1ZS9A

Crystal structure of human enolase-phosphatase e1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
254
structure length
253
Chain Sequence
LSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-1 ENZYME
publication title Crystal Structure of Human E1 Enzyme and its Complex with a Substrate Analog Reveals the Mechanism of its Phosphatase/Enolase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 253
sequence length 254
ec nomenclature ec 3.1.3.77: Acireductone synthase.
pdb deposition date 2005-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.60 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1zs9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zs9A01
2P27A 3U26A 1RLTA 1ZRMA 4L57A 2HHLA 2YMLA 4HGOA 5JJBA 1L6RA 3N07A 2WHEA 4EEKA 4CNQA 3E84A 5ALMA 1U2SA 3ESQA 3M1YA 3SLRA 4BEWA 4AS3A 2ZBEA 3R09A 1TA0A 2ZBDA 4C4TA 4FYPA 3B8EA 3OPXA 3ZI4A 2HOQA 3QU2A 1ZS9A 1RRCA 3QU9A 4UMDA 2JAUA 3SF0A 4YCLA 4L6CA 2YMPA 2Q5EA 3KOOA 4Y2QA 1Z5UA 5AK6A 3ZVNA 5AW8A 4E88A 3UMCA 1RC8A 4BYGA 4HAIA 1EK1A 3FPSA 3EF1A 4MUMA 4CF3A 3EPRA 5AIBA 1VJRA 1NF2A 3OCXA 3L0YA 2CFRA 2NO5A 4F72A 5AVSA 2FPWA 3WKAA 3RFUA 5AKLA 1RKQA 3ZX4A 1RPZA 2JAOA 2I7DA 4UM5A 2VKQA 2FUEA 2D2VA 3VAYA 3FGOA 2IYEA 5AICA 1U02A 3OCWA 2W43A 4F71A 5AM0A 4B6JA 4UM7A 5AM2A 2B1RA 4Y3UA 5AM5A 2RBKA 3QUCA 1RMQA 2B0CA 3WKDA 3NRJA 3EF0A 2RB5A 1K1EA 5ALSA 2PR7A 1QQ7A 5AW4A 3P96A 1Z4LA 2C9MA 1RQNA 1ZOLA 5ALFA 1IWOA 1RMTA 4OFZA 4Y2TA 2YJ3A 1Z4KA 2HSZA 4DW8A 1XVIA 1T9ZA 5ALYA 3L8FA 5ALJA 3SMVA 5AVXA 2Q4RA 2ZG6A 3ZTWA 3QYPA 3E58A 3IB6A 3ZWDA 3U7GA 1Z4MA 3ONNA 4CF5A 3KC2A 1WVIA 3FPBA 2AH5A 1WPGA 4MWOA 3WK6A 4BX3A 3A1EA 3WK5A 4XQ0A 2YMQA 2YJ6A 3GYGA 4Y2VA 1KYTA 2W11A 3U7HB 1Q92A 4KX5A 3QNMA 2IOFK 2FPRA 3HLTA 1AQ6A 3QU4A 2P9JA 2RAVA 3WKEA 1L7OA 4NABA 5AHXA 3AR4A 4G63A 2B82A 2G08A 4KYTA 1QQ5A 4ZEWA 2WF6A 1Z4QA 1O08A 1RLMA 5AVTA 5AKZA 2GFHA 3A3YA 4HGQA 5ALRA 1N8NA 3KD3A 2G1AA 5ALQA 3ZVLA 1RLOA 3AR3A 3L1VA 1TJ5A 4OCZA 5AVYA 5AW2A 4BX0A 2JGAA 1YJ5A 2O2XA 3M9LA 2C88A 2MSNA 1X42A 2HI0A 2ZXEA 1WZCA 3DNPA 3QUTA 3KDPA 4UMFA 5IS2A 2GHTA 1J8DA 1SU4A 2G80A 4H1WA 3N8GA 3W5CA 5AW6A 4UMVA 3ZU6A 4FE3A 3OCUA 2EATA 3B9BA 3FZQA 4UU1A 5AVWA 2I55A 3WK7A 4IG4A 4DCCA 3E8MA 2P69A 1Z4NA 1RDFA 3MMZA 4OD0A 5T41A 5ALPA 2HF2A 2FUCA 3OTQA 3AR2A 1RKUA 1LTQA 1QQ6A 4UMEA 3S6JA 2HF7A 3W5DA 2FPUA 3IJ5A 2YMMA 4J03A 2NO4A 3AR7A 3AR5A 2B8EA 3NIWA 1Z4PX 2AMYA 2I34A 3ZUPA 4UASA 2DQSA 1T5SA 1J97A 2I6XA 3I28A 3PGVA 3CNHA 1ZD2P 3N28A 2W4MA 3QXGA 2B1QA 3EWIA 3K1ZA 5ALXA 5IT0A 2IOHA 3NUQA 3U13A 3ED5A 2OA0A 5AVRA 3UMBA 1PW5A 3W5AA 1L7PA 2AUTA 1L8LA 3B9RA 4CE6A 1S2OA 4KNWA 3WGUA 2B8JA 3L7YA 3L8GA 4YIHA 3SHQA 4NWIA 5AVZA 4YCMA 4GXTA 5ALZA 1Z4OA 2HX1A 4UAVA 1CQZA 1Y8AA 4L6AA 5ALLA 4AP9A 1XP5A 3ZWKA 4NFLA 2CFSA 2GO7A 3MC1A 2CFTA 2AGVA 1L8OA 5ALTA 5AW0A 1JUDA 3A1CA 4QQFA 5AI8A 2IOFA 3WGVA 5AESA 2G0AA 2MU1A 4Y2XA 2ZBFA 3E81A 3QGMA 3L8EA 3R9KA 3U7EB 1MH9A 4BX2A 4KN8A 4Y2UA 3BWVA 5IT4A 1LVHA 3DV9A 3ET4A 5ALDA 3AR6A 5ALUA 5AW3A 4HGRA 1TE2A 2HCFA 2JAWA 5AVUA 4XE5A 5AKGA 4EX7A 3J7TA 4YH1A 4ZEXA 3L5KA 4C4SA 5A3SA 1U2TA 4BEVA 3QU7A 1Z5GA 2YJ5A 4O8CA 2R8YA 2WF7A 5AI0A 4AS2A 5AKJA 1U7OA 3N5KA 4I9GA 4Y2JA 3RF6A 3OCYA 4KNVA 2YY6A 3PCTA 2GHQA 2R8XA 3QUBA 2PKEA 3F9RA 2OBBA 2PQ0A 2IA5A 2NYVA 4EENA 5A3RA 3QX7A 2HEGA 2OYCA 3AR9A 3PDWA 2HO4A 2FPXA 3AR8A 1S8OA 4JB3A 1NNLA 4EZEA 3KBBA 3DAOA 4I9FA 4UAUA 2C8KA 2QLTA 2G07A 4C4RA 5ALKA 3W5BA 4UU0A 5AKYA 4NAVA 5AM4A 4PNHA 5AW7A 4IFTA 5AIAA 2P11A 2I33A 5AW1A 3CZ4A 5E0OA 4BNDB 2CN1A 3U19A 1WR8A 3D6JA 3SKXA 5AKHA 5ALEA 3SKYA 1RMYA 4EX6A 3U7FB 4QJBA 3L0CA 2BDEA 3ZVMA 4G9BA 5AK3A 4HGNA 5AI6A 1ZD3A 2R8EA 4DFDA 2YBDA 1Z88A 2QYHA 1YV9A 5FP0A 2FEAA 2WFAA 5ALIA 2O9JA 3WKBA 1ZD4A 4HGPA 3UMGA 4XPZA 3L8HA 1EK2A 3TLMA 2X4DA 5ALVA 3OCZA 5ALWA 4YGYA 2C4NA 4EELA 2ODAA 4UW9A 1RKVA 5AI5A 3WK8A 1TJ4A 4Y2SA 5AK4A 1ZD5A 1ZRNA 1SWVA 4Y2PA 1VJ5A 1YDFA 4Y2RA 4ZEVA 3I6BA 5AI9A 4HYTA 2G09A 4Y2YA 2GMWA 3L1UA 2YJ4A 4JDPA 2WF8A 4BBJA 1QYIA 3UM9A 1SWWA 5AW5A 4RETA 3I76A 4FFDA 3I1YA 5ALOA 1F5SA 4XOUA 4CF4A 4UARA 1U7PA 2EAUA 2FPSA 2RARA 3NALA 3MN1A 3MPOA 3A1DA 1Z4IA 3NAMA 2FDRA 3PGLA 3SD7A 4OHFA 1N9KA 1ZJJA 4YIKA 2C8LA 3ZTYA 4BKMA 2BY4A 4J2TA 3IRUA 3OCVA 4BNDA 2EARA 3BA6A 1RQLA 2R8ZA 3WK9A 5AI4A 5AKEA 5ALNA 1L7MA 1XPJA 2FI1A 4UATA 1NRWA 3ESRA 3ZX5A 1QH9A 5AKKA 5AKXA 2BDUA 1Q91A 3QU5A 5AK5A 4YCNA 2YN4A 1VFPA 2G06A 3ET5A 2Q4TA 5ALHA 3NASA 2WF9A 1FEZA 2WM8A 3KZXA 2HDOA 3L0BA 5AVVA 5AM3A 3QUQA 2ZBGA 4GIBA 1L7NA 3NANA 2B30A 4KX3A 3WK4A 5AW9A 2I54A 4RESA 3HYCA 3DDHA 4DWOA 3FVVA 1TJ3A 1YMQA 1T5TA 2YFYA 3QLEA 1YS9A 4NV0A 5AM1A 2ZOSA 1O03A 5AKIA 3N1UA 5A3QA 1Z4JA 2JARA 3WKCA 3ZW7A 5AVQA 1CR6A 3FM9A 5ALGA 2OM6A 1YNSA 3R4CA 2WF5A
chains in the Genus database with same CATH superfamily
4JL5A 2ADMA 1O58A 3GFBA 2A8YA 2OMEA 1S8FA 2YWEA 3DO8A 3L92A 1SBNE 2JFZA 3MGBA 2G17A 5F7ZA 1GPDG 3GVXA 4JLDA 4J0DA 4DCPA 5BQ5A 1A88A 1L4LA 2YHIB 3BHIA 4KJXA 3ZQ6A 4ETMA 1PBTA 5JJBA 2BFWA 1A63A 2D0DA 3X1ZA 3KUKA 4X00A 5LZ4A 4IF6A 4MW4A 3RBXA 5BMVF 1ZR4A 4EJSA 2E18A 4V3BA 3ZXUB 2VL7A 5ALMA 1O95C 2PH3A 3A26A 1YBVA 3CPEA 3SLRA 1U6KA 2I29A 1A2KC 3RAPR 4BFZA 3ICVA 6REQB 2F90A 1CF2O 4WLOA 4HUQB 1MC5A 2B8NA 1F8FA 5DHSA 5E7QA 2AL7A 3V4FA 3GROA 4TVKA 4LVNA 2PUHA 3I0ZA 2FWMX 4HAVA 4D5EA 2FF7A 2YIMA 3AOEC 2WTEA 1XXHA 2H00A 3CH4B 1P1HA 3G3EA 5CGZA 5CNJA 2O3SA 3K3PA 1IOWA 1CUYA 3ASUA 3QKUA 3CEAA 1HKHA 5IM5A 1RFGE 2WYIA 3EGXB 3GRYA 3NTVA 1K5PA 2R00A 4K7JA 4MQEA 5BR1A 1JFFB 5H3HA 4YXWA 1I5OA 2G3YA 2XSZA 5SV2A 1Y4AE 2GJSA 3II6X 2VRWA 4UNQA 2WUFA 3TLJA 4BL5A 1Z8DA 4BYGA 3DCJA 4AO6A 3EH1A 1ACMA 1MD9A 3IVXA 5EKSA 1NZJA 1BEEA 2I87A 3BD8A 1NG9A 2FOXA 4KTVE 3T4UA 4Q4DA 2C0QA 5IDYA 1JU9A 1W5TA 1HFEL 2ACEA 2XMBA 1E2HA 2XT9A 4F9EA 4EPYA 5KHLB 3TPCA 2GN0A 3WKAA 2ATEA 4DANA 3A6LA 4HEHA 3EJ6A 4YT8A 3JD1A 3RFUA 2X8AA 2JEYA 5EJ8A 3S8MA 3H65A 5HJ2A 3CCFA 1W88B 421PA 1UKYA 2EX1A 3PPIA 4FKBA 1OUMA 1T8PA 2WNHA 1HF3A 4HH3C 5EYPB 1G4UR 1RTKA 1Y1PA 4J0JA 2AMVA 1P17A 2VDMB 3F67A 2JHFA 3CCBA 3PEFA 5LYYA 4JSTA 1EJ0A 3KQTA 4B6EA 5IABA 1FMFA 4CCSA 4P0QB 2FW7A 4RTQA 1OXSC 1QGDA 2CF6A 2G76A 3AW8A 4II7A 4OQXA 3ZI0A 4A5OA 2B5VA 4B35A 1Z2OX 4MXDA 3CWCA 1CUEA 4NZYA 5CLGA 1WXFA 3VSBA 2MOKA 1U04A 3K4QA 4WXEA 2FEWB 1RMQA 4ZGWA 1CR1A 2PWZA 3NRCA 2OHVA 4IGFA 3GA7A 4C4OA 3M4ZA 2LDXA 3HVHA 2PX5A 2WYWA 3KT3A 3QKSA 3EZLA 3L82B 3P96A 3MZ0A 4R1LA 3D3KA 4PNZA 3HWWA 4GYKA 4FB5A 1N7GA 1MQ8B 1KI2A 3FUWA 3FUXA 5T6MA 4F4HA 8ABPA 5PGMA 1E7YA 1ZM9A 3ZOZA 1I24A 4IJMA 3DKKA 5T5QA 3I62A 3JQ9C 3NH9A 2XCTB 1Z16A 4X85A 5ALYA 4BZPA 2DAPA 4KQKA 3MJVA 4RHEA 4QPDA 4XFKA 4N54A 2RD2A 3IAEA 3PFBA 2WIFA 3BH6A 1OR8A 3ORYA 2IHVA 2M98A 3UXEA 4AJIA 1WU8A 4QUBA 4C7VA 3AQ4A 4RZ2A 1WVIA 1ZMBA 4O6VA 4YMSA 1KFEB 4LW8A 3OPVA 3Q1KA 2HMTA 4BV8A 1LVGA 5JJLA 5ERYA 4BX3A 1QGUA 2VQ3A 2PYIA 4ZO9A 4YHHB 2YJGA 2OE2A 3ETNA 5F1KA 2ZATA 3OT1A 3UXYA 1GCUA 1Q7RA 1XDWA 4ZU6X 1EFLA 3FWHA 3OIDA 1FDOA 3ELYA 2DWUA 4AUKA 5B3LA 3OQNA 2WOOA 2I8AA 3GD5A 3GIWA 1T26A 1Y1KE 1XF1A 3IUQA 5TPZA 1GL9B 2CT8A 1GARA 2FWAA 4J1TC 2YXDA 5B1DA 2XDAA 3WRXA 3U80A 1O3YA 2EJTA 2O14A 2DBRA 1ZM7A 1NSYA 4G09A 1GNVA 4H3HB 2ERXA 2J5QA 3KYJB 2B4RO 4I1RA 1I33A 2P9JA 3EXFA 2NQ8A 3UFXA 3S2GA 1YC2A 4JJZA 1GYQA 3ONFA 3FNBA 3X2EA 4DF3A 3LDUA 4WY8A 4KRYA 1ZGAA 3RTEA 4DWJA 4E13A 1AKRA 3TQFA 4CMGA 2K7FA 3IE1A 3I6ZA 5F2OA 1CX9B 3DH0A 3LHIA 1LUAA 4HDNB 3GJTA 1P1IA 1T25A 2ZIAA 3GQBA 1B8PA 2J5BA 3G2NA 2ORIA 3IIMA 2F4VB 3DOIA 1P44A 1E89A 4C7XA 3PNVA 1L4MA 1GP2A 3OD5A 1WV1A 2MYTA 3DTVB 3PJEA 1IUPA 4B76A 1B1AA 4GZ3A 4V0RA 2Q2WA 3T7KA 3YASA 4AF7A 4ZI7B 4YT2A 1Q57A 1NUTA 1ANKA 3SSMA 1SZJG 2MSNA 2Z9BA 1BE1A 2TRSB 2VDJA 1GG2A 2LBPA 3CB4A 3EXAA 1RI3A 3CLHA 3LYLA 1H8ED 3ABRB 2VDVE 2IZ1A 4CR8A 4EY8A 2D5AA 4BN5A 1FVHA 1ZM2A 4I5EA 4LECA 4V0ME 3SZLA 1MV8A 3STUA 3PVCA 3UJDA 1MTZA 1JHOA 4L73A 3URMA 4B4OA 3RC8A 3TXAA 3VNQA 1V16A 3SQLA 2HEIA 3CUUA 4JQZA 3DAGA 3V1YA 2VZEA 2LKCA 4C7MA 4PRYA 3BGOS 2EATA 3FZQA 1E63A 1G291 1HRKA 2J7PD 1DXHA 3B9PA 1QO0A 2DFTA 3CLSC 1NT4A 3F9IA 4U2EA 3ZE6A 2EERA 4L0DA 4MVJG 4XCVA 3EEIA 4IG4A 1E9FA 2Z58A 1E3SA 3D4OA 2J46A 5ALPA 2DG2A 3A3KA 4NXMB 1X3SA 3R6TA 4XB2A 2AFIA 2WD9A 2FMIA 4JUDX 4QU9A 3K7EA 3DO5A 1DKUA 1W5AA 2GAFA 2JAPA 2C83A 4J03A 1TQ4A 3KOXA 3AR7A 2BKXA 2BCGY 4L3VA 3GFPA 1VLLA 1VSQA 3MCAA 1E79A 3CT6A 3HYTA 4OBWA 5BQXA 2AMYA 4Q48A 3VR0A 3NHFA 4UQOA 2VH2A 2Z2IA 1V45E 1DCMA 2XX3A 2M6RA 5KQPA 1EJBA 1SH7A 5B4UA 3L7BA 4A2WA 2NSJA 3F73A 3EFHA 3EZFA 5EVJA 3OLVA 3Q11A 2BFOA 4LV6A 3BGVA 3R3WA 1QTIA 3SS8A 1DRWA 1FBNA 1RXYA 2DKNA 2MSCB 3RUFA 3ZCQA 5LZ8A 4GOND 2P5UA 3IBTA 1OXXK 2LCFA 3K1ZA 5AWFC 1E60A 2AJTA 4YJ2F 2NO7A 1K8ZB 3DMTA 2Q0HA 1O1YA 3IUMA 3SF8A 3UMBA 3SJAA 1Y6RA 3EFBA 2WWWA 1E9RA 4ARVA 4MP6A 3GMTA 3HVKA 2J7KA 1OHHA 1FFHA 1OU4A 4NONA 2VDPB 1GVHA 2QRNA 4YAOA 1T4DA 3A4NA 4ZAYA 3VVCA 4CLEA 2ZQYA 5HX7A 3MCZA 1AQLA 1P6UA 2D4AA 4HZUB 1X14A 4JKYA 5DXFA 4L9WA 4CM9D 1MFZA 4BMPB 2ZKLA 3ABZA 2E2WA 5KC9A 1W4BA 2QIPA 4BAZA 3CVOA 5LQUA 1F2UA 4DC1A 3A28A 3K6JA 2PUEA 2NN3C 1N8TA 1KVRA 3P32A 4E12A 3UPTA 1K7EB 3M83A 2IHKA 3PXDA 2P77A 1J25A 4LOAA 3ZHRA 4JZKA 1PG0A 5FO0A 3SX4A 4CG0A 4TSFA 5D87A 3GP8A 4HX9A 3ZQKA 4TVOA 1XMXA 3VDQA 2B9VA 3S2EA 2JB9A 5D3ZA 4L5IA 1IUNA 1GGMA 1T6YA 3TIFA 4L4RA 1PTKA 1TFUA 2FP4B 2HBRA 2LXNA 3T7JA 1NNEA 4A2CA 4GKKB 1KI3A 1OX4A 1TM7E 4R2HA 4JOBA 5AI8A 1SHJA 1BJRE 4OUDB 2X0IA 2ZIUB 1XZBA 2ZWVA 2FSFA 3VHXA 1JR6A 1LDYA 1JB9A 1Y89A 3IAXA 5C35A 4OG2A 4UJ3A 3P26A 4I55B 3U7EB 1AE1A 4O08A 1L5QA 3VAZA 1WZEA 2G8NA 2GN4A 3B9QA 3ENVA 3ULKA 3RJ5A 2VNAA 1E8NA 2BEWB 3NCTA 3V7NA 1EUQA 4A6EA 1GQSA 3ZVRA 4U1RA 3AR6A 5BXQC 3O84A 4PNPA 1WUHS 3PENA 4KSCA 2XMGA 4I5GA 4OX9B 2W2NA 3KQOA 1NPYA 3O26A 4P36A 4LNAA 1W96A 1ULUA 4PYJA 2XDWA 3BRWD 4P82A 5JPCA 2P6MA 2DHQA 1QHGA 2DJ5A 5SY6A 2ZJZA 3AW9A 2BFAA 2RJ3A 4QXPA 1TYDE 1VKJA 3FCSB 2GYUA 3GEIA 3PUZA 5TJ9A 1P0PA 4AS2A 4BDSA 3AVYA 1LW6E 2VBGA 3L9XA 2P2LA 5F7JA 1XD2A 1C8BA 3KFVA 4ML3A 2XNHA 3U31A 4A6XA 4D3XA 2VR1A 3ETDA 3NYQA 4FLMA 3AEQA 5EE5B 1EM8B 4P9NA 5E38A 2WQGA 1KYIA 4ZO4A 3ZBQA 3ONVA 3BMQB 4QDZA 5I7VA 1NBAA 1PQPA 1ZCBA 3GAZA 3PNOA 3S8YA 2BP7B 1OOEA 3VKUA 3WADA 2QLTA 4C4RA 1SBIA 2J9FB 1NW5A 3C1AA 5HQJA 6Q21A 1XMIA 2FWNA 4Z7NB 4CHGA 1K08A 5KS2A 1YS7A 1B23P 1DP4A 5LA6A 4J8PA 1NP6A 1Q0LA 2WTMA 4YP5A 4RHCA 3G2HA 1ISPA 2ADOA 2ZITA 4KQCA 3VZCA 1HT2E 1QX3A 4E4RA 4HZGA 1TUBA 3QEKA 4MWGA 1UFOA 3W2EA 2BJWA 4UM8B 1XX6A 3KX2A 1G1MA 3JQ7B 1UBRS 2PUAA 1FLAA 4IQ4A 4HLQB 2YFHA 1ZQ1A 5CNIA 2BM0A 3JAKB 1ZGCA 2CXSA 3EPPA 4D9IA 1Z8HA 3ZVMA 5AHOA 1OX6A 3N2NA 4S24A 3GRUA 1WF6A 4RYDA 1XCMA 4Q4JA 1XTKA 1XZHA 1E9EA 2YN0A 5C1PA 3T0FA 2WA1A 1WZIA 2ZWAA 3ACDA 2GRJA 5UKDA 2GVZC 3ND7A 1Z68A 2A0UA 4OYHA 3CZPA 4GOXA 1DKQA 3O1HB 3ENZA 4B83A 2A30A 4CIVA 4NOKA 1A8IA 2ZSAA 4EHIA 2V4MA 1DGQA 3TZLA 3OZEA 3IULA 5FYQA 1CF9A 5IAEA 2PX6A 3KKOA 5DW3A 3C3JA 1XF9A 3CX3A 3CYFA 3JQ9A 3R9XA 4BO0A 1A2BA 2FR0A 2XYHA 4HSEA 4PXAA 5J1TB 4UTRA 13PKA 1KAOA 4GG1A 2OGSA 4QQNA 4BO4A 4KQIA 1TMKA 2Q6KA 1R0BA 3RRYA 5AI5A 1N2GA 2FGJA 5HJ7A 4Y1GA 3MBOA 3P4UA 1F7VA 3A2KA 3BMOB 4XR4A 1P0QA 1KIAA 2YC4C 3HJBA 1QC5B 4C14A 1GTL1 4PONA 3HO8A 3DXYA 3PA6A 4IEEA 3LK6A 4QAJA 4MLCA 3KTDA 4M38A 3PJDA 1PJQA 3C8UA 1I3OA 3CTPA 1EINA 1VXRA 3ANMA 4UNIA 4J1TA 4CFYA 5C4IA 2JLXA 2XGMA 2OD7A 4DNPA 3EISA 2P90A 5MFZA 4BASA 5B4TA 2P91A 1NUAA 4MV6A 4D6YA 5LKRA 2EP7A 3HEAA 3RSSA 4Q7KA 1EFPB 3PL5A 1UBTS 2G25A 4RA6B 1SXPA 5L3SA 2TECE 4N3NA 2XUDA 3PKJA 3VR6A 4O25A 1HGXA 4BFCA 2ZR7A 3EBPA 1J20A 2O3UA 4UZSA 3DR3A 1M1XB 2C2OA 4RH0A 5FWAA 2WTXA 3DZDA 4TLCA 1GUYA 5ES4B 2C78A 3EXHB 1RQLA 2DC1A 1Z26A 2GDJA 2XCUA 5ALNA 1GZSA 1YACA 2N3ZA 5HDBB 3Q3EA 1Y1SA 4P58A 3WSWA 3Q4GA 4LC0A 3RU3A 1OWMA 2OZEA 3GJ3A 3OVMA 3PHLA 4G1VA 4MCIA 3T3HA 5AVOA 3UEOA 1G5QA 1ZNZA 1KBQA 4YRQA 1NRIA 1Q91A 2HIAA 5P8WA 3FSGA 3S44A 5ERXA 3AHEA 3HQ4O 1XMVA 5CCEA 4AN0A 2RAFA 1IEQA 4U02A 2RG7A 3D0QA 2A58A 4OH1A 1JXAA 1PL6A 3EIHA 2GPJA 2XF2A 1JYSA 4F21A 1B0UA 4B5LA 2HMUA 1CZOA 5EIBC 1A2OA 3ETEA 1H65A 5LXTA 3EG9B 1I1HA 3GGJA 3I5XA 1Z18A 3WK4A 2JH8A 2QM8A 3SOZA 5JQGF 1NQ5A 1SUIA 4NSNA 4XWKA 4Q7QA 3KJFA 5KNDD 2A0XA 3RYFA 1ZH0A 3LAWA 4FYXA 4R7ZA 2C2GA 2ORVA 2VT6A 1XWWA 3GWGA 3GJ4A 3ZCSA 5AKIA 2WTBA 1D04A 5J4LA 4HYYA 2D1FA 2EDCA 3HDGA 4HVTA 5CCBA 3LV8A 2IY8A 3B89A 1H1LB 1EE2A 4N8SA 1F2TB 4WCVA 1US8A 3HPQA 3QKWA 1M73E 5ALGA 3RTDA 2P9EA 1ZJZA 4INOA 4LQ4A 3SHQA 3V8RA 4ZXPA 3IT2A 1U7HA 5K8UA 2XCSB 5A2GA 3A11A 1IB0A 1J09A 1F20A 3OY7A 2JDID 2I2AA 3GJ6A 1HDEA 2YMLA 4MWCA 3OQBA 2CLHB 4LYDA 2PO7A 1Q2XA 3C6XA 2YOGA 1PLLA 1Y4ZA 4YAIA 1BKDR 2F3TA 2J9RA 4RABA 4CT5A 1CIPA 2WHEA 5FWYB 4YV7A 2DECA 5HEKA 1K9VF 4Z8YA 3VTKA 3F7OA 3L79A 1BHQ1 1XFAA 5FPQA 4INZA 4TRJA 1T24A 4KW7A 4HFJA 4BGUA 1NVVR 4YONB 3ZG6A 4YDRA 1PWXA 5TB5A 2ZB8A 2SCUA 4J7UA 5JNWA 2XGJA 3NKFA 3KWJA 1U3DA 1U81A 4MUAA 2CJYA 4QJ4A 4H6WA 2PBFA 3NEJA 1ZIDA 2PT5A 4G9GA 4EMSA 2V3VA 2WKSA 1HSOA 2C20A 4TM8A 5BPFA 2B8WA 4PHCA 1Z5UA 3P45A 5GM2A 3ZVNA 1JAHA 1QHNA 2ZB3A 3D2AA 3HBMA 4HEQA 1GUAA 1QG4A 1M33A 2QMYA 1DAIA 4R0VA 4AG6A 2FRDC 1PK7A 1N2IA 5KSWB 3K70C 2WE8A 5IJAA 3R5SA 5G3YA 2QJTA 5TPWA 4F5YA 4A1FA 4BNLA 4IFBA 2ZBUA 2X23A 3S2UA 3ZIUA 5K8JB 3LYHA 2PUFA 2JFBA 2W2XA 3BWBA 4D6XA 1U2EA 4REQB 1YS2X 3TD2A 2QY9A 1WULS 3HZHA 4O4LB 1C4WA 4H0CA 1VLQA 4EVIA 1B00A 2C2YA 1PWYE 2AR0A 2Y99A 5B7NA 2VZLA 2GLTA 1PR3A 2G72A 3NU1A 4RHFA 4ALKA 4MRNA 4ERNA 5G3ZA 2F1IA 5JFOA 6CHYA 3GA0A 4BNWA 2HMWA 4I19A 2Z2KA 1IATA 4UM7A 2Q4OA 4AKIA 1C8LA 1MBZA 5H83A 4IWXA 5FTJA 4TUYA 1E99A 5HBRA 4XARA 3QWBA 2IWHA 1AZTA 4MR8B 4MAMA 1MU0A 2V5AA 4O4IA 4ZCIA 4ZICA 4BX9A 1JZTA 4DMRA 3EZ7A 4N65A 1CULC 2HJHA 4EAAA 4NYJQ 4XWYA 2IZZA 5ALSA 4J2OA 5A02A 4AJHA 3B2NA 2A67A 1EFVB 2NSYA 4V0SA 4BLWA 1XDSA 1RQNA 2O8BA 1IWOA 5KOHA 5KTTA 5GQSA 3CH6A 4YP0A 2I3DA 4QFMA 2CVFA 2GGSA 4EY4A 4DW8A 5LYJF 3GUCA 4XJVA 3AF3A 2VTVA 4CIXA 5EE0A 1SKAA 5EQDA 5JSHA 3Q9UA 3W9UA 2GK3A 3DJYA 4LFCB 3RD5A 4JI6B 4CMIA 5CDYA 4QWMA 5KJFA 1ADCA 2XWPA 2LUOA 3NATA 4XM2A 3W8RA 3PTLA 3D1LA 2B1IA 4U7WA 5L3RA 3UXHA 4DILA 3WO0A 5KYTA 3OOHA 1V8FA 4H0FA 3WNVA 1WPGA 2I22A 5H59A 2VP6A 3IGFA 3N76A 2PG3A 3RYTC 1MN6A 1E1CA 1TQDA 2RONA 2FXVA 3R5TA 4RIIA 4FLEA 4IZIA 2J9XB 5EP3A 2WV9A 2IV7A 3MTBA 4GICA 4YCDA 2F7SA 3KQLA 3BFJA 4U3JA 3CV3A 4YI5A 5ENZA 5FI0B 3TOVA 3AF5A 2JH9A 2BGRA 1QQAA 2QZ9A 1T1IA 4WCDA 5CT5A 1T9DA 4X9XA 1ESEA 4OA8A 1Q16A 7MHTA 2FPRA 2CDRA 2WWRA 3T5CA 2HRBA 5FWNA 2AA3A 2ATIA 4IVRA 1PFQA 1OREA 2BFFB 2PQ2A 4MO9A 4CM1A 4EW3A 4Z4HA 4HDOB 4NABA 1Z25A 2DWCA 2XIJA 3FFBA 1K9SA 1VL1A 3QEMA 4G65A 3D2CA 1BXRA 1RYDA 2HJ9A 3ECCA 4WERA 3KQNA 1AK2A 4WTOA 4DWWA 3EZNA 5AKZA 3S81A 3JX9A 4R01A 4HGQA 1NLYA 5ALRA 4OSPA 1G6OA 4ZKEA 2G6BA 2SKCA 4MRMB 4NL4H 1G8SA 5EKDA 4DLKA 3JPYA 4PFKA 5DK6A 5EWJA 3DOHA 4G5FA 2NUAA 2JLBA 3CFYA 1KEUA 1RXCA 2XQVA 4C89A 4EPWA 3WYAA 1GFIA 5K4HA 2A0WA 5FI5A 5L51A 1UDRA 4GPEA 4RH3A 2WKQA 5FUXA 2O5RA 3I2FA 3QUTA 1BN7A 2BHRA 1K0FA 4MITA 3ON5A 2QD3A 4Y6GB 3C97A 2P2CA 5F5NA 5REQA 3AZPA 1E2PA 3BKWA 1CUWA 3ZZ0A 3FZGA 3MJHA 2JEZA 2H2IA 1YR2A 3W5CA 5AW6A 3CY6A 1YK0A 2NSLA 1O0BA 2IBMA 1Z38A 4UD2A 1YS6A 5A7GA 3DDZX 2O2YA 2QX4A 5JXJA 3T95A 2XCRB 4UTNA 2FSUA 2P69A 5F1OA 5T3YA 3WLEA 2WQ7A 3KQUA 2HF2A 3GZJA 1V8DA 3R7WB 4BFYA 5EJ5A 1P7CA 1R64A 4MQFA 1TOAA 4UMEA 5GONF 4DDVA 5KSZA 1ZA2A 2VXBA 1OXKB 4GYWA 2MPHA 1SVIA 4M0KA 4YECA 1L5KA 5CTJA 1AKEA 3NIWA 2B9EA 3UB2A 1WXEA 2IIPA 2QUKA 2C7OA 3LVQE 5DHQA 1TAHA 2C5BA 5D6NA 3WLLA 2Z8XA 3ZV3A 2QLJA 1WDTA 3WOVA 4N48A 5BWMA 1M34A 1GCAA 3QFSA 3QHPA 1J1IA 5A5FA 2PL9A 1RQRA 2PS3A 4A3SA 3LO5A 2G04A 2AFHA 2JCXA 4LF7B 2F55A 3IKMB 4TTSA 3WL3A 4BNUA 2ZJ7A 4O4HA 4U8GA 2XZLA 4OK3A 2IU6A 2ZBVA 3WZLA 1Y5MA 3RG2A 2IQ5A 4GMDA 4S2UA 3ORSA 3ROTA 4ETWA 4LWZA 4EFDA 2BH9A 1M2VB 2B6NA 3QMMA 3UA4A 5AVRA 5C52B 2W58A 4ZOLB 3AVUA 2Q0QA 1IZYA 1VC2A 1A9SA 3ONEA 1S2OA 4KKVA 4MVJF 1GAXA 3ETGA 4GHWA 4GMXA 5F64A 1S01A 3UV6A 4GC5A 5CBKA 4B3MB 3KKPA 4IIGA 4JCCA 2GKSA 5CGQB 2PWBA 5DMHA 4ZVVA 3EN0A 3DVRX 1WRBA 1AY0A 4GSLA 1NQAO 2W2VA 4GI3A 1W36B 4FMCB 1MNAA 2ALJA 4XGRA 3L04A 1EJ6A 3KZ1E 4DQDA 4RD0A 3EPHA 1ZC4A 2AQKA 2HBYA 4ZJYA 2ODPA 4P3OA 1YB5A 3QIVA 3WLJA 3KLBA 4MR7B 3MSCA 4JJ6A 1BCRB 1BAPA 1RM5A 4JZYA 5D5PA 4DIMA 1P5FA 3CF4G 1EE9A 3F46A 3LD9A 3PQ3A 3LWDA 2VWGA 3JVDA 3QY0A 4M1YA 4W82A 2WNIA 4XJSA 2CL6X 5EJ6A 4R4JA 3SYMA 5AW0A 1PTJC 1A5BB 3GBPA 2RGYA 2PD4A 3MIIA 4P7BA 4WW0A 4Y2XA 3VPFA 2JI9A 4K8OA 4X8LA 4JQOA 1BMFD 2NP7A 3DEIA 2DK4A 1Y5LA 1WEHA 4KPFC 2UYHA 1SC9A 3AXTA 3MBIA 3AJRA 4GQBA 1Q1NA 2XQKA 1CUXA 3ELBA 2ZT6A 1YL6A 3D3EA 3E18A 3IV6A 4MVJD 4QARA 3TTTA 2Y0EA 2G40A 1IM5A 3GLIA 4HDKB 3VJRA 1DO8A 1WW2A 2NMVA 3PA8A 3OCJA 3F78A 2C9CA 5P21A 4LXTA 1Q1ZA 2P62A 1U2TA 3AL2A 5FAXA 3B51X 2RHWA 1N0VC 4Q66C 1K7XB 1Y8QA 5CB0A 1HE3A 5FBZA 2ZXUA 1VYVA 2WF7A 3OAAA 4DLBA 2GJ8A 3LQFA 4M98A 3VR5A 3E9NA 4OHRA 1R6UA 3O3OB 1H5QA 1YZUA 4LF8B 3KZCA 5AKJA 1N78A 2ZRGA 5ITWA 4D7AA 2A0YA 3VU1A 4MEJA 2VH1A 3Q85A 2N1BA 2Y4OA 4DCTA 4DLWA 4BLRA 3EIUA 4MS4B 4KO4S 4O0LA 4A26A 1H69A 1O97C 1FDIA 2PFKA 3HLYA 1RCFA 3TZ6A 1W4CA 1JNXX 1TEZA 3L7CA 1W5BA 1X92A 3FCUB 4XQ9A 2ECKA 1Y5IA 1ZESA 1N6NA 2FPXA 1IMJA 3P2IA 3K5WA 4OIMA 1VHQA 2FG6C 4K40A 2BGKA 3JQAD 4RH1A 1L5HB 4YWJA 5GPBA 5AUQA 4YA6A 4WSOA 3TRFA 2C97A 4DPKA 4KYIB 4JLSA 5B53A 1U8AA 2P35A 4K5QA 5H3LA 4F96A 2JC3A 4N3CA 4CF7A 3PYLA 3UJCA 4L8LA 1L7RA 3VO9A 4PNHA 1KZHA 4MGKR 2ZJ2A 4YT5A 1XA0A 3FPKA 3D5TA 3A04A 4XIJA 4QWWA 1EGVB 4BJ1A 1PZEA 4MI3A 3VXKA 3FFWA 5FDFA 4U2BA 4LJ5A 5TMPA 4OGGA 1IG0A 5E9AA 3B78A 3BICA 3DEAA 4BLVA 1EB9A 1NBWB 5TF0A 4AY2A 4HKTA 5DIFA 5IFKA 2IXTA 3QG1A 3WR5A 3M6LA 4BKOA 4AZ0B 3L0CA 2OCLA 5I45A 3PUKA 1D1PA 1QCCA 2IYTA 4M1WA 1KBOA 3UBMA 4K03A 1JSZA 2P9FA 2PX3A 3LECA 2AR7A 2EFHB 2POCA 3P97A 4G9EA 4JJEA 4N49A 4N7RA 3U3MA 2X0DA 1XR3A 2G0NA 2WHPB 3EAGA 3I5UA 1Y7PA 3QI7A 4GE0A 4DOMA 2AVNA 1PF7E 1UEJA 2BRUA 2NU6B 2RHTA 4GBJA 1EX9A 2XB4A 2YZGA 1E2QA 1C1DA 3ADKA 2JVWA 1V6CA 2NW6A 4FGZA 2OAEA 2GFIA 2W7TA 5KKCA 4BV9A 2K2QB 4G5HA 1W75A 2ID4A 2JJ2D 4IR7A 1RZVA 5FOVA 3R24A 4DUZB 1C4XA 1A8UA 1DJOA 1GR1A 4LHWA 2AOUA 5GVRA 3BE4A 4OQNA 4CM8A 4QT4A 2WTAA 2C4NA 3VZRA 1GN9A 5DP1A 1WIWA 2DUUA 2DU8A 4WJZA 3K9LA 2IEYA 5GV8A 2HMYB 4TXNA 3TLEA 1ISGA 4REMA 5KOIA 2H4YA 1CY7A 2FQQA 3HZOA 4FDTA 5EXSA 1YA4A 1GTRA 4M1KA 1I4LD 4U63A 4RPCA 1G8YA 4W9MC 3T8YA 3ECSA 4GRIA 3ZD9A 4DA4A 1AX9A 2PMFA 2WF8A 4AMZA 1CRLA 1H9BA 3HV2A 5FLYA 1Z3CA 5AW5A 4BHTA 1SBQA 2DX7A 2FXIA 2W2KB 1T1GA 1BS1A 1F5SA 2QG6A 2YR0A 4G2TA 4TMYA 2QAGC 3QPDA 2VK8A 2YJTD 4F4JA 4P4NA 4DLTA 4QOIA 3DKVA 3L6CA 4KR7A 2XE4A 3O8QA 4BWGA 3Q72A 1ENZA 3BWCA 4DSZA 1HDYA 1ODLA 3DZFA 1I94B 2IU0A 4RSMA 4DIKA 2J3IA 2FDRA 3JATA 5BV2P 1WY7A 3UGJA 1V1JA 3LUBA 3KPWA 3AY6A 4OYRA 4YIKA 4EGQA 1EXNA 2DPMA 3CLRC 4F0JA 3T3NA 1MC1A 2V97A 3EA5A 6LDHA 4IJ6A 4PZUA 2XCQA 4DV0B 1T3TA 5IASA 1GVNB 1UBSB 5JALA 2H2WA 2O50A 3U56A 2IDMA 4KFUA 2HQSA 3URKA 4TPKA 2H16A 3HBJA 1YZGA 2WSMA 3ESRA 2RCYA 3ILVA 2OB1A 1YZFA 1TJPB 1T4GA 2NAFA 1W29A 1KQ3A 3QU5A 3FD8A 1M6YA 2EG9A 4I14A 3ZJTA 4DV6B 3RQIA 1G0OA 1ODKA 3LQ1A 3WIBA 2P6UA 1PR0A 5DMXA 1AH2A 1S2MA 4Q4HA 5CX1B 1TJNA 1B0AA 3KZXA 2R8OA 3H7AA 4R9VA 4RF3A 1JTEA 4C07A 1X80B 2PXHA 3ITNA 3THOA 5K0ZA 3RSQA 5AM3A 1JLRA 2PMDA 4XD7D 3QUQA 2C3MA 4ZYYA 5CB6A 4COOA 3UAVA 5AUOB 1CFZA 2ECQA 3ODGA 3RVPA 4L5AA 2VHEA 3AEZA 5H9WA 1CJSA 5CIQA 1X1SA 3HO1A 1XTVA 3K0HA 3MXOA 5EE1A 4F1KA 2HU5A 5A3QA 3SJCA 1XCJA 4G0ZA 4NYIR 2P8SA 2V7GA 2WWGA 3CZCA 3KSDO 1P1CA 3QEOA 5FA6A 2C07A 2XNDD 4PC7A 4HTFA 5H4HA 1MKYA 1E77A 1P6XA 3HUEA 4KQHA 3TNYA 4NEQA 2NZ8A 3JQRA 3W34A 4YUZA 2YWBA 1YNSA 2J48A 2QRKA 4JI4B 3WGYA 2ZJOA 3QZUA 4DLUA 3QUSA 3LUAA 3RHZA 2EGGA 2CV0A 4I81A 2HXSA 3SBEA 2GYWA 2W6ZA 2W2MA 5G0TA 5ILOA 1DQYA 2EWVA 3UYKA 2HHLA 1P7PA 3KYCB 1AIPA 3V1KA 1I30A 1XRLA 2YZMA 3KJIA 4KDEA 4DARA 3NNDA 4YAFA 4U7TB 5MN4A 1O5IA 3H13A 3LMKA 5JNSA 5TF4A 4P31A 1PJLA 3TE7A 2R65A 1GTSA 1QG6A 3FWZA 2QROA 4CM3A 1H2HA 3ELUA 4XD2A 2XXAB 1TA0A 3F97A 5EIEA 4OI0A 1HO3A 1NLUA 3B8EA 4LJ7A 4QVGA 1B3RA 2J3HA 4JN6B 4U2DA 4PX2A 1Q19A 4R2LA 3HSSA 3LC0A 1NJSA 5F1YA 3HP7A 1RZ3A 1DC7A 4X84A 3FPHA 1RHJA 3I30X 5L95A 3SDBA 1H4TA 1PGJA 5KU1A 3FGPA 3RUEA 1EFCA 1QHEA 2C0CA 3CSDA 3KB6A 5BSUA 4BGIA 1M67A 3VNRA 3R8FA 1NKSA 3GVIA 4Y2QA 1SR8A 1EGMB 1I3KA 4YXFA 4E88A 2VSXA 1C9EA 4WKPA 1NMZA 4OUKX 1JWAB 3LLVA 3G0GA 3JXEA 4BLSA 3VPHA 1EIWA 2X19A 2QA5A 4H27A 4O4JF 1S3IA 2Y66A 4Y2GA 4MCJA 2NU9A 4C7KA 2HYIC 1Y6FA 4JP3A 4BRSA 4MP8A 2QTZA 5EPUA 4NXNB 1RQGA 1LPAB 1W49A 3CW9A 3DLCA 4POAA 3UVEA 4EWLA 4BB0A 4E2YA 2QOEA 3R2JA 4X71A 2FPIA 3QFRA 1AD2A 3RUIA 4A23A 2Q29A 4GZ6A 1QHHA 4Q9JA 2NUTA 4ZZ2A 1IZ9A 3KHUA 2HCTA 4D02A 3EH2A 3TNDA 1N6IA 3QWIA 1TU0A 1MAAA 4JT8A 1XVVA 5D7NA 5EMLA 4GPIB 3ZE2B 2PL3A 4F1JA 3A0UA 3K4HA 4S1TA 4F2WA 4PG4A 3MJ4A 4L15A 2VYFA 2OLEA 1BWPA 3B7GA 1ISMA 3GG2A 5FAKA 5FX2A 4B81A 4S3MA 4B09A 2WAYA 4MUNA 4EP1A 1J2UA 1NC3A 3KKEA 4TXMA 1R2QA 2QTMA 1PDWA 4GZ5A 4FU0A 2O8EA 1NBEA 4I8DA 3LBIA 4KQ6A 3A37A 1JG4A 1VLHA 3OCCA 2FW6A 3DMFA 5KWEA 2VRBA 1OROA 1GNLA 2I3AA 3V2UA 3J80A 1KBZA 1TF2A 2C5LA 2NO6A 3HGQA 3TW4A 1ZOLA 4QHTA 1JQDA 2PYZA 3AP3A 4FHEA 2P9GA 4FEAA 4EDHA 1JQEA 4FIZA 4LXQA 3W7VA 2I8LA 2NNLD 4BYMA 4PZEA 1PK8A 2CVHA 3HN2A 3MD9A 4FYHA 3O1JC 3RFTA 5CIYA 3WZ2A 4ARZB 4C4XA 4TQGA 1J7KA 4R5HA 3MT0A 5C51B 4YX9A 3ISVA 1G8MA 3ND9A 4KXYA 2UV8A 1O4WA 3WHLA 1ZHHA 3RGGA 1Z35A 1X13A 1T29A 2BKEA 4U9IS 2CNNA 5KB3A 2Q41A 3FW1A 4AJPA 1MNQA 4YALA 1YR3A 2GB4A 5FTMA 4C9BA 1IBCA 4YRGA 2YINC 4FW8A 3I39X 2ONJA 3UMRA 4YQFA 5F3WB 1FSPA 2QX7A 4GAEA 4OFBA 4D0RA 4XX0A 2O8FB 4EG5A 2MWMA 2PMCA 5IDQA 3NHKA 4YCAA 1AUOA 3COJA 2JHPA 2PQMA 1LX7A 2WM9B 1V5IA 3ESDA 4RJLA 2AW5A 5KQGA 2P5TB 4ZAVA 3VVLA 3ZHSA 3PQFA 4PYKA 1AQIA 1FS5A 2G82A 3C98A 2YYYA 3CWQA 2WU1A 4UE6A 3U7HB 1Z5WA 4TV9B 4KITB 3L0PA 2RK6A 1E1LA 1W44A 5ITVA 1I4DD 3PI7A 2WWTA 4L6IA 2VDNB 2WP8J 4D96A 4MA0A 1ZA1A 1WPQA 5DB4A 5IVPA 1L5FA 2AVDA 2VDWA 4Y98A 1L6IA 3W8DA 4EG4A 3OKFA 1NQWA 2UXCB 1FRFS 1M0EA 1T4MA 3T7AA 4B7UA 2WF6A 2WFLA 4HXYA 4MA5A 3U3JA 1YOVA 2PX4A 1RLMA 3KOMA 3CVYA 1XB2A 1JIXA 2XOKA 2QUAA 4ZOEA 1LGYA 4YI3A 1FK8A 4TXLA 3GIDA 5F77A 2I3BA 3QJGA 4FI3C 5L9AA 5EY5B 5J5AA 1MIHA 3B6KA 3KCQA 3J7AC 2IPOA 4XZ3A 4YMTA 1WCIB 2W6JD 4RMNA 4M0EA 5DF1A 1MX9A 1ZNWA 3AJEA 5IS2A 2ZIVB 1W85A 4H6PA 4Q0MA 2H2GA 3AHGA 1NXXA 3TD6A 2BGUA 4AZ3B 5GM1A 1ID1A 3BIXA 1QG0A 1MPTA 1O0SA 3ZJUA 3VGPA 3B9BA 1Q0RA 2I55A 1ML4A 5AT1A 2BGGA 1UPFA 1NX6A 3F90A 3C39A 4LG1A 3FRIA 4UVIA 5BP7A 2EIXA 3TR0A 2JCSA 3FKSA 1G4HA 4JI2B 2CUTA 2JW5A 4OHZA 1I7NA 3DP9A 4X1OA 3W5JA 5C80A 4HDSB 2QD4A 1Y3CE 1PR5A 3OZUA 4S12A 4INJA 5E6RA 4XXHA 5FNVA 5K4GA 2V98A 1KO5A 4NBWA 1A97A 1ZINA 3QW2A 2WLSA 3S2ZA 1RJWA 4KGDA 4H3KB 3ROFA 4Q7JB 3RIXA 1X6VA 3IBYA 5DZSA 1YA6A 5JT1A 1T6BY 2I6XA 1AC5A 2XEDA 3GNTA 2P8JA 1G2OA 2PXAA 2FUG6 1RXUA 3V8VA 3GXBA 5JSZA 5FL7A 4NBLA 1OWNA 2G63A 3R41A 5H8WA 4JQSA 3WL6A 1NXWA 4M0UA 3DXFA 4N01A 2EBUA 1Y82A 2GBIA 3Q8WA 4R8KA 1Y8ZA 4PLVA 4F7DA 3E4CA 3QE2A 4B8YA 1GAJA 3KCNA 3TKLA 5ISMA 2V7VA 2VSOA 2OA0A 2H1SA 3KSZO 3UK1A 3W5AA 3LA8A 3K0KA 2D8AA 3UTCA 4CE6A 5ILGA 1ESCA 4P86A 1MO5A 4IZHA 1Q3KA 1JMVA 1OFVA 5DTQA 3WGKA 4GP7A 2RHHA 5B7GA 1X7DA 2JZCA 3MGKA 2WWIA 5CTAA 4KK4A 2G5CA 1RBMA 2O0JA 4J0EA 5BMVB 1X2BA 2OMKA 3HZRA 4YFYA 3L8GA 2XUAA 2YQ4A 4CGZA 3ZV7A 4XGQA 1Y8RB 1ZD1A 3EMKA 3IBGA 4F3KA 2VIIA 5L3QB 1JHVA 4B3IA 2EBHX 3K1TA 1V4NA 4PQFA 1E6WA 3VSEA 4PPNA 2E4VA 3DLPX 1A82A 2FDXA 2RK4A 4KXFB 4UEQA 2HSDA 1EWKA 1FU4A 2XVZA 3T3MB 3LBAA 1K92A 5B64A 6NULA 3TRKA 1JQBA 2C5GA 2M6LA 2ZBQA 1Q0TA 1R10A 1Z22A 5LU9A 5EZSA 4C5BA 5HSGA 3L84A 1P29A 1SCQA 3MC1A 4KWIA 5FA5A 3AETA 3W79A 4HUJA 3KQQA 2XYPA 3ZYCA 1PEYA 1LPBB 1FDVA 2QVYX 4RULA 2GK4A 3MJCA 4MRAA 1YS4A 3MWJA 3QLVC 3GEPA 4BX2A 1NYTA 3DEKA 3DDNA 5JADA 3DE2X 4IH9A 1CWUA 4IKEA 2DFVA 3ET4A 3D7LA 1AUPA 5ALDA 3E0QA 1OA1A 5IMBA 3AONB 5AQ1A 4HK4A 1DBIA 3RB8A 4HCJA 3UW3A 4XE5A 3B53X 3G8AA 5L6LB 1V1RA 1YQTA 4DIDA 1F0YA 1XHFA 1Y37A 3ZJ4A 1M5RA 1P0CA 3DBRB 1L4HA 2P3SA 2WUWE 5E8RA 2QNIA 1Y5RA 1YJQA 3L7AA 3RS7A 4WKBA 1B3BA 2VRCA 4KL8S 1HDGO 1LDNA 4PHGA 4I9GA 4IOLA 4ETIA 1UC5B 1ZUNA 4IIEA 4LTMA 3OPMA 3AF1A 4UE2A 3WFJA 2C04A 3RS0A 1Q50A 4XYLA 1KPHA 4ZHSA 2YXBA 3GEEA 1PWHA 2QT9A 4IIUA 3UMFA 4QOFA 3AR9A 5EN4A 3M1LA 3MRVA 5K1ZA 3GCGA 4MVJM 3GU3A 3HRIA 2DCUA 4AUMA 1HE8B 2Y2VA 2CE2X 2G5PA 2P65A 2JIZA 3KQHA 4YRIA 2I1QA 4X1YB 3MWLA 4UAUA 2ZULA 3Q87B 3BB1A 2DEUA 3PDCA 1H9FA 4I6JA 1QCYA 3A9SA 2VZ8A 4RFLA 3HXTA 3ZWXA 5IAGA 4AKTA 5BV1A 3FYUC 1MR3F 1SHTX 2QYOA 2JATA 4TMZA 2BM1A 4OB6A 3PC3A 2DHRA 3R1IA 4CLOB 1GRRA 1PGPA 3B3JA 3MK31 5A9SB 1A76A 1QUEA 3GBVA 4BEBA 5JZBA 3GGDA 5E0OA 3CZMA 1Y7IA 4EUFA 1ZUWA 1N8KA 3O2SB 2CHEA 2I2BA 1YAJA 2RJNA 4DRZA 1MVOA 4TTIA 1KDOA 4HPJB 4ZQIA 4NV1A 2DPGA 4W8GA 2ERYA 2EIHA 4JLAA 4LDQA 1XEWX 5BOSA 3U7FB 4QJBA 4N3GA 3WSTA 1JPNA 1XELA 4KVZA 4PO8A 1M5TA 2HV9A 3GH3A 4G01B 1V8OA 2E1PA 1UQUA 1CETA 2R8EA 2XHZA 1C2TA 2YBDA 1FDTA 1PJRA 4ZMSA 2EP5A 3FVTA 1PKEA 5A4AA 4RZ3A 3UMVA 1MFPA 4RTPA 1LPPA 4BATA 1M5UA 3TTSA 3ANLA 2MR6A 3DC7A 2WWVD 5CFOA 2Q5OA 2V7QA 1UBJS 2DHDA 1BROA 2VDRB 1X8LA 4NYJR 3OMWA 4KOEC 4R71A 2JGIA 4DLPA 5ITZA 3EXEA 3QA3E 4RTJA 3AYXB 3FZEA 2PU7A 4UQPA 1B15A 3CG4A 3INGA 4XUEA 2V6JA 2EHJA 2O6HA 3ORFA 1SOAA 3MOIA 1QZUA 4LZWA 2QMUA 1JU3A 3OESA 4RVNA 2LIPA 2NXNA 2F64A 2HJVA 4KFTA 3SOPA 3TWOA 4Q4AA 3VC7A 1YQXA 1COWA 3MYRA 2VSFA 1M3SA 3OTWA 4LRXA 4UW9A 5IKOA 4LVCA 4A8JA 3I04A 1PW7A 3LT4A 3MJSA 5GTDA 1RRPA 2AOVA 7ADHA 3U4MA 4RE6A 1T8WA 5C7YA 1XNQB 1HORA 5CVCA 4BO2A 4HQLA 1F4PA 5JE8A 2Q3MA 5AOBA 1ECBA 3I72A 4DG5A 2V96A 1QO0D 3TFWA 2OL4A 1Y80A 2VBIA 2HW8A 1KHHA 2ORWA 2QNBA 2NZUG 3QBJA 4XWAA 1NVTA 2MTBA 5K0BA 2CMHA 4GI7A 2NUBA 3I1YA 1SBYA 1YFJA 3TCKA 4OK6A 3W5HA 3E7FA 4XOUA 2CMDA 3WQHA 1U6JA 4ARUA 1HXHA 4PW0A 1PI3A 1UKBA 1ULBA 4GKAA 4LHEA 1ZDMA 3H4VA 4J3JA 2PNFA 1EGHA 2IYNA 1VBKA 2HRZA 5AOAA 4TYQA 4TT8A 1R0KA 3TOZA 1JDZA 1PN3A 4YRRA 2CEKA 4ENPA 2DQ4A 1JP7A 3MHPA 2GN9A 3FN4A 2PGNA 1Y0BA 2FY8A 3IPAA 4MV7A 3PGMA 4UDNA 3GDWA 1M2HA 4JC8A 1APBA 4YJHB 3VOTA 2C42A 1QSGA 2WD7A 4DNQA 4MCAA 5AP9A 3NBKA 3ZS9A 4FMDF 3B2QA 4PYIA 4X3CA 3OKAA 2J9GA 2R8ZA 1DDIA 2F43A 2X3YA 1FVOA 3D7MA 3EUEA 4WFQA 5CXSA 4JJ8A 5IM4A 1H05A 2BTQA 4ER7A 1TPZA 3I2GA 3H9JA 4HXFB 4KWHA 4DLAA 1PL0A 3LTNC 4JA0A 3OIVA 1MJGA 1RCTE 3Q0IA 4UATA 5FBRB 3U3XA 4TZKA 4DHWA 4P7GA 4LGMA 1XJWA 2P0AA 2Z6VA 2FJ0A 2UVPA 5JRJA 4EYSA 2BR3A 1U9IC 3F2VA 2G06A 1IOZA 3NOVA 1EMDA 2BOVA 3TB6A 5BN5A 1SUEA 3NTLA 3BFPA 2XZDA 1DIBA 3IBSA 4KQXA 3INYA 5AVVA 1AM4D 2VTEA 2PUCA 4YJ2B 4JENA 5INTA 5ECWA 4C2AA 1N5JA 4X20A 1O7JA 2VA9A 1EA7A 1NWCA 3NANA 2C8JA 3ANNA 4EUHA 1RYBA 1L1QA 5TDHA 2Q49A 3KTAA 1KY5A 5HVNA 4N6OA 4Z3OA 3IIIA 4F3TA 2YL2A 3O8BA 4GWGA 4PSKA 5LBUA 3FVVA 4MS1B 3RT1A 5AM1A 3WQBA 2YKGA 4I5DA 1D2NA 4ECEA 2PPVA 5BSKA 2OGZA 4R81A 5DTRA 3HKCA 5LQJA 3GY0A 3M6AA 4ZHQA 1U1FA 3FB1A 4RDCA 1GQYA 3TVDA 2WSYB 1R6AA 3HN6A 1UFQA 1D3AA 2X0RA 3W7AA 4Q00A 4L8WB 3UAYA 5HIKA 2GETA 4E94A 2GCEA 1AK1A 1ZRMA 1EDZA 1GZ6A 3WGQA 4JLMA 5JAMA 5KI6A 3FJYA 1TAGA 3DQPA 1G41A 4J0QA 1NQOA 3V55A 3IMFA 4HGOA 5FLXA 5EI5A 1KYYA 1M8JA 1UXOA 4AIIA 1CEXA 2OFWA 2EL9A 3BD9A 2DFNA 1OBOA 3BTSA 3LRPA 3R8XA 1MABA 1KNQA 1FTGA 2GPBA 5CIUA 3CF6R 3NVAA 5EZ5A 3HB0A 2C9OA 3STXA 1O95D 4MJ3A 3SP1A 2P0YA 1OX5A 4U7FA 3E2PA 5HIAA 2BLNA 3ESQA 4EPRA 2E6UX 1ZK4A 3V3TA 4MAFA 3REQA 3B82A 3V7FA 3A6FA 2ZB4A 3OTHA 5JXWA 1ZX1A 3VNBA 3U62A 2JF0A 2OG2A 4RIGA 5HJ5A 4KR3A 1X70A 1F3OA 2V0GA 3RU2A 2O0MA 4QREA 2IE0A 1ZS9A 2OR3A 1OBFO 3CZ9A 3KTOA 4LI3X 3WDMA 3KOZA 3KFXA 1Z39A 1SOWA 5BV0A 3LUPA 3ZD7A 3LZDA 1W35A 2A78A 1VE7A 1OYYA 2IEBA 1FMLA 2Q5EA 1NOJA 2VNJA 4I9UA 1FRZA 5GMOA 2EZ9A 4YRJA 3ZU3A 1E2GA 1H4SA 4HAOA 4J75A 2HA2A 4LFAB 2FVYA 3UGTA 3LL4A 1K27A 1KC1A 1CUCA 1GN8A 1TQ2A 4HTAA 4CT4B 3BBLA 5AJHA 5I8WA 2AUNA 2W48A 5FULA 2LRHA 1UPUA 3WZMA 4CKZA 5KSYA 2Q9CA 3MWKA 4ILEA 3L0YA 1HQKA 2NO5A 2O3TA 4HEJA 1A2QA 4JSYA 2BHSA 1XTPA 3MEQA 5FJJA 3TRIA 2OGTA 1J0CA 3PDIA 2BAGA 2QRUA 4MDYA 5AKLA 2HN9A 2PH7A 5DRYA 1W4AA 3E2MA 3W6NA 3JAWB 4WECA 5BNWA 4GM0A 4X7RA 3C1UA 5D00A 3ZDEA 1K98A 1KEZA 2I4IA 2W51A 2Z04A 4LBVA 3ADPA 2IYEA 2AOXA 1KIFA 1YKFA 4TMXA 3UHFA 5E4YA 1GL6A 3UUWA 4D3DA 3WLPA 2QLMA 3M3PA 2B2XA 3SLKA 4RD2A 3MCTA 4UXHA 4Z9FA 3T7EA 3A06A 3TFOA 3AQIA 2VJMB 4TXHA 3LUKA 4RTSA 3W8NA 3RRXA 3IOBA 4TWJA 1UJMA 3DGEC 3UY4A 1M8GA 5DHFA 3K6SA 1GTVA 4ROSA 2CVZA 4WUVA 1MAVA 3P2MA 3QTBA 3TOSA 3S8EA 1A4RA 1G21B 3EDYA 3GMDA 4Q34A 2W6OA 4D57A 2FN3A 1J0BA 3VZPA 3HM2A 1OTHA 2OHJA 2O1XA 4NE7A 4TKVB 4MTLA 1GSIA 1AKUA 1QGOA 1BYIA 4IFIA 3U3ZA 3WLIA 4P4SA 3P7MA 2HK8A 1HC7A 4LY3A 2IS1A 1RI4A 2JGRA 2QTTA 2W4QA 2B25A 1PQUA 4AF8A 1J5EB 3DE7X 4FHGA 4KXVA 4EM6A 1P1BA 1EFHA 5B2FA 1TIPA 5LP6C 2HQRA 5LU8A 4DUPA 1D4FA 2AEMA 3DAFA 3FYUA 1HT1E 1Z4MA 2IP1A 4IHJA 3L6BA 3F7NA 1ZIOA 4RQTA 3ENNA 3C14C 1MJNA 3T1YB 4NCNA 4D8UA 1TNDA 5B5SA 1P5RA 1H0HA 4W1QA 1B93A 2FUG1 2I0FA 2PH1A 2G9RA 4GI2A 4ZZIA 3IQWA 4XCQA 3ZWOA 4Y1RA 3KQSA 3LVRE 5HBGA 2JD1A 3JQFA 4CGYA 1BZYA 2XTAA 5BUCA 4L5YA 1O87A 1OWLA 5NULA 3NHUA 4A4DA 1T2NA 1E3TA 1OGIA 1V8ZA 5LXTF 2EXXA 1CVIA 1X9IA 1SCJA 1Z33A 4KO1S 4MRRA 1G20B 1RHKA 5F76A 3O8CA 3KPUA 3HYRA 1PUJA 1UXGA 4KAFA 4R9SA 2QPTA 3OZTA 4RVDA 2XBLA 4TWBA 2ZDQA 3AR4A 1O4VA 1JEQA 2QE6A 5JD4A 2EKQA 2XWSA 2GEUA 4EA6A 3B2EA 4JV5B 1Q1EA 2VJPA 5GJWC 1Z13A 3K1YA 3DONA 4MW7A 4OXYA 3PI6A 2RNNA 3RRBA 3T3GA 5KMGB 5KYYB 4NCBA 3ANYB 3AESA 4WFJA 4KG7A 2JJ1D 4LZOA 3VDNB 3D4IA 1ADFA 3BX1A 3HO6A 3ZVLA 2UZAA 1DADA 2G4LA 3L1VA 5JDIC 3U1BA 1D09A 1XNGA 1I9CA 1U9CA 3U1TA 3T1HB 3GNSA 4JXXA 2UYCA 1XU9A 2FMTA 1M2KA 1E2EA 2VF7A 2ZXEA 3QF4A 2EKPA 1UIRA 3HDVA 1D07A 1GPYA 2JASA 2RH8A 4JOCA 4X44A 3TW8B 1SK9A 2HNBA 3FVWA 4FLFA 2M1ZA 3CUVA 5BV7A 4WNYA 3I6YA 1HFWA 1N0UA 1ZC3A 1HEYA 1JLMA 2C99A 2YIDA 3NWOA 4GL4A 3CX7A 1TT5A 2C7BA 4NZ9A 3CLSD 1YRQA 2B94A 5JO0A 1VCOA 2VHJA 3ZLBA 4ZZ0A 3A8TA 4WH0A 2D62A 4RPIA 2C3PA 2IYAA 4E2FA 5E6SA 4LTNA 1JHAA 4OMDA 4ALJA 4DCCA 1DAKA 5TVKA 3EARA 1C0IA 3LOPA 5AOCA 1KFJB 1IWBB 1LSSA 4HG2A 3STVA 2ZLBA 3VKWA 2CCKA 3HU3A 5CJPA 4HPXB 2ES4A 2RHOA 4BAGA 4C87A 1IBSA 2OVFA 3BSYA 1GPWB 2Y8EA 2AMLA 4PYRA 4RXUA 2IX9A 3M6VA 3T5DA 3R5HA 4RM3A 3TNJA 4A92A 5FRDA 3Q88A 4QTTB 3BWEA 3EC7A 3L41A 1SOVA 3D0RA 1J39A 2IYXA 3JYPA 4R3UC 1PCXA 3LUGA 2BEKA 2BFBB 2FSPA 3ISTA 3BJMA 3I0NA 3PD1A 5TQ0A 3RV4A 3FCEA 4E5KA 5IC5A 4BPRA 5JQGB 2GZ2A 4IDEA 3PUXA 1AKYA 3VKHA 4E14A 1DC5A 2EJBA 2IEAA 3GB9A 3NXSA 4BIMA 4MVJI 2R11A 4RY9A 3UUEA 3EGCA 3HHPA 3CNHA 5CNKA 4YRTA 1E3QA 1AKTA 5IVDA 3O31A 4HAWA 2Z3ZA 2JGDA 4Q12A 3TQHA 3UF0A 4ZVOA 1D4ZA 3E9RA 3ZWNA 2IPMA 2TS1A 1HLFA 3VZQA 1VSTA 4LTDA 821PA 1P7YA 4X3PA 4NENA 2EJWA 2V7PA 1X15A 3PT9A 3NIFB 1NATA 1U9IA 3H9GA 3KYBA 4JMLA 1WD5A 1V47A 3NOXA 2UKDA 2MMCA 4ZDIA 3CGWA 4PQEA 1LQUA 3TR5A 2O0KA 2KPOA 3P9XA 1KPGA 2QB5A 1K88A 4B31A 1B0PA 5KVSA 3USZA 1PGQA 1OFTA 2SBTA 1CQJA 2OXIA 3TSYA 2F8SA 1KC3A 1MAWA 2C9DA 3E0XA 2J09A 4RYLA 4XVCA 5JFGA 4YIHA 1CC1S 4TUYF 4K9OA 1YDHA 4DXAA 2WTUA 1RACA 1AHNA 1CTQA 1I9GA 3KQKA 5LQNA 5LQRA 3NC1C 3FLGA 4MARA 2E3JA 1A50B 1KE2A 3VPDA 3O47A 2HJSA 1JAIA 3D6HA 1TO2E 4JVLA 1WKCA 2VFAA 3K6RA 1E4EB 3KU4A 3B3QA 5HXAA 3EGDA 3LDGA 2Y1KA 5B1HA 2XIQA 1JKJB 2XMPA 3GDOA 4BV3A 4D0GA 2R86A 1ZITA 3M3DA 3PPYA 3WLFA 1U80A 2UXBB 2G0AA 1KYZA 4AECA 2Q62A 1ORVA 1DAMA 2XB9A 3ABOB 1A9PA 3D6NB 3OU7A 2ID7A 4HFMA 4FSDA 4P0TA 5ARCA 5FD8A 3TRHA 4QLOA 1ECJA 4US2R 1QK3A 1ZM3A 3OPYI 5LZ9A 5BPHA 3S3TA 5CJ2A 2E82A 3T0GA 7GPBA 4R7TA 2VQ6A 1MOPA 1I0LA 1NW6A 1RAAA 2JAWA 3GGSA 5I51A 4OJQA 4LRTB 4KVGA 4IOJA 3QP9A 4JBGA 3I61A 4E5PA 5KTNA 3VMFA 2Q3JA 5E4JA 1YZ3A 4FFLA 3T06B 1TUEA 2P67A 1T36A 4MV3A 5DLDA 2R6ZA 2I2DA 1G21E 3PSAA 4XQEA 3T41A 1R00A 4BKUA 5EZQA 1A8QA 1G63A 1ZH2A 1RWQA 1LX6A 4JOSA 5HCUA 2QN8A 5KYWA 1CVLA 1RPJA 1DHRA 4Y2JA 1UK7A 2Z83A 3R6GA 5J4VA 4ZQEA 3AERB 4OV6B 1BXZA 2OBXA 2HLNA 1P0MA 3M0EA 2ZIXB 1R27A 1RC0A 4MLPA 5TQVA 3WFIA 4B33A 2FKNA 1LPSA 4MDEA 2AHRA 2ZDGA 3C3KA 5I7SA 2CK3D 2OBBA 3FCAA 1YCFA 4AD8A 4GF5A 4LZZA 2CXNA 4H16A 4Z7OB 1OZHA 3LT2A 4JVSB 3K9BA 1JG2A 5T8KC 3UOGA 1BDBA 1QRRA 3NEPX 4UFOA 2CJFA 5FUMA 5KX5A 4AJ2A 5FLKA 4I9FA 4Z4QA 5CDUA 4ZTZB 5E9JA 2BTOA 3TRJA 4GX0A 1KHCA 1F14A 2IUUA 1BJKA 4YYEA 1VPEA 4JHXA 4KACA 3NVMB 1Y7TA 3WGNA 1VI2A 3N2KB 2Q2NA 4BNVA 3W5BA 1QTQA 2H4FA 1RAHA 4RFSA 2IEZA 3UWPA 5AM4A 4RZSA 4QTZA 2Z9CA 1GFWA 1M7HA 1Z0FA 3DXXA 3K0FB 4HPWA 1JVNA 4IFTA 3SIPA 2A1TS 4MULA 4TKLA 1I2ZA 2ZJ8A 4BNNA 5IBCA 2R62A 2YVLA 3Q0TA 4ND8B 1FW8A 1TA4A 3DV0B 4OX9Y 2XTMA 4GUDA 2P4HX 4NJOA 4CV3A 3P1JA 1A98A 5FYDA 3UUGA 2SKEA 4L16A 1W5EA 4PYOA 3RODA 4RLQA 1PE0A 3IAS6 1ZLXA 5CVTA 2FQXA 3DL2A 3WQSB 5A4KA 3D7KA 3BXOA 2Q0XA 5J43A 3V8EA 3U4CA 3G5AA 4P98A 3GA5A 4XW2A 4DTCA 3ED1A 1GR0A 1W0JA 2XUOA 4W5JA 5FPKA 3EUWA 5LQMA 4JJAA 1SXJA 2Z6UA 4CHTA 3AI1A 3ILYA 2DT5A 3GRAA 1SQFA 4YCSA 4PIVA 3LFUA 3EZYA 1I4WA 5K3FB 2Y05A 4DJDC 3IDAA 2O9JA 4RKWA 4NVRA 4WCFB 1U2ZA 1WHTB 1WETA 3HADA 3DWEX 1KJ8A 1O2DA 3L8HA 4HSGA 1C3XA 3Q7SA 5LMZA 5ALVA 1SVUA 1L4NA 1RAIA 2GM5A 2NZ2A 1KPIA 3O3NB 2DWPA 3R76A 1QMPA 3PJFA 2WA2A 2XXBA 3PC2A 4IP0A 2CXRA 4MB0A 4MQ4A 4RA9A 1B8NA 1GDHA 1U94A 4WA8A 1PJSA 4WACA 4OHUA 5TPZD 4DB4A 5AK4A 3RWMB 1R0ZA 5CITA 1OXTA 1W73A 1JLLB 2N46A 4O4HF 2NZJA 4YFVA 4CLRB 1THZA 3C70A 4Z4GA 2HPAA 2I7XA 3ONWA 4MGEA 1CYEA 4OYLA 4IGIA 1W0KD 2A5GA 1UXJA 1AGXA 1K89A 1QANA 1XQVA 3EEQA 3GRRA 1YSCA 3QX9A 4UCFA 2I03A 3QENA 1T5IA 3R9WA 2ZZKA 2CNDA 1CRQA 1GCOA 2UZ0A 4PLFA 5I9SA 1FSSA 1YO6A 1I3CA 2JJQA 5C32A 2VYCA 3SQWA 5A3VA 4I4TA 4DADA 1PZNA 4WZAB 3DVAA 3N6RA 3R75A 2Y6UA 3N75A 4G41A 5ITSA 2XXJA 3FRHA 3MFQA 2KLBA 4DZZA 1IOVA 4BQFA 3KKQA 1NMXA 3IBCA 4GKJB 3IP3A 4XEHA 1WL8A 2EX4A 3HPRA 3K71B 4LJ6A 1P81A 1W1IA 3C5EA 4CF6A 1YZVA 1SZPA 2X1MA 4JU8A 2C03A 2QJWA 1FVXA 4EG3A 2QPOA 3FDFA 4D9GA 3ZDCA 1OXMA 2HA4A 1G8HA 4H4DA 3PEYA 4Z0TA 1XZGA 1PHPA 4YLYA 5GONB 4H2DA 4M1TA 4QBIA 2HRRA 3SS7X 3Q5EA 1GPUA 2UZ1B 5K0EA 2EARA 3G8CA 3NWPA 2FMUA 3RUDA 3DLIA 3S1AA 5JDIA 2HWWA 1L7MA 1ZN9A 1B6TA 3SNKA 4OMCA 3ZXYA 3UPUA 2VCEA 4D74A 3AU8A 1KJ9A 3DUWA 4J07A 3BFVA 3ZX5A 1J7JA 1JSRA 4ZK2A 3HXMA 5CFNA 4Q18A 3A1WA 3BMCB 3DOCA 1BD3A 1EFKA 4F6RB 5JASA 1DQZA 3MTEA 5L53A 4NF2A 2J5KA 5ECGC 3NASA 1XRPA 1FEZA 4RQAA 3V2GA 4GI5A 3Q9NA 4ZN6A 5JECA 2PMKA 2V6FA 3OZXA 2RC5A 2AQIA 2REXB 5EIBD 4REOA 4B2LA 3WJAA 1GL3A 2GPTA 2EQ5A 2ZBGA 2HQBA 3JTEA 3CN9A 2QTVA 3PF8A 3K9NA 4HNQA 5EWMB 3RK0A 3THWB 3BS4A 4FD3A 2JAQA 3RTCA 5KNDH 2C7VA 3HXKA 1LA2A 3H6GA 3RSLA 2W0MA 3O4GA 4G86A 4HRYA 5CHYA 4AT1A 1GPNA 5DM60 4BO1A 2W6CX 4CIYA 3TGPA 1IK4A 2AF4C 4PX3A 2XTJA 2BKUA 2PSHA 3FNHA 3P71T 4ZTBA 5FXMA 1NXVA 2CHFA 5SICE 4YBRA 1VLZA 3VOBA 3WKCA 3ZW7A 5AVQA 1SUFA 4G6ZA 3HZZA 2Y0CA 1V5WA 5BQFA 1Q95A 2WVGA 1RT9A 1V39A 3U4IA 1WDWB 2FX2A 4D8XA 2JBAA 4D43A 3VKGA 4TT3D 1GAWA 2WJWA 3JVUA 4MQ5A 1MHPA 1SD2A 4X93A 1H9AA 1JQLB 2VPIA 4UTXA 3KEQA 3OJCA 2KSQA 4XDGA 3CEMA 1LBIA 1ZGHA 1DTWA 2J87A 1JQJC 3RROA 4DDTA 5DX8A 5CFLA 4G97A 2XT6A 2H52A 2YJZA 3EQ2A 4LGCA 1N36B 4IWYA 1ICIA 2I65A 8GPBA 1UFRA 4MGIR 1E9DA 1T10A 3SHVA 4F5WA 2J85A 5IC4A 1ZN7A 1Q84A 3FPJA 3GVPA 3H1EA 3JQAB 3CW2A 1ZVVA 2J0UB 2HXYA 3LOQA 4N0PA 3KEGA 1FNDA 4C4TA 1E1QA 2Q9UA 2YWJA 3PWZA 3ZE1B 3V1TC 4C0AC 4LRWA 5DTJA 1PYGA 1CG6A 4MK4A 5T64A 4LJAA 4ABYA 1PD1A 5IUJC 5DYNA 3VR5D 1SKQA 3H1TA 2QNFA 4W9NC 2WY2D 1SULA 3DFZA 1GD1O 3KB1A 4GXNA 2VT7A 4JP5A 4MTCA 2IT1A 3UJ6A 2HPHA 1RJ9A 2EZ8A 2OKGA 1E7MA 1KXJA 4X61A 4LK3A 3ROEA 1GGVA 1QH8B 3E1SA 4QDOA 3CMCO 4F3CA 2G70A 3SX2A 4MDFA 2PLWA 3QVSA 3D4NA 3PXCX 1RKBA 3WB2A 2LWIA 3OIUA 4GP6A 4BUCA 3ZJ5A 1TO1E 4DCOA 3OPYB 1UDWA 2FAXA 3K70D 3AT1A 2HHHB 2BGWA 2CKMA 3PQ6A 5C8DA 2B83A 3KJQA 1OTYA 2OXFA 4BRZA 3LHDA 2X9QA 3AIKA 3B3AA 5I6DA 1YASA 2G7MC 4P1ZA 4EUSA 3C3EA 3TZCA 3DF9A 4GQIA 4D9CA 3HS3A 5JS7A 3ZV5A 5A0TA 1UMCB 4CJXA 4C6HA 2OV6A 2IP2A 3LCMA 4H77A 4YCJA 4DQKA 4ND5A 4GOMD 2ZUVA 3TAXA 4EEKA 2I7TA 4EPXA 4EQ6B 4P3YA 4ZGGA 1N2JA 4Q05A 3BGDA 3GBSA 2D1SA 1IPHA 1JBEA 2HUNA 1LS6A 2Q3HA 2TSYB 3D0KA 3F3YA 4WD3A 5C4GB 2NVUB 5EUBA 1IE3A 2Q3EA 4A7PA 1FSZA 2GD2A 4CL2A 1UWCA 3TSZA 2NM0A 121PA 5IEBA 3OT5A 3OO1A 3H9CA 3IPLA 4NQRA 1DXOA 1R7RA 2V65A 4YBZA 5DOVA 4FNGA 3T1VA 1TL7C 3PU6A 5AK0A 5DNWA 1SUAA 2V1UA 4QTYA 2BKAA 3KSRA 1ZI9A 2E4UA 3OM1A 2VSYA 1R16A 2B0CA 1WUJS 2NZWA 3WKDA 4D8VA 2NU8B 1OXBB 4EO4A 3MS4A 2QHXA 3WL4A 2KVEA 1EUCA 3FCOA 1DVRA 4F9FA 1OLXA 5HUHA 1JEYA 4M22A 3VNAA 3NONA 3QLUA 1KP2A 2F1JA 3KXPA 2YOHA 4F86A 5EIWA 3SR0A 1J07A 1QOZA 3W2IA 3GJSA 4K9DA 5T8KA 2O7SA 3CU5A 4S1VA 4G8BA 4GR4A 4YUYA 4X45A 2X6TA 1N7JA 4RV9A 4XM0A 5CYPA 5ALJA 4ZWNA 2IDKA 2WHQA 1YULA 2HO5A 3SZ3A 3RGWS 3QTTA 1EJ2A 3JZIA 3BCUA 2R8RA 1AT1A 1VIVA 1ONNA 1RRMA 4ILKA 2F1OA 5EJAA 5EZYA 3M6MD 4JP2A 2G1JA 3G0BA 1H6AA 3FPBA 2QORA 5IWCA 3NAGA 2Y1LA 3C3CA 4FN5A 4YRAA 2NU7B 4MWOA 1TU4A 3FCYA 1JHZA 1DG1G 2FOIA 1IXSB 5B37A 5BSHA 3S4YA 4YMVA 3CONA 3MGGA 3WYNA 1P5JA 4XSVA 5KKNB 1RI2A 1Q7CA 3JWPA 3AGQA 3AHCA 4WZAE 2ZRMA 3KVRA 1P2VA 2PPLA 3GYGA 1XT6A 221PA 3AFIA 3OJ0A 3KALA 1L5MA 1E6LA 2O48X 3NETA 4A27A 4KUGA 4R2JA 5CK4A 2CLIB 4MIEA 2R5FA 4IAOA 2IOFK 2VP2A 3TEJA 3HUFA 4EL5A 4FX5A 2M6KA 4C0KA 1AQ6A 4AY5A 4BVAA 5G40A 5BQ3A 4PQRA 4DMUB 1HMYA 2H8KA 4IO1A 4AWXA 4DL9A 1K3FA 4DIEA 1JG7A 3VX3A 4H31A 3H2IA 1CP2A 1KFBB 1JA1A 3HG7A 5AVTA 3TUZC 1KMHA 2JGMA 3A3YA 5IN5A 5I9IA 1FUYB 5A71A 2EL7A 1J1ZA 5AMXA 1G9TA 1FFWA 3E23A 1CQIB 1OLUB 4BB5A 1QIGA 2JVJA 1NRJB 4YRSA 1XPOA 2OZLA 2ZGVA 1YR9A 1QZTA 3VI3B 3H5WA 3OQ6A 3QVOA 2C8VA 5TT1A 2HV8A 2JGAA 3LWBA 2O2XA 2GPYA 2C88A 4HN2A 4QGBA 4NULA 2E55A 1X1BA 3B70A 1ZH4A 5IFLA 4RVFA 3NHBA 1QPBA 3WGTA 4Q24A 3D3WA 2H4XA 1KXZA 2MYNA 2O2CA 1UBGA 1A77A 3QRWA 4M49A 1YUNA 2EBFX 5KDOA 4KVAA 1NNSA 721PA 2QRQA 3KKNA 5CK5A 3VTAA 1T0UA 1WLYA 2BI8A 2XBMA 1U4OA 4W1PA 1U3GA 3AIIA 3KZKA 3G5LA 3NTUA 1X3LA 4MVJE 4QYIA 3E8MA 2BJVA 2GWHA 1IC6A 2WB4A 2G28A 5KSPA 1PKXA 2V58A 2JL1A 4HJXA 4HFRA 2QXYA 1IQRA 5D51S 3CQ9A 3MWFA 1RKUA 2ECOA 4FYJA 1QQ6A 1J42A 4ZVPA 1TF7A 1VB5A 4JXKA 1N9GB 3R7NA 1QFSA 1C7ZA 3M70A 2CKDA 5AUNB 4L75A 4E3WA 1Q0PA 1YTLA 4C6RA 4MR9B 1V6AA 1XUOA 5FFMA 2NYUA 1GFZA 2FSHA 2H6EA 4LKOA 1M76A 3KL2A 5JCJD 1EZ1A 3G0HA 4ASUD 2WU4A 1L1FA 4OSOA 2FWIA 5I3CA 2AI1A 2P4EA 2H2HA 1Y42X 5J1SB 4N7MA 1PJ8A 1AK9A 1UQTA 3GZ4A 3DGFC 3MOGA 5EPEA 2XKKA 1KZ1A 1LRJA 1GY8A 1IHPA 1REQA 2H9AA 3S29A 5A9RA 4GRDA 2RGDA 4P5PA 3VR4H 2RK3A 1VPTA 2DBVO 3DFUA 2Q7DA 1YJCA 3U7GA 3F3MA 3AJ8A 4M1SA 3KB8A 4WY5A 2WU8A 1EDDA 1V11A 3CR8A 3T4EA 4B45A 1XL1A 4S1NA 5JBNA 3GUUA 4ESHA 4DLSA 3UXMA 4X8OA 3F5MA 1ETHA 2IX3A 2AIRA 4J3FA 1FRQA 1RWXA 4I6EA 1H2YA 1OWPA 4K26A 1SCDA 3GJ5A 4NCXA 3WNQA 3LF2A 3T9FA 5K01A 4D0SA 4HWKA 3P9CA 3VC2A 4F92B 1R6VA 1KQFA 1OE0A 1EHIA 2OZPA 3AM5A 3JQDA 3IH5A 4WBXC 3P2EA 3RYHB 4DHEA 4AB1A 1EHYA 4AIRA 4D42A 3WB9A 5K8LA 5FPHA 1RC1A 1P7ZA 2HDHA 5LLSA 4YC7A 4AU1A 5ALZA 2EJUA 4P33A 2GZMA 4ND6A 4V0KA 1F0PA 3ANXA 3DE0X 4CI0B 2IEIA 1FTSA 1Q1BA 2V6IA 2XCOA 3HNPA 3IAS1 2O6LA 3G8BA 4EUKA 1QR2A 2QM7A 4FQ5A 4PN7A 4RGQA 1R0CA 1DLJA 1GA1A 2I66A 1VMKA 2Q6LA 3JD3A 4GOLD 1E59A 4H1HA 4Q3OA 6REQA 2HZBA 4QLAA 1K6JA 2Y1OA 4HUQA 3ZC3A 3TSWA 3LFHA 1N1EA 1Y3IA 3PHHA 4F9GA 2VP3A 2Q99A 1DWQA 2RKOA 3PEVA 4ZZ1A 4OMFG 3MQ4A 5AESA 1SGWA 3OO0A 2AG5A 2Y2UA 4XFDA 4HNUA 3RDPA 1FXWA 1LZLA 4LBYA 1ECCA 5JOQA 1P9LA 1M1ZA 4O4JB 2ZVJA 3D64A 4KAAA 3W1VA 4D92A 3EGXA 5CLIA 4MVJH 1SA0B 5DU2A 3L1KA 3IMEA 1JFFA 5AW3A 2F3RA 4ZIRB 3T7RA 4KE7A 3G59A 4YREA 3C5CA 3H04A 1UP4A 4OGFA 2JI8A 2CUZA 4BO6A 3PJGA 1SUWA 2X8JA 3GK3A 5DLEA 1SFRA 3ZI7A 2QI9C 2YUTA 4WFIA 5FA8A 2P6RA 3T5GA 3G82C 1SZCA 4LNUB 1P91A 3RF7A 5JD6A 2I7VA 1XO1A 2CBZA 3D81A 1C1YA 5IZ4A 3P2YA 3SG0A 3FHJA 4IDHA 1E2NA 5JZ9A 1XKTA 2H65A 1M2OB 2PGAA 3SXUB 3S40A 2CJXA 2IH4A 1RBQA 3H84A 1NXPA 1T91A 1V2HE 3I3SR 4WXPA 2I62A 4CV1A 2QSUA 2YY6A 3ZCPA 1TLLA 1TVMA 2KS6A 3QYAA 1O97D 5EXTA 1NMEA 2G1KA 4MPJA 2ZAIA 4QPPA 2PJDA 1Q77A 5EYPA 3KUUA 1N2OA 4H4EA 1USWA 1WTAA 4JB3A 4LZPA 4DA9A 3D8BA 2X4LA 1LNZA 4KO8A 4EZEA 1GAQA 1QYCA 2G4VA 5LM3A 1J99A 1NVMB 1Q6ZA 3P5BA 4C21A 5LKAA 2PSJA 3AHHA 3NBUA 4P35A 4C1BA 4CRWB 1G64A 1YHNA 2WDZA 2GHIA 2LD4A 4XIGS 3AHFA 3E3AA 4URHA 1T2EA 3MLBA 1BSVA 3UAXA 3FWKA 4FFBA 1DEAA 3WIVA 4KR6A 1MX3A 2R6CA 3L46A 4V0LA 3NOOA 3AUSA 4OTZA 2XA9A 3NDBB 1MV5A 3OP4A 2HADA 1VZ2A 3CZ4A 4IRMA 4DJFC 2GH1A 5IN4A 1ZHOA 3BFXA 4JHLA 4RD3A 2Q1TA 2FFBA 4QVIA 4TX1A 5I47A 2CNWA 2QRLA 1U4NA 1QAMA 1CJCA 2V6MA 4G07A 3FFXA 3FH0A 1XFDA 1VI6A 3O0TA 2DMRA 3AY0A 4G0NA 4BO5A 5EP2A 4G9BA 3QBEA 2PKQO 4WGGA 3R7DA 4EW6A 4CEHB 4EZIA 4DQVA 3PQDA 1MQSA 4Z49A 1K06A 2JI7A 2BFCB 5H9VA 3B13B 2O2ZA 1C3OA 4E31A 1ZBHA 4GX5A 4XSGA 2QRHA 4EA8A 2BMVA 1OT5A 1AN0A 1OIWA 1PQ4A 1SB9A 2JGJA 2BZSA 1NVDA 1RSZA 3K9CA 4OQPA 3I2JA 3OOYA 5FNVF 1Z5PA 1NJ5A 2HB6A 1KMNA 1P5ZB 4F2HA 1BXGB 1Y3BE 4NK5A 4TMKA 2XE8A 2OILA 2H3HA 4JB8A 5HS6A 4WESB 4IDCA 1YR7A 3GLQA 4BJ5A 2P40A 1WDMA 3IOMA 4QYMA 2QE7A 5BNZA 1V3UA 1EK2A 1KK3A 3PLRA 5L6MB 2X77A 1DG3A 2QTRA 1R18A 3C8MA 3OKCA 5TEVA 4H7KA 4GDMA 2RI6A 2ZYDA 2CCJA 4OGKA 5TVGA 2MYPA 3OM9A 3RS9A 5IHPA 3QX3A 1WCXA 3KZVA 1GZHB 2B36A 1Y4DE 1Y4SA 3C4JA 4I1PA 1XK6A 1ZD5A 3A25A 4W6ZA 2ISCA 2XZTA 4HQ6A 2FQWA 4ZEVA 1YDFA 4Y2RA 4TWRA 5A5DA 2DFPA