO L;  4LF9 Q;  4QIW B;  2F4V Q;  1BCP D;  4DR2 L;  3MA2 B;  4GLA C;  4JBW A;  2K5Q A;  4BXX G;  1QZG A;  1I50 B;  5M3M B;  1SND A;  2JA8 G;  1GJJ A;  1PRT B;  2EYF A;  3J80 E;  4IPG A;  3TME A;  2EZV A;  4DUY Q;  5A35 A;  1HPC A;  1SE4 A;  3VDY A;  4OXP A;  1STN A;  3QOL A;  2XVS A;  2LS0 1;  3RZD H;  3Q23 A;  2P5Z X;  4LAA A;  4IFD I;  2V1C C;  5C4X G;  3CPF A;  5CBE E;  1LT4 D;  1PFS A;  2R6G A;  2IL8 A;  2R92 B;  5E4X A;  4FF2 A;  4B3T Q;  1XXG A;  2M2L A;  4A3D B;  3LX0 A;  1GUO A;  4DV4 L;  4A3E B;  3SK8 A;  4K2K A;  3HOZ H;  5ISR A;  3EN2 A;  4LK1 C;  2MO1 A;  3KDF A;  4JYA L;  1PH2 A;  3K5N A;  4ALP A;  1EZ8 A;  1TWF B;  1DON A;  1KC8 C;  1SSO A;  1RJT A;  2RKS A;  1XNQ Q;  4JI2 L;  4QB4 A;  2NVQ B;  1NE3 A;  3K5M A;  2FFK B;  4J1M A;  1I94 L;  1CKO A;  5I2X A;  4XIG S;  1MKH A;  3MZ5 A;  1G2S A;  4POF A;  1PH7 A;  3S17 B;  1YHA A;  2CQO A;  3JC6 6;  4XDX A;  3OTO L;  3BYY B;  4HIK A;  3S16 H;  3EA6 A;  1IL8 A;  1AH9 A;  4O2D A;  2L55 A;  1IBM L;  2F0D A;  4G7H C;  4GN4 B;  4ULL A;  4X3T A;  5KGU A;  2CHB D;  4HSV A;  4X66 L;  3H94 A;  2JN4 A;  1F9S A;  1I6H B;  1ET6 A;  1EQV A;  3ERS X;  3QG1 A;  5T1G A;  4A3I G;  1KL9 A;  2K50 A;  3GTP B;  1SMY D;  1VQJ A;  2SNS A;  2N49 A;  4N8X 1;  5IT9 E;  4DK1 A;  4XQJ A;  3K59 A;  3X3N A;  1AW7 A;  1S5E D;  2Q2I A;  1SYF A;  2A73 B;  3G6J B;  3HOX G;  3RZO B;  2E74 C;  1PYB A;  1DD2 A;  5E7N A;  3QKJ A;  4A76 A;  1LTB D;  2JA6 B;  2YTX A;  3A7L A;  2DUD A;  4KJO A;  1KD1 C;  1VQM A;  2D0P A;  2JP1 A;  1XTD A;  4Y52 H;  4CKE A;  5IT9 L;  1R9T H;  1KAW A;  2A69 D;  3FRP B;  1ICW A;  1DXM A;  4LF6 Q;  3F2D A;  1SNQ A;  1ZS9 A;  2R93 G;  3HOV B;  4DR5 Q;  5C44 G;  2I5H A;  3PUX A;  2DN8 A;  3VA5 A;  2KCC A;  1QZH A;  4B3R Q;  2N88 A;  1I50 H;  1X54 A;  1I3Q B;  5I9P A;  5M3M H;  1YIT A;  4JBK A;  4JI8 L;  3ERQ A;  2Z6K A;  4LWC A;  1ENC A;  1FD7 D;  4JI4 Q;  3CCL A;  5G3L D;  4PMC A;  4NDX A;  3K6O A;  4DXF A;  1B7Y B;  2PQA B;  1Q81 C;  1BBX C;  2NVY B;  4CDC C;  1DCZ A;  1Z7T A;  3NHH A;  1A63 A;  1VQF A;  1A6X A;  2AUK A;  3CKI B;  3HGB A;  4RGO S;  5EQ0 A;  3G6E A;  1EOT A;  1TY0 A;  2F0K A;  2XWJ B;  1FNU A;  1TWC B;  4RKB A;  2F1M A;  4A3D H;  1HRJ A;  4RKL A;  3DWP A;  4CKC A;  2M00 A;  3ULL A;  4X65 L;  4A3E H;  4IUT A;  3K5O A;  2Y0S E;  3HOY G;  1WCM G;  3PGZ A;  4ZKC B;  1PZI D;  1TWF H;  2KEE A;  5IGG A;  5IGE A;  5IYB G;  4LF7 Q;  4PZ7 A;  3ULP A;  4GS3 A;  1J6Q A;  4DNI A;  2NVQ H;  3NUC A;  2PPB C;  1SR3 A;  3GTG B;  4A3F B;  1ZXT A;  3LLR A;  3S17 H;  3W1B A;  3CCQ A;  4DAY B;  4A3K B;  1EY9 A;  2R61 A;  4N8F A;  1B9N A;  5K5P A;  4HSP A;  3FP9 A;  3I72 A;  3UDX A;  1TS3 A;  1I6H H;  3KK7 A;  1YI2 A;  4EQN A;  5JJI A;  3KLR A;  3CME A;  1SE8 A;  3PUY A;  2JA5 G;  2MGS A;  3GTP H;  2VUM B;  1EN7 A;  1Z6H A;  1BCP C;  4P2C B;  3D0F A;  4PQX A;  2R7F A;  1QVF A;  1ESR A;  1Z9F A;  3M9B A;  2JA6 H;  1AEX A;  2CW0 D;  3RD4 A;  4PZ6 A;  3V05 A;  2ICE C;  4NP5 A;  2YU9 B;  1W6K A;  3ITP A;  1ONL A;  3I73 A;  4XTC S;  4ID6 A;  1CTM A;  1EQT A;  4WRD A;  4L8J A;  4OHJ A;  2D5D A;  1LO5 D;  3A56 A;  5L37 A;  5C4J B;  4BY1 B;  1HQR D;  1CUK A;  1RF2 D;  3MAQ A;  2FMC A;  3BVZ A;  2NN6 I;  3HOV H;  3DHQ A;  1H9M A;  4DR6 Q;  1V9P A;  4A75 A;  3OIP A;  1UEA B;  3AEV A;  1Q3L A;  3CQZ B;  3GTQ B;  3S1R B;  3BZK A;  1Y1V G;  4JI0 L;  2EJG C;  4NMZ A;  1JWS D;  1I3Q H;  1SYC A;  1NSN S;  4C3J G;  5EAY A;  4JV5 Q;  3D3R A;  4AQY Q;  2J0T D;  1NR4 A;  1XPO A;  1QOH A;  4HED A;  4U68 A;  3L3O C;  2FXQ A;  4A3I B;  4BBR B;  3T16 A;  4QCL A;  3HOZ G;  2AKW B;  2EOT A;  2EQS A;  1K83 B;  2NVT B;  1KDA A;  3S24 A;  3D31 A;  1E2W A;  1ASZ A;  3RNU A;  4I7A A;  4LF5 L;  4IUQ A;  5JEA H;  2UXB L;  1TWC H;  2ZJP A;  4DNR B;  4K0K L;  1EU3 A;  2IHF A;  4HID A;  4OWX B;  4HJ7 A;  2VB2 X;  2Z6B A;  5EBC A;  1HH2 P;  3A8I E;  4LFC Q;  5CBA E;  5IOD A;  5JVH 3;  1PZJ D;  1TVX A;  1EIH A;  3SVM A;  4A3J G;  1V8Q A;  1BF4 A;  1KIX A;  1GOZ A;  4IQZ A;  1Q1E A;  3GTM B;  1HQM C;  2R93 B;  1IYV A;  4JI7 L;  1L2F A;  1KDB A;  2UUA L;  1BKB A;  1PA6 A;  3K0Y A;  4FO2 A;  3BZC A;  4O42 A;  4X62 Q;  3GTG H;  3SK6 A;  3TZU A;  1IBK Q;  4Q5V A;  4A3F H;  2WAC A;  2Z9H A;  4P71 A;  1VQE A;  1I4X A;  1GHK A;  3C1F A;  2K7V A;  4A3K H;  4BXX H;  2RCN A;  4IPC A;  3GTK B;  4OON A;  4HJ5 A;  3CRK C;  3CCE A;  5FKA C;  3CC2 A;  4E6I A;  2F0G A;  3OPO A;  4G7O C;  2GVA A;  1STB A;  1BXT A;  3TN2 A;  2ZTE A;  4H7B A;  2LXK A;  2G9H D;  3NTH A;  4IZ8 A;  3DMU A;  4OWW B;  3KF6 A;  2VUM H;  2WII B;  4HIO A;  2B63 G;  3GV6 A;  5KYI A;  4KY6 A;  4LFA Q;  2MPH A;  5C4X H;  2ZTD A;  4PG3 A;  4DFA A;  5J22 A;  4DF7 A;  4RCO A;  5GAD C;  2HIX A;  4TKO B;  3I91 A;  1HXY D;  3VYS A;  4K5X A;  3KF8 B;  4DXG A;  3T1H Q;  3D6W A;  2YU9 H;  3BU2 A;  2RNO A;  1PYS B;  2F3I A;  3BDO A;  1W2B A;  5M3M G;  1VQC A;  1C0A A;  1A3U A;  1X3F A;  4RH6 A;  5C4J H;  5I9O A;  1C48 A;  1D1K A;  2B8G A;  1F77 A;  3JAM L;  3CW2 C;  1RTN A;  3K7U C;  1OO9 B;  1X3Q A;  4DV1 Q;  4TSS A;  1V66 A;  4GKJ L;  2LD7 A;  3I4L A;  2N8N A;  1LT5 D;  3Q6S A;  3IRB A;  4KN4 C;  3MC0 B;  4JC0 A;  3CQZ H;  1FVI A;  2OQK A;  2O2L D;  4OIJ A;  1PTO C;  3GTQ H;  3S1R H;  5M5W B;  5G3L F;  1FL0 A;  1H9S A;  1WD0 A;  1X65 A;  4YY3 L;  4MN3 A;  4DV7 Q;  2R92 G;  2K4K A;  3CXC A;  5F2D A;  1K3B C;  2ZM6 Q;  2DY7 A;  2QEJ C;  3ER0 A;  3N6R A;  4A3D G;  3BVM A;  2EYM A;  4UZW A;  3M4Q A;  1VQI A;  4RGM A;  4A3E G;  4A3I H;  4BBR H;  4JPB W;  1N33 Q;  2X69 A;  1SE2 A;  4NXN L;  4QGU A;  3D4D A;  5AFW A;  4IUU A;  4J15 A;  4F8M A;  1K83 H;  4N9P A;  4LUV A;  2NVT H;  5LMU Q;  2E2H B;  3VYU A;  3HOX H;  1F9R A;  2D62 A;  5FJ8 G;  4UDU C;  3U50 C;  4KKS A;  1WTW A;  4QQB X;  4KKU A;  1WTH A;  1PH5 A;  4Y7N B;  3R8B A;  3JAM i;  3CU7 A;  1I6V C;  4UAI A;  3MXN A;  1RD9 D;  2MNA A;  4C1N I;  1FR3 A;  1HCZ A;  4ZQ3 A;  2OWO A;  3UE0 A;  2F0F A;  5IGF A;  1E1T A;  2B8F A;  1H9F A;  5J39 A;  1VS0 A;  4BY7 B;  5DLQ E;  1TWA B;  2X6G A;  2JEB I;  1PH6 A;  1PZK D;  1YNN D;  4X64 L;  4IJH A;  2NZ1 D;  1JWU D;  3GTM H;  2R93 H;  4RHS A;  3L2P A;  2BCO A;  3GD7 A;  2L4N A;  1XMQ Q;  1BBU A;  1HNW L;  2L11 A;  1ZKO A;  4KHP L;  3GTJ B;  1EIG A;  1Y1V B;  3TP5 A;  4LF4 L;  3NWS A;  4JI3 L;  1DOM A;  1S3O A;  3W3A A;  1LYL A;  4C3J B;  3GTK H;  4QF4 A;  2ZT9 C;  3NK9 A;  2VQE L;  2NYZ D;  2W51 A;  2RDG A;  2JA6 G;  1VQ7 A;  4TQU S;  4DU9 A;  2HHH L;  5BR8 Q;  4F7X A;  2BE5 C;  1A15 A;  1B3Q A;  2KEN A;  4IFD J;  2HUG A;  2K5V A;  2WKC A;  4XYQ A;  2OTL A;  1X3E A;  1K8O A;  5JAV A;  1K73 C;  4WOR A;  1UEB A;  4C56 C;  3WOF A;  3PIO 3;  1PH8 A;  3HOV G;  5FLX E;  1V1P B;  4H02 A;  2HQL A;  3SK4 A;  1QUQ A;  2EPB A;  2F0V A;  4HIM A;  4KD3 A;  1EWI A;  3A8J E;  3HOY H;  3FEW X;  2KEC A;  4B3S Q;  1KHI A;  3CP0 A;  3NSW A;  3NEL A;  2N3S A;  3HZX A;  4H44 C;  2N55 A;  4A3J B;  3C1E A;  3EJI A;  2R7D A;  2K03 A;  1AN8 A;  5KRU A;  3BYT B;  3L9A X;  2KJX A;  1STA A;  5IYB H;  1Q1B A;  4OIK A;  2GA4 B;  2WB1 E;  2Y0S G;  1QWY A;  1HZ9 A;  5FLX L;  2OTJ A;  4UP9 A;  2F0O A;  4DR3 L;  2RF4 A;  3EFX D;  2K04 A;  3BDC A;  1B2T A;  3C3L A;  3LNN A;  5ELB A;  5JOB A;  3TEH B;  5M5W H;  3J7Y W;  5C3X A;  5FK9 C;  4DV0 L;  1IW7 C;  3H3V C;  1YJW A;  3NWT A;  1N32 L;  3J7A V;  3LWU A;  1TKW B;  4L5Q A;  2GVB A;  4B3M Q;  4P74 A;  5AJ3 Q;  2RCF A;  1HR0 L;  2UXD Q;  1BO0 A;  2A8V A;  1CT1 D;  1DJR D;  1A3T A;  3K5L A;  3MEH A;  1KTK A;  2PQA A;  2PZU A;  1IL2 A;  1ILP A;  3SGI A;  2B63 B;  4GKK L;  1FNV A;  3QIA A;  3KJP A;  1H1J S;  4WFN 3;  3X3M A;  1O78 A;  3KOJ A;  3I7F A;  3A74 A;  4DK6 C;  5IYD H;  4IUV A;  1OXS C;  1GUT A;  1DOK A;  5H1S E;  2EY1 A;  2YV5 A;  3UI2 A;  3J7Z C;  2I5L X;  4F87 A;  3FLG A;  2SOB A;  3H0G G;  3LWE A;  4A3K G;  2B2U A;  5KEE A;  4FDB A;  4DV3 L;  3DWQ A;  1VQB A;  1EUJ A;  1KNA A;  3TBI B;  2BDO A;  2B2U C;  4BY7 H;  3SXH A;  4PNY A;  3P75 A;  3GTO B;  2NZO A;  2NWG A;  4ZAI A;  4IN3 A;  2QGQ A;  4JI6 L;  4LF9 L;  3H3V I;  3R93 A;  2F4V L;  2VUM G;  1WFQ A;  3QWN A;  1OTC A;  1Y1V H;  1N8R C;  5CR3 A;  1Y1W G;  1GL9 B;  4ZLT F;  4C3J H;  4RG1 A;  1G8Z D;  1RHP A;  2LXJ A;  3J7A 5;  4DUZ L;  4DAP A;  2I46 A;  4DV4 Q;  4DUY L;  4XT1 B;  4EQ5 A;  2K75 A;  2KED A;  2OCE A;  2JEA I;  3VR6 A;  3B6Y A;  3M4O B;  3UDF A;  1NTG A;  3AMU A;  1OXV A;  1CSP A;  5M5Y B;  2JQO A;  5IGC A;  3KLW A;  4BY1 G;  1JJC B;  3NBH B;  1JJR A;  3VYR A;  4PMW A;  4B3T L;  2RDF A;  4K14 A;  1E7Z A;  1G6Z A;  1IBM Q;  3P20 A;  4HN7 A;  4JG2 A;  4WJ4 A;  3J81 c;  5I6W A;  4A3J H;  1TU2 B;  2XWB B;  2V4D A;  4MIU A;  1XNQ L;  3CRL C;  3CC4 A;  5KYL A;  4YCU A;  2EVB A;  3J81 i;  1O7Z A;  4BBR G;  1EQQ A;  2KUM A;  3E5S A;  2PI2 A;  1R4P B;  3PF5 A;  4RHR A; 
#chains in the Genus database with same CATH homology
 2MFI A;  1K3R A;  3J80 c;  2ATW A;  4DV2 L;  3D0F A;  3CCV A;  2R7F A;  2HT1 A;  4GKJ Q;  3PO2 G;  1QVF A;  1N34 L;  1Z9F A;  3M9B A;  4JBM A;  1IZ6 A;  3TS2 A;  1B70 B;  1X55 A;  4LW1 A;  1E7D A;  1NY4 A;  2KBN A;  3K7A H;  4B3S L;  2AHO B;  2JA6 H;  3HOW H;  3PO3 G;  1CKN B;  4DK3 C;  1E3P A;  4DV0 Q;  1JJG A;  2ZTC A;  4IFD G;  4PZ6 A;  4NB3 A;  1A0I A;  4NXM Q;  1N32 Q;  2JE6 I;  2UUB Q;  4YY3 Q;  4DV6 L;  3CAM A;  4XTC S;  1XPR A;  2IHE A;  1HR0 Q;  4IJL A;  1K8A C;  5IE8 A;  1QVC A;  3K0X A;  3I2Z A;  2MQH A;  2G80 A;  4C3I H;  3DM3 A;  5HY6 A;  4BA1 I;  3KF6 B;  2B63 H;  1CUK A;  4NXN Q;  4DR4 Q;  1A62 A;  2B29 A;  1GKU B;  1GO3 E;  2NN6 I;  4GNX A;  1FJG Q;  3HOV H;  4R4I A;  1MIU A;  1D8L A;  3AFQ A;  2WFW A;  2E2H H;  1Q8K A;  3EBE A;  1V9P A;  4DR1 Q;  4DR6 Q;  1P16 A;  4A75 A;  2UUB L;  1EIY B;  4POG A;  4GNX C;  1EOV A;  2K5H A;  2OQ0 A;  3AEV A;  2IT1 A;  1G51 A;  4JI5 L;  1K9M C;  1UWV A;  4DKA C;  1V1Q A;  4LNQ A;  3BZK A;  1Y1V G;  5LMN W;  4JI0 L;  4Y7N H;  2BH2 A;  1XJV A;  1XMO Q;  1I3Q H;  1H9E A;  5EAY A;  5AJ3 L;  1YHB A;  4DR2 Q;  5GQO A;  3RN5 A;  4JV5 Q;  1PHJ A;  4AQY Q;  2UXD L;  5FLM G;  1XPO A;  4DV3 Q;  1N36 Q;  2EIF A;  3I4N G;  4A3G H;  1C7Y A;  5FLX c;  2FXQ A;  1LUZ A;  3F8T A;  4LF6 L;  4QJF A;  4DV5 L;  1PH9 A;  2Z6K C;  1OXU A;  1EYG A;  1HNZ L;  4AYB G;  1WOC A;  4L5R C;  3GTO H;  2B3G A;  3JAM c;  3HOZ G;  1TWA H;  2AKW B;  3I4M H;  2EQS A;  1E24 A;  2XTI A;  3PF4 A;  4GOP B;  5IY0 A;  5ELO A;  4JI6 Q;  4RMF A;  3M3Y H;  4X64 Q;  3S24 A;  3G71 A;  3RR5 A;  3D31 A;  1E1O A;  1ASZ A;  1YJN A;  1E22 A;  5C0X I;  2HJQ A;  2JA7 H;  4B3R L;  4A93 G;  2BA1 A;  4YHH Q;  5M3F G;  3RNU A;  3U58 A;  2CKZ B;  3RLN A;  4LF5 L;  3DLL A;  1NMG A;  3GTJ H;  5LMN Q;  1Q7Y C;  1E7L A;  1CSQ A;  1T9H A;  2R92 H;  2UXB L;  1TWC H;  1KRT A;  2ZJP A;  4JI3 Q;  4K0K L;  2IHF A;  5IP9 G;  1UE6 A;  4HID A;  1JT8 A;  4OWX B;  2JK8 A;  2VS1 A;  4HJ7 A;  4DUZ Q;  4UY8 C;  4JI4 L;  1G6P A;  3GO5 A;  1YIJ A;  2VQE Q;  1HH2 P;  4LFC Q;  3ZJY C;  4A3B G;  4A3J G;  2BH8 A;  2HHH Q;  1KQS A;  3M4O H;  1KIX A;  3MEF A;  4R4T A;  2ODC I;  3M85 A;  4BA2 I;  5M5Y H;  5C44 H;  1Q1E A;  1SRU A;  5GRO A;  3K8A A;  1YNX A;  2AWN A;  4JYA Q;  1HZB A;  4JI7 L;  1L2F A;  4ME3 A;  4YWM A;  2UUA L;  4PZ8 A;  1K8G A;  1BKB A;  1PA6 A;  3GTG H;  3BZC A;  4QIW E;  1EIF A;  4JI2 Q;  5FJ8 H;  4X62 Q;  2YTV A;  3T1Y L;  1IBK Q;  1RL2 A;  3S2H H;  4A3F H;  4KI0 A;  4P71 A;  3NEN A;  4GN5 A;  1VQE A;  3CCJ A;  1I94 Q;  4LFB L;  4AIM A;  4A3K H;  4C3H H;  4BXX H;  1JJ2 A;  1SLJ A;  2RCN A;  4IPC A;  3CC7 A;  1GVP A;  4L5T A;  3OTO Q;  1CKN A;  1VCI A;  4OON A;  4HJ5 A;  1NBW A;  1VQA A;  3E0E A;  2QA4 A;  3MXN B;  1HZA A;  3HOW G;  3EIV A;  3CCE A;  3S15 H;  3A5U A;  2VNU D;  3K80 C;  2C35 B;  3CC2 A;  2QNF A;  4QL5 A;  1PH1 A;  1Y14 B;  4X66 Q;  2GVA A;  1UE7 A;  3CF5 A;  3WWV A;  4YCW A;  2ZTE A;  3G48 A;  4LF7 L;  3K81 C;  2LXK A;  5IWA L;  4OWW B;  5JEA J;  3KF6 A;  1YZ6 A;  4JI1 L;  2VUM H;  4HIO A;  2UXC L;  4OWT B;  3PUW A;  2ASB A;  2B63 G;  1FGU A;  1VQ9 A;  3CCM A;  3S14 H;  4LFA Q;  3HOU H;  2MPH A;  5C4X H;  2ZTD A;  4DR3 Q;  3LGJ A;  4PG3 A;  2LC3 A;  1PH3 A;  4A3M H;  5GAD C;  1MJE A;  3RZO H;  2HIX A;  2I0Q A;  2ID0 A;  4GLX A;  1X6O A;  3S1Q H;  2UUC L;  3KF8 B;  5IYD G;  1VQO A;  3FHW A;  1WCM H;  3T1H Q;  4IOA A;  4YWK A;  4AH6 A;  3BU2 A;  2CWP A;  2WP8 J;  4GLV B;  2VW9 A;  4IOC A;  2YU9 H;  1PYS B;  1WYD A;  4AYB E;  2F3I A;  3J80 i;  1B8A A;  1VQP A;  4UP8 A;  1W2B A;  5M3M G;  3I4O A;  4NPS A;  1VQC A;  3U4Z A;  1X3G A;  1JB7 A;  3RLO A;  1O7I A;  3Q8D A;  3KDF B;  1C0A A;  1X3F A;  4A3G G;  3M7N A;  4BBS G;  3ICE A;  4DR7 L;  5C4J H;  2GN5 A;  3HOV G;  4A3C H;  4BY7 G;  4A4I A;  3CW2 C;  5HGQ A;  3K7U C;  3H15 A;  4GOP A;  4DV1 Q;  2PNH A;  4OO1 I;  4GKJ L;  1VQH A;  4GKK Q;  2LD7 A;  1L1O B;  2N8N A;  2UU9 Q;  2CFM A;  3F2B A;  4GOP C;  4A3L G;  3IRB A;  1JE5 A;  2A1A A;  2HIV A;  4JC0 A;  3TS0 A;  3CQZ H;  3TRE A;  1FVI A;  2OQK A;  2K5N A;  2RHQ B;  4IPH A;  3GTQ H;  2R7Z H;  4JI5 Q;  4DR6 L;  3S1R H;  4KLK A;  5J3B A;  2VQF Q;  2KHJ A;  1FL0 A;  4NXM L;  1VQL A;  1QUQ B;  4C2M H;  3KJO A;  1VQ8 A;  1W3S A;  1AE2 A;  1X65 A;  4YY3 L;  3J81 j;  3PIP A;  5JEA G;  4DV7 Q;  1VQ6 A;  2R92 G;  2K4K A;  1VQG A;  3CXC A;  5IYC H;  4B3M L;  5C3E G;  2ZM6 Q;  3ER0 A;  2CWA A;  4JI8 Q;  4EX5 A;  2KFV A;  2ES2 A;  2JA5 H;  4A3D G;  1TWG H;  3M4Q A;  1VQI A;  4A3E G;  4A3I H;  4BBR H;  1Q86 C;  1N33 Q;  1HZC A;  3W5O A;  3F2C A;  2N78 A;  4NXN L;  4QGU A;  4DV5 Q;  4DR4 L;  1FJG L;  4IPD A;  3RLF A;  4J15 A;  1M90 C;  1K83 H;  3I55 A;  3A5Z B;  4P73 A;  1PH4 A;  4LUV A;  4DR1 L;  1IBL Q;  3F1Z A;  3TQY A;  5LMU Q;  2NVT H;  3PO2 H;  3I56 A;  1XPU A;  4DR5 L;  3STB D;  3HOX H;  1PV4 A;  1Q46 A;  2WB1 G;  2LSS A;  2D62 A;  2NVY H;  4LUZ A;  5FJ8 G;  3U50 C;  4QQB X;  3PO3 H;  1J5E L;  3HFZ B;  3HKZ G;  5IP7 H;  1YNS A;  4A3F G;  1XMO L;  1S72 A;  1PH5 A;  1K0R A;  2CCZ A;  4LF9 Q;  2VL6 A;  2F4V Q;  3TRZ A;  4DR2 L;  4LF5 Q;  3JAM i;  4OX9 L;  3NEM A;  4GLA C;  4JBW A;  4AQY L;  1VQN A;  4BXX G;  1QZG A;  3CD6 A;  2MNA A;  2OWO A;  4LUO A;  2JA8 G;  3CMA A;  1HNX Q;  1GJJ A;  3UE0 A;  5IT9 c;  2QNC A;  1LM0 A;  3U4V A;  1E1T A;  1H9F A;  2E2J H;  4IPG A;  4X65 Q;  1EQR A;  1SRO A;  1VS0 A;  5K36 G;  2Q2T A;  5DLQ E;  2JEB I;  4DUY Q;  2H5X A;  1PH6 A;  1JMC A;  2KCM A;  3VDY A;  4OXP A;  4X64 L;  4IJH A;  2I5M X;  3GTM H;  5C0X J;  4JCV E;  2R93 H;  3HKS A;  3L2P A;  3CCS A;  4JI7 Q;  3RZD H;  1BVS A;  4YHH L;  3GD7 A;  2F52 A;  3PIO A;  1XMQ Q;  1BBU A;  3E9I A;  4IFD I;  1HNW L;  2V1C C;  3HOU G;  1UE1 A;  4KHP L;  3FKI G;  5LMN L;  3CPF A;  5C4X G;  2JJQ A;  4L5S A;  1D7Q A;  4LF4 L;  1PFS A;  2K14 A;  2R6G A;  4JI3 L;  1S3O A;  2NN6 G;  1LYL A;  5FLM H;  1M1K C;  4B3T Q;  3UE1 A;  3H0G H;  3I4N H;  3GTK H;  2VQE L;  4LFC L;  1NMF A;  2W51 A;  4DV4 L;  3RN2 A;  2JA6 G;  1VQ7 A;  4TQU S;  2HHH L;  5BR8 Q;  3CCR A;  3M4P A;  3HOZ H;  3EN2 A;  4LF8 Q;  2MO1 A;  2KEN A;  3KDF A;  1YBY A;  4JYA L;  4MTN A;  1ASY A;  4IFD J;  1Q12 A;  2K5V A;  1PH2 A;  4ALP A;  1KRS A;  4R4C A;  3UDG A;  1X3E A;  1KC8 C;  2OTL A;  2E5L L;  1XNQ Q;  4X62 L;  4JI2 L;  1XNR Q;  2A19 A;  4JI1 Q;  1BBW A;  4A3C G;  2DK4 A;  3G4S A;  1NE3 A;  2WAQ G;  5M3F H;  1K73 C;  1I94 L;  4IO9 A;  1CKO A;  1UEB A;  1L1O A;  1QVG A;  3S1M H;  3PCO B;  1IYJ B;  4XIG S;  1N9W A;  3AFP A;  1MKH A;  4P75 A;  1GKH A;  1Y02 A;  4POF A;  1Y1W H;  1PH7 A;  1PH8 A;  1YEZ A;  1YHA A;  2CQO A;  2Z0S A;  3JC6 6;  3OTO L;  4HIK A;  2E2I H;  4JBJ A;  2MO0 A;  4H02 A;  1WJJ A;  4O2D A;  4DV2 Q;  3S16 H;  2OTJ A;  2HQL A;  1IBM L;  1SMX A;  1QUQ A;  1N34 Q;  4HIM A;  1WI5 A;  4GN4 B;  1EWI A;  4R4O A;  1YVC A;  5C0X G;  1NJI C;  3HOY H;  2NZH A;  4X66 L;  4A3B H;  4B3S Q;  1KHI A;  3CP0 A;  3NEL A;  2N3S A;  1YJ9 A;  5IYC G;  2K52 A;  2R7D A;  1JEI A;  3STB C;  3ERS X;  4HJA A;  4MNO A;  3S2D H;  4DV6 Q;  5IYB H;  1Q1B A;  4A3I G;  2WB1 E;  1Z47 A;  1KL9 A;  2Y0S G;  2K50 A;  1HZ9 A;  4JOI A;  3PUV A;  3PSI A;  4UP9 A;  2AWO A;  3ULJ A;  4DR3 L;  4LFA L;  2JA9 A;  1VQJ A;  3HKZ E;  2ZJR A;  4BY1 H;  2N49 A;  3AQQ A;  1A8V A;  1MJC A;  4JOI C;  1P8L A;  2ZJQ A;  3I4M G;  2Q2I A;  2RF4 A;  1SN8 A;  1S40 A;  3HOX G;  2QEX A;  5GAG C;  1PYB A;  3UDI A;  2ODG C;  5E7N A;  1RIP A;  3TEH B;  5M5W H;  5IP7 G;  3T1H L;  4A76 A;  2L15 A;  2JA7 G;  2IX0 A;  2YYZ A;  4DV0 L;  3OYY A;  2YTX A;  4R4Q A;  1YJW A;  2DUD A;  1N32 L;  1KD1 C;  4JI0 Q;  1VQM A;  1AH9 A;  2D0P A;  4L5Q A;  1XTD A;  2DGY A;  2GVB A;  4B3M Q;  1LTL A;  4P74 A;  4Y52 H;  5AJ3 Q;  1HR0 L;  1YHQ A;  2UXD Q;  5M5X H;  3PUZ A;  1R9T H;  1KAW A;  2A8V A;  2Q2U A;  4DV1 L;  2PQA A;  1G29 1;  3CCU A;  1IL2 A;  4LF6 Q;  2IX1 A;  3SGI A;  3F2D A;  1KXL A;  4GKK L;  3GTL H;  3A0J A;  2UU9 L;  1HNZ Q;  5GAE C;  2D0O A;  1ZS9 A;  3OW2 A;  1H95 A;  2PMZ E;  2R93 G;  2XGT A;  3KJP A;  1UE5 A;  4DR5 Q;  5GAH C;  5C44 G;  1V43 A;  2I5H A;  3I7F A;  3KOJ A;  3PUX A;  3A74 A;  2VQF L;  4HJ9 A;  4DK6 C;  5IYD H;  1OXS C;  1TXY A;  1J5E Q;  2E5L Q;  3H3V H;  1QZH A;  5H1S E;  1OXX K;  3CPW A;  4DV7 L;  4B3R Q;  1HJP A;  2YV5 A;  4OX9 Q;  2VY3 A;  1I50 H;  1X54 A;  3J7Z C;  4JV5 L;  2I5L X;  5M3M H;  2ZM6 L;  4DAM A;  1YIT A;  3H0G G;  4JI8 L;  4A3K G;  4JBK A;  2UXB Q;  4FDB A;  1IXR A;  2Z6K A;  4YCV A;  4DV3 L;  1N36 L;  1CKM A;  1VQB A;  4BBS H;  1EUJ A;  4LWC A;  4K0K Q;  1N33 L;  3L0O A;  3W1G A;  3AYH B;  4JI4 Q;  4BY7 H;  3CCL A;  2WAQ E;  3S1N H;  5JJL A;  1IBL L;  2ALY B;  2NZO A;  5LMU L;  4O0A A;  1X9N A;  3GDE A;  4UPA A;  2PI2 E;  4A3L H;  1B7Y B;  2QGQ A;  4JI6 L;  2PQA B;  1Q81 C;  5ELN A;  1VQD A;  4HJ8 A;  4GNX B;  2IY5 B;  1VQ4 A;  4LF9 L;  1A63 A;  3H3V I;  1C9O A;  1VQF A;  2F4V L;  2VUM G;  2UUA Q;  1HNW Q;  4P72 A;  1WFQ A;  4KHP Q;  1OTC A;  1VQK A;  2E8G A;  1Y1V H;  3T1Y Q;  3G6E A;  1N8R C;  1Y1W G;  1GL9 B;  4LF4 Q;  4OO1 G;  4C3J H;  4RG1 A;  4LFB Q;  1HNX L;  5C3E H;  4UP7 A;  1SFO H;  2LXJ A;  4A3M G;  3J7A 5;  4A3D H;  1X56 A;  4DUZ L;  3ULL A;  4X65 L;  4DV4 Q;  4A3E H;  1DGS A;  3HOY G;  1U5K A;  2Y0S E;  1GM5 A;  1VQ5 A;  1WCM G;  4DUY L;  4EQ5 A;  3BJU A;  2K75 A;  2OCE A;  1TWH H;  2NVX H;  1Q82 C;  2JEA I;  3B6Y A;  3PGZ A;  2BA0 A;  3UDF A;  1NTG A;  1OXV A;  1OXT A;  1TWF H;  5IYB G;  1CSP A;  4LF7 Q;  4R1J A;  4PZ7 A;  4APV A;  2JQO A;  2VZA A;  3ULP A;  4TVA B;  1XMQ L;  4GS3 A;  1J6Q A;  4YWL A;  4DNI A;  3E9H A;  2NVQ H;  5IWA Q;  3KLW A;  1PVO A;  1SR3 A;  4BY1 G;  1IBK L;  1JJC B;  4A93 H;  4KHZ A;  2UXC Q;  3NBH B;  1AE3 A;  5JJK A;  2Q2H A;  1EFW A;  3S17 H;  4B3T L;  4PMW A;  3PV0 A;  3W1B A;  3CCQ A;  4WJ3 M;  4X6A H;  4DAY B;  1E7Z A;  4MZ9 A;  2JA8 H;  1L1O C;  1IBM Q;  5IP9 H;  1U0L A;  2R7Z G;  5BR8 L;  4QY7 A;  4JG2 A;  4WJ4 A;  2AMC B;  3FP9 A;  3UDX A;  3J81 c;  2UUC Q;  2YTY A;  2KCT A;  4LF8 L;  1YI2 A;  1I6H H;  1I5F A;  1GD7 A;  3KYH C;  4A3J H;  1HR0 W;  5JJI A;  3CME A;  4DPG A;  1SE8 A;  1XNQ L;  2RHS B;  1XNR L;  3PUY A;  2JA5 G;  2EXD A;  3CC4 A;  4YCU A;  3GTP H;  1L0W A;  3J81 i;  4BBR G;  2KHI A;  1EQQ A;  1EN7 A;  3KFU A;  3FKI H;  3L7Z C;  2PI2 A;  4GN3 B;  4DR7 Q;  3PF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...