1ZS9A

Crystal structure of human enolase-phosphatase e1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
254
structure length
253
Chain Sequence
LSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-1 ENZYME
publication title Crystal Structure of Human E1 Enzyme and its Complex with a Substrate Analog Reveals the Mechanism of its Phosphatase/Enolase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 253
sequence length 254
ec nomenclature ec 3.1.3.77: Acireductone synthase.
pdb deposition date 2005-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.60 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1zs9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zs9A01
1PW5A 3GYGA 2B8EA 2EAUA 1L8OA 5AKZA 3ZI4A 2AGVA 3WK8A 3QGMA 4OCZA 4BNDB 5ALQA 4C4RA 1WVIA 3I28A 2PKEA 2FPSA 3ZWDA 2R8ZA 3WK6A 3QX7A 3A1EA 1YMQA 3QNMA 4ZEXA 1RMQA 5AKIA 3WGUA 2WHEA 2YMPA 4FE3A 2HHLA 2RARA 3AR2A 5A3SA 2GMWA 2YN4A 4L6CA 1U7OA 3FPBA 3R09A 5AI0A 3ZW7A 1LVHA 1NNLA 3U7HB 1XPJA 1EK2A 2P69A 4I9GA 2YFYA 1U7PA 3QYPA 3SF0A 4YCLA 5FP0A 5ALSA 4UW9A 1X42A 5ALEA 3BA6A 5ALJA 2G1AA 2HDOA 3E8MA 3L0YA 4EELA 5AVTA 2QYHA 2BDUA 2O2XA 3QUQA 4KNVA 4Y2TA 3U26A 3RF6A 4Y2UA 3WKBA 3E81A 4ZEWA 2JAWA 4QJBA 3UMCA 4UU1A 4BNDA 3QU2A 3RFUA 4BX0A 4NWIA 4F72A 3EF0A 3OCZA 3AR9A 3L8GA 2FEAA 4OHFA 5AW1A 3WKEA 5AKHA 1TJ4A 1Z5GA 2FI1A 2I7DA 1RQLA 1RRCA 4Y2PA 3J7TA 3DV9A 3WK9A 5AICA 5AW7A 3IB6A 1T9ZA 3AR6A 3WKCA 2R8YA 1YJ5A 5ALLA 1QQ7A 3FM9A 2ZXEA 5AKKA 3FZQA 5ALWA 3AR5A 1N9KA 4OFZA 4YIKA 1ZD2P 5AM1A 1J97A 1MH9A 2G08A 5JJBA 4GXTA 3SKXA 2VKQA 4KX3A 4ZEVA 3NUQA 4YH1A 3EPRA 2OBBA 5IT4A 1Z4PX 4Y2VA 3OCWA 1XVIA 1RKUA 4C4TA 2HOQA 3ZVNA 1Z5UA 4Y2RA 1NF2A 3WKDA 3NASA 3B9RA 1Z88A 4YCNA 1RKQA 1ZS9A 3WGVA 1EK1A 4YIHA 5IS2A 5AKEA 1L7PA 4IG4A 3PCTA 1Z4OA 2I33A 2P27A 2RAVA 5ALPA 2B82A 3K1ZA 3TLMA 1O03A 5AI8A 2R8EA 3OTQA 5E0OA 1U2TA 3OCYA 4E88A 5AKXA 5AKLA 3MC1A 1RKVA 2OA0A 5ALDA 2B1QA 3KZXA 3N28A 4HAIA 4OD0A 2FPUA 2DQSA 2P11A 3SLRA 1T5SA 4JB3A 3SHQA 2I34A 4HYTA 3B8EA 2G07A 5AK5A 3N5KA 3DNPA 2JAOA 2W4MA 4NV0A 5AKJA 2PQ0A 3NALA 4HGNA 5ALVA 3M1YA 3QUBA 5ALXA 2ZG6A 2B8JA 4YCMA 2WF6A 4BKMA 5AESA 3E58A 3PDWA 3ED5A 2NO4A 2NYVA 4UU0A 5ALUA 4EX7A 3W5CA 1VJ5A 4NFLA 4Y2JA 2BY4A 2AUTA 3N1UA 1Y8AA 1ZRNA 2WM8A 3KDPA 3A1CA 3L8EA 3ESQA 3HLTA 5AK4A 4FYPA 3SKYA 4AP9A 4EEKA 5AIBA 5AVUA 3A1DA 3ZTWA 3QXGA 5AW3A 3UM9A 4BYGA 3PGLA 1ZRMA 5ALTA 3ZTYA 3KD3A 4Y2YA 3ONNA 2RB5A 2EATA 5AVQA 4BEWA 1QQ5A 1RMYA 4AS3A 1XP5A 2P9JA 2Q4RA 3QU9A 4Y2XA 2I6XA 2O9JA 2HI0A 5AM0A 3KBBA 1J8DA 2CFRA 2JGAA 5AW0A 2FPRA 2I55A 1U2SA 5AVZA 3L1UA 4RETA 5AVYA 4XOUA 2FUCA 3NAMA 4XPZA 2W43A 3QU7A 5AKGA 3L8FA 5ALHA 1K1EA 2CFSA 3OCVA 3U7FB 4KX5A 4G9BA 2FPXA 3F9RA 3FPSA 3AR8A 2ZOSA 5ALNA 5A3QA 3L7YA 2Q4TA 3N8GA 4JDPA 1TA0A 5AVVA 1ZD5A 2HO4A 2ODAA 3MPOA 3ZUPA 4HGRA 5AK6A 1CQZA 1Z4LA 1FEZA 4HGQA 2MU1A 4UM7A 1Q91A 1RPZA 2EARA 2IOFK 5AI9A 3I6BA 1WR8A 4UASA 2HEGA 5AVRA 2FDRA 4UAVA 2YMQA 2HSZA 3I1YA 5AI5A 2B0CA 1WZCA 2FPWA 2YY6A 4IFTA 5ALFA 2YJ3A 2WF7A 4I9FA 1JUDA 3WK7A 2YJ4A 5AW5A 1O08A 3L8HA 1TE2A 3I76A 5AK3A 2GHTA 2HX1A 4Y3UA 5AI4A 1Z4JA 2C4NA 3HYCA 4CE6A 5AM3A 3QLEA 4FFDA 2ZBGA 1YS9A 5AI6A 2YJ5A 3NRJA 1TJ3A 3R9KA 3R4CA 1RDFA 2QLTA 1IWOA 5AVSA 1LTQA 5AM4A 1NRWA 2WFAA 4KYTA 1ZD3A 3W5BA 3ZVMA 4YGYA 3UMBA 1N8NA 2GO7A 2G09A 1YNSA 3L0BA 4G63A 3L1VA 3QU5A 3DDHA 5ALKA 1ZD4A 2C9MA 4EZEA 5ALZA 2WF9A 3ZX5A 2OYCA 2C8LA 3QUCA 5AIAA 4AS2A 4UMVA 1CR6A 2MSNA 4BBJA 5AW9A 5A3RA 2PR7A 3ET5A 3FVVA 2IOHA 4UMEA 2JAUA 2W11A 4H1WA 5ALMA 1Z4IA 1L8LA 2AMYA 2JARA 3CZ4A 3EF1A 1WPGA 1QH9A 5AVWA 4UATA 1RC8A 1ZJJA 3MMZA 4O8CA 4L6AA 3PGVA 1L7OA 1VJRA 4CNQA 3D6JA 4MWOA 3NANA 3UMGA 2GFHA 2HF2A 3EWIA 1QQ6A 3E84A 1F5SA 3ESRA 4L57A 5AW2A 5AHXA 1SU4A 2ZBFA 3KOOA 2WF8A 4QQFA 2HF7A 1KYTA 1RQNA 4HGPA 5ALRA 3W5DA 5AKYA 2G80A 1L6RA 5T41A 2YMLA 4KNWA 1TJ5A 2X4DA 3CNHA 3QU4A 3M9LA 4UARA 3ZX4A 2CFTA 3WKAA 4EENA 1YDFA 5AM5A 3VAYA 3BWVA 4DW8A 1YV9A 4UMDA 1ZOLA 3ZU6A 2YJ6A 3N07A 1SWVA 3U7EB 4Y2QA 2G0AA 3FGOA 3SMVA 2B30A 2RBKA 2YMMA 5AM2A 4PNHA 4CF4A 2OM6A 3WK4A 3WK5A 3ET4A 3AR3A 3OCXA 2WF5A 3OCUA 5ALGA 1Z4KA 3KC2A 3L0CA 1QYIA 2B1RA 1Q92A 4DFDA 2GHQA 2ZBEA 5AW8A 2ZBDA 5AW4A 1AQ6A 4UM5A 5IT0A 1S2OA 2NO5A 3L5KA 4UMFA 4MUMA 4NAVA 4DWOA 3S6JA 2C88A 4CF3A 1L7MA 3SD7A 4XQ0A 1VFPA 3NIWA 5ALYA 2I54A 3U13A 4BX2A 3IJ5A 5ALOA 4UAUA 1S8OA 2IYEA 4B6JA 4HGOA 4DCCA 4C4SA 5ALIA 2AH5A 1Z4NA 2G06A 4KN8A 5AW6A 1RMTA 3ZWKA 2IA5A 3B9BA 3ZVLA 1U02A 2HCFA 1SWWA 3AR7A 2C8KA 3AR4A 3W5AA 4F71A 1RLOA 1Z4QA 3A3YA 1Z4MA 2R8XA 2CN1A 3DAOA 2D2VA 1RLTA 3P96A 4NABA 4BEVA 5AVXA 4J2TA 4EX6A 3OPXA 2IOFA 2BDEA 2FUEA 4XE5A 4RESA 4Y2SA 3QUTA 1L7NA 3MN1A 4GIBA 3U19A 2YBDA 1T5TA 2Q5EA 4BX3A 3U7GA 3IRUA 4CF5A 4J03A 1RLMA
chains in the Genus database with same CATH superfamily
1UL1X 4LI3X 1L8OA 4U00A 4HNVA 1SM4A 4DLKA 2AGVA 1DC4A 2OESA 4WKNA 2A35A 5ALQA 3WLOA 4ZHSA 3ZY5A 2WU4A 4RK0A 1N32B 2AD1A 1V25A 3KOMA 2JZNA 2VDKB 1AQJA 2CL5A 4FYIA 3QXSA 1ZM2A 3ORFA 4JSRA 5IKMA 5IU6A 4X9XA 3A1EA 3G8YA 1T2EA 2RGYA 3D31A 3GB9A 4MR7B 4RF3A 2H1SA 3DHEA 5GMOA 1YQXA 2QE7D 4REMA 2BH2A 4NZMA 4DAEA 5LR6A 2HHLA 1QHIA 1AQIA 2PKYX 3F98A 4DBLC 3GLIE 3ZWNA 4DUPA 2C2YA 4J3JA 4EM6A 2CK3A 2J9XB 3N9IA 1FMLA 1KY2A 1LBEA 4J0CA 2F1KA 3FPBA 2FTKE 2NACA 2JHFA 2XTZA 4DIUA 3Q8KA 4ENRA 1A5AB 1OT3A 2UVQA 2Y77A 3JD3A 3OPNA 4O2BA 3EPLA 2A92A 3NW9A 3SZLA 3PNOA 1UM9B 3LXMA 3NGMA 1MB3A 2J07A 1CR2A 1ONPA 1JDZA 3AB8A 3V97A 1G5TA 1TB4A 2X19A 1IE3A 3JAKB 3D43A 3OPMA 2O2ZA 1XC7A 3PC8A 2JVWA 4RXMA 3PQDA 3E8MA 2DQYA 1H2HA 2F1JA 2NSHA 1QZTA 2E5LB 1X8LA 2OFXA 3JQ7A 3BERA 1GQRA 4ZD6A 2DM6A 3UHAA 1VG9B 4F6RB 4URZR 3WKBA 1Z13A 4H08A 4Y2UA 4DQKA 3DFKA 1LI4A 1H65A 5EEHA 2QRPA 3UMCA 3KB1A 4PC2A 1ORWA 1J99A 2WHQA 1PK9A 3ZI0A 4L28A 4P4UA 2ZM5A 3RBAA 4MUIA 1N7JA 3SE0A 4HEA1 1JBEA 3TBFA 3X1WA 4EKDA 1G66A 3W9UA 3WKEA 4CMGA 4HSEA 1F2UA 2ZJ0A 1JU9A 4Q4AA 4RHUA 1VGQA 3FN4A 3K0AB 1T9KA 2PZLA 4KJXA 4U0KA 4L5JA 4V0LA 2CHGA 2DETA 1WBJB 1WXIA 4YYEA 2EZ8A 4EGSA 2GPYA 5CFMA 3W2FA 2YINC 2UUPA 3BWEA 2YZ2A 2FSSA 4LSWA 5CUQA 2YRFA 2Z2XA 4QPDA 3N2YA 3R0IA 1IRXA 5T4EA 4BLOA 2WWFA 5A6SA 2OSVA 2P41A 3PC4A 3PA8A 4CTJA 2GAJA 4D9IA 4G5SA 3ZC3A 4Q00A 1KAQA 3WQBA 3S2IA 4W5JA 3HQ4O 2OCAA 4E22A 5LDDC 3BXGA 2AZXA 1V37A 3KFLA 4YIKA 1FYDA 3I53A 4ZO8A 1MXHA 3GNLA 5ARBA 4JYZA 3TK1A 4BCCA 1GIAA 3C3WA 1KY4A 1P1CA 4ZJUA 1VHJA 3KOZA 1JJAA 2W6ZA 2A0KA 3EPRA 1V8ZA 3FSJX 2YWEA 3BVPA 5IT4A 4OX9Y 3CR8A 3LWBA 2BTEA 1Q77A 3ACCA 3AJ8A 3ER9A 4D8WA 3GEDA 5L3SA 1IJBA 5CPBA 1QBKC 4PG5A 2P68A 4U2GA 4Y2RA 4P31A 1NF2A 3RSGA 1EJ2A 1KOJA 2DWQA 3DAHA 1Z88A 4LZAA 2H2GA 4MPRA 4CG3A 1OB5A 5JAOA 3O03A 3EXFB 2B2XA 1AA9A 3KZKA 3EC2A 2NVWA 3L7BA 1E0JA 2ZT8A 1SU7A 1PF7E 2LP4Y 1GPDG 5CXSA 2IWHA 3U2QA 2G63A 2AYYA 1Z74A 2DFLA 2XDQB 1FFBA 1GGVA 4YFVA 5EQTA 3B3QA 5F1PA 3FLMA 2OHOA 4KO4S 4R7GA 4JI8B 1CUIA 2OM2A 1R3UA 3A1SA 3NDRA 1D2HA 5KYGA 1JMVA 1K4KA 1F8FA 2H5IA 2X0IA 3TLGB 2R8EA 1AHIA 1SCAA 3FUTA 3GN2A 3KDAA 5EHXA 1H8EA 1RQGA 4MGKR 1XZDA 2FKNA 2B99A 3KQLA 4TUYB 4HDRA 2VP4A 1Z0AA 2D1SA 2G9VA 3F3KA 2VZ9A 1G21E 4LXYA 1T9GR 2DKFA 5DGHA 4CFSA 4YYZA 4KNYA 1I8TA 4OD0A 3VC7A 1T6ZA 2X6TA 2Y05A 4HQ6A 2B25A 3C39A 4NU5A 4YMIA 1RRFA 2ATVA 2V7VA 1KVTA 4MP3A 2OGUA 1BN6A 4IWXA 2BUCA 2LKDA 2Q2VA 1ICEA 2WSLA 2HK9A 2I34A 3HYRA 3AEUA 1TGYA 3VR2A 5AK5A 3RJTA 3F97A 2HDHA 3FUXA 5CXUA 2P6RA 2Z6UA 4WNAA 5JG7A 3N5KA 5JYEA 2FSGA 5A4KA 2C4HA 1S2NA 3JRWA 5M7EA 1ECGA 1U8YA 2BCEA 3B1YA 1NLYA 1U7DA 4KOEC 1HNZB 4AWAA 2ZRIA 2DBVO 2G72A 4FINA 5IVKA 2G6BA 4R8RA 4C0KA 4Z53A 1BXZA 3ZHVA 2HLDD 4RCYA 3WP1B 1QORA 4XUGB 4AZ0B 4LOIA 4D9GA 3HXQA 1RWQA 2PSFA 5I7UA 2BEKA 2QU8A 1DX9A 5JNUA 3D3QA 2NYVA 1X1RA 1X7YA 3AWDA 4W6ZA 4UHFA 2IYNA 2AZMA 3A4IA 1NQUA 4RMHA 5LQCA 3CRVA 3KQWA 2CDBA 3LOQA 2F90A 4MROA 4Q82A 5LQSA 4BL5A 3QVJA 2QXYA 3R8XA 1Z6QA 1UF9A 4OOEA 4DMRA 1XJWA 3GJSA 4MIOA 4PO1A 4NS4A 3FD8A 4QGBA 5H4HA 3PWKA 1ZXLA 2X8AA 8GPBA 4RW0A 3TOVA 4JKOA 2BVNA 1M8FA 2ZTSA 2GETA 5AK4A 2P2NA 4DG5A 4DDWA 2X5OA 1TW3A 1CW2B 3K9WA 2NN3C 1FFXB 3LOPA 4CDRA 1LBQA 2UZIR 2LV8A 3GEGA 4WUVA 4NOJA 1JSZA 2H57A 2WNHA 2PQ2A 2ZSDA 1RFGE 4S1TA 4MW9A 4C6SA 4Y2YA 2YHUA 2Y0BA 3IQIX 4JMLA 4KUGA 1H22A 4BC1A 4C0LA 1OFUX 2PM8A 1KRXA 2ASEA 1GRVA 3NIBA 1Z7YA 3DPUA 4R5HA 3IKJA 3ZUGA 5K0GA 5HIJA 2O8DA 1GFIA 4E1VA 1CZHA 4COKA 2V1UA 2GX6A 1CB7A 1AHHA 2JFXA 2PZEA 2RAUA 4P7JA 2COUA 3OD5A 5FOVA 4BKQA 3MJDA 4XDZA 1P2FA 1DCMA 1OAKA 3NBFA 3OF3A 4D3DA 2OD2A 3IPXA 2UZ3A 1X3LA 3W5UA 4LXGA 1F2VA 1VKHA 2CDCA 2FRVA 3ZWBA 2FUCA 3RIHA 1YZ3A 5DIFA 5AKGA 5F77A 5BSTA 1UMCA 2V6FA 1KYIA 3KB2A 1WSAA 2WJYA 3GO4A 3H2GA 4BUJA 3OVMA 4G9BA 2VZ8A 1T4GA 2PLAA 3PUKA 2FPXA 4KCGA 4PSDA 4I50B 4B83A 1WU8A 3AEKA 1E94E 3THSA 1IEXA 3DH0A 2W9XA 2JG3A 3SVZA 3N2IA 1DPGA 2AX4A 4B4KA 2XWSA 1US8B 5EKXA 3N05A 2YY7A 5F35A 3ROQA 2B4KA 3OTWA 1Q1EA 2R1VA 2Z56A 1GPBA 2J41A 2BEVB 4ZOQI 4L51A 4UHKA 4FONA 1YTUA 1XRMA 3R3ZA 3DAYA 4PX3A 2WMOB 4M4SA 4Z86A 3SPXA 1R6XA 3VUFA 5JJ5A 3CBQA 4GZ5A 1KXJA 2HEGA 4CKEB 4ZYLA 5CDYA 5AVRA 2ZEJA 1IXYA 2W90A 2OLEA 3CISA 4UAVA 4M49A 5J23A 1WZCA 2XNKA 4CCYA 2YQ5A 1SD2A 1TCCA 5LBTA 2YY6A 1KS2A 4X90A 1KMCA 3QNWA 3MSXA 5K2OA 1J4AA 1BEZA 1L2TA 2PRKA 2VPQA 3I2KA 3KT8A 1JUDA 4DYVA 1BYIA 1U1FA 2FRXA 2I80A 1E2NA 2XECA 4J1NA 5H7XA 3WMEA 2JLUA 4UVEA 3IMEA 3DTVA 4YMTA 4G89A 2ZJ4A 1O08A 3A4VA 1OV4A 3IHLA 1HYQA 1D0SA 2X58A 4ZZ3A 4DV7B 1ENPA 1JA0A 1KMMA 1L5MA 3ELWA 5CVCA 2OL4A 4MX8A 3RFFA 1A04A 4NH4A 4DC9A 1E7LA 1XAGA 1YRQA 5TF4A 1NDHA 4AMUA 1EA7A 2CMDA 2QN2A 1VKOA 3WIVA 3HJGA 1K9SA 3IAS6 5EIAA 1AF7A 1IN7A 2OHVA 5C7LO 4KR6A 4MAMA 3STYA 4EA9A 1F7VA 4ND7A 2F3RA 1P91A 2HXYA 1M2GA 3MBIA 3WBJA 2QLTA 3HB0A 1Q1GA 1AS2A 1C2YA 4UM8B 2YS6A 3GJYA 1ZD3A 2X0DA 5AVJA 1P4SA 5CX4A 4RDXA 3S81A 2OGTA 2YJZA 3UMBA 4QXAA 3TO5A 1MX3A 2I8AA 1U2EA 1PQ4A 4R4JA 4GC9A 2Y1WA 3ACBA 4RSGA 1M2VA 3T7CA 4DARA 3FWPA 2OXFA 3FA2A 4H4CA 1WUYA 1QDEA 2WTNA 2KS6A 4QE3A 1A8IA 3IKVA 2BD0A 3PJRA 5GJBA 2OCKA 1PCXA 3EBPA 4KH1A 5E6SB 1OE0A 1QP4A 5KYTA 4NNOA 3ECAA 4JGIA 1O58A 4Q1EA 2OYCA 4ZOCA 2IUYA 3SAJA 2B8WA 5LZ7A 4ITVA 3EUWA 4AS2A 3QKWA 4HWRA 3SR3A 4H27A 1HKHA 3O1LA 1BE6A 1QHFA 2P1RA 1NXVA 1EZZA 1SGWA 1W88B 5EKDA 3RROA 4LRUA 3B82A 4NECA 4RCVA 3T9CA 1C9NA 3AXSA 3BEOA 4BTEA 1P6UA 4H1WA 4FPXA 121PA 3F7MA 2V98A 1SBYA 1U3DA 1W44A 4LQLA 2XT6A 1V16B 2G6TA 4B1FA 1QRSA 3GJ7A 3GGDA 3LYUA 3N53A 4LOHA 4PLFA 4DGQA 3WLMA 1EPUA 5IDVA 2F55A 2C96A 5FAKA 4YCDA 1ZK2A 4XKJA 1IQPA 4QOGA 3VU1A 1CZOA 3QQ5A 1SZJG 4YRDA 3U80A 1S2IA 5G4KA 1M2KA 5FO0A 1SVMA 1XA4A 4JJGA 5IM4F 4M8KA 2BL4A 1JA1A 1PHRA 2WTEA 3NANA 1CRPA 1OXVA 3TNYA 3SK0A 2HHHB 3LAWA 4EF4A 4FU0A 4RM3A 2E21A 2A88A 3GGOA 2XCRB 4Z0TA 1GN8A 1VSUA 3LPAA 2XITA 2GAIA 4HXFB 3RYFA 1KEEA 4GH5A 5C7OO 1FQKA 1UPCA 1VL8A 1FSSA 2CNLA 4LWOA 3RJ5A 3T7TA 3IUBA 3JASB 3C4JA 3EW7A 3FNRA 2G04A 4GMGA 1QE3A 5DO9A 5JPIA 4F1WA 4CIBA 4QXRA 1EKXA 5HTOA 1TEHA 4LJKA 2G80A 1CKEA 5A9TA 3S2GA 1TA9A 3QE0A 5JS8A 2I76A 3CW9A 4GL4A 1D7OA 4B3BA 4KNWA 2PVSA 4KDEA 1TTTA 2M6KA 1AQNA 1NRJB 3PZRA 1Z0ZA 3JYNA 3RUEA 2CFTA 3CRW1 1HLPA 2G8LA 5EJEA 5K8TA 3NVAA 4DUGA 4YY3B 4OHBA 3B6KA 1K8YB 2QNBA 4NY1A 3IOYA 3ZGLA 4EGCB 1BD4A 2HRRA 1SQFA 2YJ6A 3FOBA 4UHHA 1NM5C 2XYVA 5HKKA 4LDRA 1XCMA 3DMHA 3TVDA 3WMGA 5JZBA 3WA7A 3BMOA 3PRYA 3UB2A 1SVUA 2ZUSA 3VHRA 1YDMA 2QRVB 4C2UA 3QNUA 1LQUA 1DBPA 1L5FA 2IYWA 4G5FA 3GBPA 1A1VA 1V7ZA 3EFOB 2C5SA 3GCZA 4MUXA 1U28C 4QYXA 3CSSA 1N0IA 2WF5A 3OCXA 2AC7A 5HCIA 3WB2A 5D01A 3R5KA 2IH4A 2PAFA 3AFNA 4KQFA 2PBFA 1RWPA 1AMUA 1ZISA 2HNBA 2VHJA 3RRMA 1UOQA 4ZQFA 5E95A 1L4LA 2NQ8A 1NBHA 4LV5B 1XRLA 1H2WA 1P5ZB 3TAUA 4EFNA 1W93A 4BV2A 2AG1A 2BFDB 2W2NA 2ZYWX 1JH8A 2OORA 4PFSA 2AOUB 4JC4A 3S6JA 3FB4A 3DZHA 4Q3NA 2CLOB 3AW8A 1XF9A 1AKNA 2GXUA 2YCBA 4RVDA 2VP5A 2GF0A 1KR2A 1K8RA 1ZAKA 3AUXA 1LNZA 3H1EA 3MJHA 4F7WA 4ID9A 3QOXA 2AEJA 5EJFA 4FDLA 4J0JA 4KGXA 4RGBA 1J7JA 1XCPA 3C5CA 4HGOA 4NZ9A 3RC1A 2JGJA 3E1KA 1J8VA 3W4JA 3OEYA 2BAGA 2EC5A 2C92A 3CX8A 3D4OA 2XCUA 3DT9A 3MWLA 3N58A 4MZXA 4D92A 1ZUNA 3KETA 1NW4A 2VNJA 2B4QA 2I62A 2V0CA 4QBTA 3EZNA 4LJ8A 3WNDA 2IS1A 4D3XA 3PRJA 2HWKA 4UXHA 1JJFA 2OXEA 1SWWA 3ETHA 4B34A 3EDRA 2X5NA 2Z9CA 5DXAA 1U5BA 1Z15A 3IUSA 4LRWA 4XIGS 3NHWA 4BZWA 3M89A 4BNJA 4DR2B 4MJ7A 4AMYA 3UK7A 3ZGYA 1TO6A 2EQBA 1PW7A 4O2BB 5TT0A 3IV7A 3VJLA 4L78A 4X65B 1Q7GA 3CIOA 4KWCA 3MRTA 4L8LA 2ZSIA 1JFLA 1SXJE 1TQ2A 1ZINA 2JDID 3CR3C 3O4VA 4IHQA 3V8RA 4LMPA 1EUDA 2XQJA 3G5MA 4A82A 4QTYA 3Q98A 3EEBA 4C3VA 1LPNA 3NH6A 1RAEA 1XALA 4L0CA 1II0A 4KXNA 1GWNA 4Q7QA 1Z08A 3DE4X 3JQ7B 3JZDA 4BKPA 3WLKX 1G55A 1GQ2A 1PUJA 4LX0A 3TFOA 2E3JA 3DZ8A 5KDOA 4POAA 4D0NA 3D4IA 4FZRA 1P31A 4B3XA 1JG3A 2EAUA 4PZUA 2O7SA 4BGUA 1NRIA 2EIXA 1SR8A 4N6OA 3EGVA 1PT6A 4GKAA 3BFKA 3OFKA 3C6MA 3DL7A 2XVMA 4M9SA 4TTVA 1ZEMA 1GR1A 2H17A 4AUMA 5FX2A 3ND9A 1U8EA 3PTAA 1F2UB 1SC6A 1U0GA 1NW6A 2DCMA 3DC2A 1G8MA 4Q4AB 4ZEXA 5BUCA 5KTSA 1GCAA 3U9SA 3VA7A 5FLXA 1EUQA 4JZKA 1G291 3GVHA 4RLQA 1IBSA 4AP5A 2PUEA 3V7FA 2PGIA 3NXSA 2X3YA 3O3MB 3QOWA 3VPBA 2B3DA 1KQOA 3TKLA 5L3VA 4O02B 4DLLA 4AKSA 3N2KA 2J7PD 3HS3A 2FQ1A 2FE1A 3WGIA 1CR1A 2C94A 4TYPA 3L7AA 3GP8A 1NUSA 3DEJA 3GQVA 4UAJA 1GTJ1 3NCHA 4ENVA 1YHZA 1YZYA 3DKIA 2PS9A 2IZOA 3K9QO 1RS0A 1MO3A 4U2BA 4DQUA 2Y1FA 5EN4A 4YXWD 3DO8A 5I47A 4KXUA 1IMOA 4IQ4A 2CLEB 1GG5A 4LDQA 1RXSA 2NLOA 4PYIA 1M8GA 3OESA 3R77A 5BW6B 3SNHA 5JFGA 1FNMA 2GK3A 4B6PA 3E9MA 3QHAA 1I0LA 2BI8A 1OT5A 1S8NA 4HAVA 4EELA 2O2XA 5L3SB 2QUBA 5DLDA 3A7EA 5CNMA 5J43A 2VJQA 1WMDA 4ZDIA 2FSPA 3D3KA 5JJKA 2JEOA 1RCFA 4IW3B 3JQEA 1M2HA 4L4RA 3RFUA 2G9UA 4HHEA 2UYYA 5J40A 5K8CA 1A4XA 1O0BA 3R6GA 4YQYA 3CA8A 4UNQA 5EKTA 4ZJZA 3SQOA 3MLAA 2RNNA 4PIPA 3VR4H 2IGBA 2PZFA 2CHUA 2DUNA 3RC8A 3NHUA 1B0UA 1SB9A 1C8VB 3D7LA 3H1AA 4Y2PA 2QPTA 1M83A 2VBCA 3KL2A 2V4ZA 2W4IA 4OYHA 2JBAA 4PHFA 2WG2A 3T3EA 4WIAA 1QFYA 2IY9A 2WIKA 3IBGA 3PSHA 3CC8A 1E4OA 3SZRA 4DV6B 1OBFO 5ARCA 1KH3A 3KLPX 2QTHA 1Z0KA 3AY3A 3CONA 4OXKA 1SBQA 1RZRA 1QQ7A 1X1EA 3NAQA 2ENUA 1W2GA 4HDRB 5AKKA 3S2EA 3FNGA 3NHZA 4U2CA 1YGPA 2YY5A 3MTGA 1SZDA 2QORA 3ASZA 3CM0A 3IELA 1SUWA 4OFZA 5JAQA 3EDQA 1L9XA 3EUAA 3LUGA 4E4RA 2CVOA 2V6MA 3SKXA 2VKQA 4AJPA 5CBKA 4KX3A 5A62A 1QIHA 3AYZB 1TT7A 1V47A 3IP8A 1RHMA 3QUSA 3RGGA 1SG0A 1XDBA 2HU5A 1Z5NA 2QS9A 3P7MA 4YRBA 4HNUA 3RVNA 4ZN6A 1BDHA 3AEUB 4CMHA 4Z2YA 3K0CC 3QPUA 3A6GA 3BHMA 4JYPA 4EHLA 4WNAB 1VL2A 4DDMA 3OKPA 2H18A 1VCHA 3GL9A 4L75A 4O4JF 3ZBUA 2A58A 1RKQA 3GJ4A 2EOAA 2KBEA 3HJTA 2HTEA 3H18A 3PHBE 1PD1A 2W2XA 2EJUA 3VZRA 3C1UA 3S7ZA 2TMDA 1HOXA 1A62A 5DIZA 2I33A 1S8AA 2A5LA 1UODA 4MPDA 3CLUD 2GN2A 1RZVA 1QKJA 3BREA 1E6LA 2GR9A 3C8UA 2DEUA 1A77A 2ZJYA 3IQZA 3NHBA 4I46A 1X7YB 3NTUA 5HIKA 4MPJA 3LCUA 1DVRA 1L8XA 1E2EA 2GM9A 4KXYA 5E0OA 4OXXA 1WB9A 3RW9A 2I4LA 1O3YA 3CTPA 3RHSA 1GCIA 4CIDA 4R8VA 4HL6A 4ZOLF 4UPDA 3L8ZA 1NZJA 3PJFA 2R5WA 5T5QA 1BD3A 2QLBA 1WXGA 2AQIA 3RK4A 3MWGA 2CL7X 3IEKA 2FPUA 1QM5A 3MTBA 1C0IA 3PYXA 1W29A 3T3MB 3FNQA 1NT4A 4RENA 1RYEA 4W8GA 4Y1EA 5M29A 2HUPA 4UCFA 3W6PA 1WULS 1MO5A 4IGAA 2OCIA 1UK9A 2RK3A 3L7NA 3O9ZA 3SHQA 5BN5A 3X44A 4D6PA 1WMAA 4FYYA 5B2EA 3H5LA 3RSLA 4AP6A 2QP9X 3O8QA 2ON6A 4HFJA 1B0ZA 4ZEMA 2GVZC 3VRHA 2P62A 2TYSB 3KR0A 4RPJA 1Z2EA 4B46A 5AXBA 2NPFA 3WVNA 1Z34A 3B1FA 1D7AA 3O3CA 4YCMA 2O8DB 1DARA 4RPLA 1HBJA 1E0SA 2NVUA 4RTJA 2DKOA 2AN5A 2BKXA 4PLZA 4A92A 2XB8A 2HRZA 4I1RA 1ULAA 2QRZA 3PDWA 1JEQA 3EQZA 4OJNA 4PQFA 1MA0A 3R20A 3WO1A 1H1DA 5K3EA 3UCXA 1T1RA 2PKQP 3IXLA 1I14A 1D9XA 2OY0A 3NORA 4HGYA 4FFLA 4R5MA 4XD7D 5M3BA 2KQUA 2VK2A 4LGYA 1M6NA 3RS4A 3DC7A 4R9SA 3DHYA 4B7UA 3CRRA 3SCZA 4QFMA 3GFTA 1NPDA 1LLQA 1MGPA 3QKSB 3PQ3A 2B6HA 4V38A 4DIBA 1FOEB 1NX9A 1RRGA 4J9VA 2HA0A 3I9FA 4HH3C 4P7FA 1IQRA 3QG5A 3AEKB 1C7RA 1DRVA 1Y6RA 4NE9A 3ME5A 2HU2A 5BWNA 4TGLA 4XQ9A 1YUBA 2GJ9A 2HJRA 1A7JA 3UN1A 4E94A 1Z75A 3TNLA 2Z0MA 2FX3A 3UM9A 4A8PA 2QIOA 2ET6A 3IB3A 1XAIA 2R1VB 4B76A 5IC5A 3LQFA 1PL0A 3MT0A 1JZSA 3CUVA 3GELA 2GH1A 1E2UA 2I3BA 3C98A 2RB5A 4HYYA 1U1EA 1MQ8B 3QELA 4ZPXA 2CL6X 1GPKA 3RAEC 1GGKA 1B3BA 4FGZA 2JFOA 5TQJA 1H2ZA 2XT9A 2CUTA 1YVPA 3SHOA 4GZ6A 2HHCA 2IV7A 3E5HA 3GPCA 1DEHA 2FMKA 3WXBA 4CCYB 1LKZA 3N2GA 5IM4A 5JASA 4MHTA 4J0DA 4UOQA 1M2FA 1K86A 2VYNA 1VLZA 4ZZ1A 1DKLA 1B8OA 2XYHA 5FI0B 1PS9A 4YP6A 1NBOA 2A5GA 1V4NA 1W4RA 3KM0A 1FF9A 3DR3A 2MMCA 2LTAA 1J8FA 5D5HA 4GR5A 1YULA 3DTVB 4N4AA 3WLHA 1JZQA 2JAQA 1O9GA 2GJ8A 1QP7A 4I6JA 3WADA 3UK6A 6YASA 1PV4A 3MD9A 2VHCA 3KD2A 3UXEA 4Y30A 2EGGA 3PHHA 3FR8A 2IU0A 7MDHA 2PSJA 3QX8A 2OCXA 4BWGA 2CK3D 2ZI7A 3M49A 4JOCA 4ZAGA 1RPTA 3IA2A 4P3OA 2ZZKA 3ZUPA 5U9CA 3Q3CA 1T8RA 1XRRA 5B30A 2GJAA 1CUGA 3G9TA 3Q6IA 4YRFA 1PEKE 1X0VA 2YV5A 5ER9A 3G6WA 1SCKA 1LA2A 1A2OA 2VJOA 2IOFK 4AG6A 1MQAA 1PX2A 2ZLBA 1Z7EA 3I6BA 2PMDA 2NXNA 5EXXA 3SZGA 2PRJA 1Z28A 3ZCVA 4QVGA 4EHDA 2ZRCA 1ESNA 3IS3A 5IDQA 2H4YA 4JB0A 4V24A 1M2VB 2EP8A 2GUGA 2YJNA 3QVUA 1ZLXA 5DNAA 5J4KA 1KIAA 1OLUA 4O5AA 1C2TA 1S01A 3FBTA 1FUUA 1UOEA 2IYLD 3D7NA 4YJFB 3P5BA 3U49A 4QZVA 5ALFA 3OIGA 2WF7A 3GJ8A 3FFBA 4LJ9A 1ZAYA 1LDGA 1T34A 2V6BA 2W0SA 5FBKA 2PX4A 3TUIC 2DUJA 2VJMA 4YGXB 3RT9A 3FPJA 4RTNA 3PXXA 4FWBA 2C0CA 1W581 2XLBA 5IW8A 5AW5A 4AYXA 1ISHA 5AQ1A 4Q7LA 1JE1A 5ECDA 1JNYA 1KVUA 4J2OA 3TRFA 1S9DA 3LXRA 4K26A 2AOWA 3EA0A 4NYMR 3JRNA 1L4KA 2BM1A 3SYRA 2OZLA 3CH6A 4QA9A 1ONNA 4AN4A 3ZDFA 1K8ZB 4NTZA 3H4TA 1TA4A 2TS1A 4RELA 3LT0A 4JENA 2GI4A 5AM3A 5BV1A 3GFQA 3K31A 4AL4A 1AH2A 4RMNA 1D6SA 4PO3X 3VSDA 2NO9A 3RVLA 1W75A 3N3BC 1H9AA 3AL0C 1ZL2A 4OXIA 4QJIA 5G4KB 1Y1TA 5K99A 3LUHA 1IUNA 4J4HA 1C1DA 1ZOOA 3JW8A 4PX2A 4PGFA 4PLYA 1C4KA 1E92A 1H8HD 2J5QA 4QUJA 3T7EA 5JAIA 4FFVA 3AHDA 1N8NA 3EA4A 5L3RA 3U7QB 4F46A 3EIFA 1KEEB 5BN3A 3ZU4A 2A2ZA 2B8NA 3ZH2A 5DBGA 4ALKA 4RK6A 4KHZA 1KDOA 1KGSA 1BKSB 2YV2A 3JWJA 4AG5A 1MPTA 5HQJA 4YLGA 2X0FA 3I04A 3ULKA 4Y6GB 5KTOA 3Q6NA 1JJ7A 1NVVR 3CLTD 4RQBA 5F1KA 1YCGA 1M0WA 2JEYA 4YMUA 3AUJB 4KPGA 3L4JA 4IUCS 4G0VA 4TKUB 3RVPA 1TPZA 1BS1A 3V48A 3MUOA 3I9JA 5A05A 1N2IA 1T2VA 1Z3CA 1BE8A 3CX6A 1CBUA 2O2GA 4TTJA 3H5VA 2VSNA 4ZHQF 5IZCA 2JAUA 3QX3A 4H7EA 4QBHA 1MB4A 2QW1A 3BMOB 3GVIA 2F3SA 4HB3A 2V5VA 2BZSA 1WPGA 3AF4A 1CY1A 4CKBB 3O9VA 3DZKA 1H8ED 5AQEA 5CFQA 1JQJC 3PDHA 3RS5A 5BXYA 1W5AA 3RSQA 2PKCA 3VPHA 2LNDA 1XXLA 3ZBTA 5H82A 2H7VA 2Q2NA 2F8SA 4KFSA 3ONVA 4JL8A 1ULZA 3A9WA 3RS7A 4C4OA 3U3KA 1DHTA 2V4UA 1LJLA 3WGYA 1UKCA 4KG7A 1QQ6A 1RC0A 5G0UA 4NYJR 1FU7A 5CJJA 4FYXA 3SX2A 1T25A 2H51A 2WA1A 3MZ0A 3GGCA 4BLUA 3GT0A 3ER8A 4QGSA 1Y81A 4GHWA 1Q2XA 2DPLA 2RGCA 4DNFA 2R48A 5JQGF 2V03A 4L3VA 4BJ6A 1II9A 3MS7A 2H7XA 2JS7A 2WVAA 3BAFA 2YC2C 3TL3A 4TYYA 3W9YA 3K05A 3QVVA 1PSZA 2G70A 3KV3O 3H1FA 4UZFA 3A37A 3I05A 4CQMA 3TUZC 2C03A 4MUHA 4UARA 3U17A 4H6XA 1DJQA 5LMCA 3WKAA 5M34A 3E2IA 1C5KA 1Z68A 4HUQA 3UT0A 3N07A 4QO8A 2GB4A 3M3HA 3OH8A 4MVJD 4BO7A 1ZUNB 2GK4A 4MUGA 4P7BA 5EYPA 3ACDA 1H4QA 2N3ZA 3L6EA 1Y42X 5IAJA 1CB0A 1LVUA 2L19A 3EXEA 3KLOA 4TTIA 5AHOA 3FPAA 3AM1A 1TXGA 1V7QA 2XQKA 1OWOA 1YVUA 3IUYA 1OH6A 2C0QA 4IVNA 4KEAA 5DK4A 2VNIA 5C37A 4BNMA 3AR3A 1UWLA 1YOBA 1Z4KA 2WNSA 1DQYA 3A6ZA 3LM8A 1ETUA 1X7WA 2XGGA 3CUUA 2WAYA 1FS5A 3KZVA 1NNI1 3L0CA 3WRYC 4BFLA 1XQYA 2A33A 4BVLA 1UJ2A 1B43A 4WOBA 4XVHA 4ZREA 4C9BA 3JVUA 4WERA 4NZZA 4KE8A 4PTZA 1RQPA 2GCOA 2Z83A 4TSKA 5JZMA 2HW8A 1YR2A 1EUDB 5DX1A 4GUDA 2G4LA 2YWGA 3O8BA 4AIRA 1IXSB 2WUVA 3MG9A 4KAJA 4NS1A 1ZICA 5HK9A 4BDTA 5A03A 4EQZA 3CVWA 5EMMA 1VLMA 4FR2A 1Y9DA 2R00C 3I9KA 1HNWB 2WKPA 2JRCA 4DXDA 3OZGA 1FU4A 1B1CA 2W22A 3HYSA 3S2YA 3NIWA 2NXJA 4M1SA 1P9WA 4L9AA 1H94A 1YS7A 3FKSA 4IDAA 5DHRA 5E4YA 4LVCA 2VNKA 3ZY4A 2CNKA 2Q49A 2IEDA 1XZEA 3KNZA 4W9MC 5TARA 1EVJA 1E7DA 4R3UC 3WICA 1Z0SA 2PKXA 2FWBA 2VQFB 5F9HA 3GDGA 2IYRA 2HPVA 5KAMA 4BC0A 2BGWA 4O4JA 3R3XA 2Y0EA 1SUPA 3NKLA 4DC1A 3ENWA 4FFMA 1IZ8A 2JJ8A 1UKBA 5J4HA 2H4FA 4BBPA 1BVUA 3N2KB 4Q12A 3ZV3A 3ZCUA 1K6JA 4YAKA 2VF4X 3U4CA 4RPHA 4DANA 8ABPA 2R85A 5AUPB 1MAHA 4ARAA 1JAZA 1U11A 1R8YA 1PT7A 3NHLA 1ZLYA 2CJXA 2JD2A 1TQ6A 3DAOA 3MT8A 3OMXA 2CXOA 4O0MA 5CNKA 2QG9A 1ZYUA 5B3JC 3AVYA 1JG4A 4PY2A 3DMGA 2VXCA 4Y2SA 3QUTA 4O4LF 1USUA 5G4LA 5HQTA 3DYIA 4Q03A 3QLJA 1M5TA 2TMGA 4PZYA 4BX3A 4TMFA 4B2IA 2ADMA 1D4FA 2WG1A 4FHEA 3HUDA 2EBWA 3QWHA 4HMOA 1DOAA 1BC5A 5AJHA 4DQDA 5IJXA 2OEPA 3VM6A 4EFMA 1G19A 1A82A 2VTKA 3ZG6A 3HNRA 3AUUA 1BJRE 1DBSA 2GWHA 1QV9A 2Z1NA 3TIGA 4DIMA 3OQPA 3LQ2A 1VZ3A 2UUOA 3G0CA 2AXQA 3MUNA 3ZWDA 4QYWA 2R8ZA 3JVDA 3O7MA 4LXTA 4RKQA 1ZGGA 5DDIP 1L4BA 4TMWA 5EZYF 3N2LA 1EQAA 4OV6B 3OE1A 4TQUS 3H65A 2JBAB 2VUIB 2IU3A 2Y1GA 4LYYA 4A7PA 3ZGVA 1U3FA 3DTVD 1HL7A 4OM8A 1NVUQ 3QI2A 4OQZA 5TQVA 1CZUA 3LQ4A 5KKAA 5IKEA 2PV0A 4NVRA 4ZU6X 1H4TA 2VQSA 1J39A 4QTXA 1SKQA 1YR8A 2FDXA 1MIHA 3EMVA 4FLEA 1LVHA 3ZE1B 3ZK8A 4GWLA 1MJFA 5BOSB 3IOMA 4I3HA 2GEUA 5FBLB 1H3EA 1V71A 3TL2A 1B16A 3AUSA 4BUZA 2GEDA 4W82A 3TBKA 3GT7A 3QYPA 4QEKA 3DBHA 4RS4A 4ID3A 1ZH8A 4OKNA 3ZY3A 3AMVA 3F71A 2WQ6A 1Q17A 5JZVA 1XPOA 1YQGA 4R9UC 2H2HA 2HDOA 3NUGA 4GLOA 1SKBA 2XIJA 2XE8A 5AVTA 5T64A 2QIPA 3KX2A 3RRYA 4P08A 1GTMA 3HXLA 3T5GA 4YMWA 3I9V6 4QHSA 5JZ9A 1ESDA 2YXNA 2JGEA 4OJKA 3WLLA 3THRA 4JH0A 4TRRA 4PFJA 1S9HA 2DPMA 4DLSA 4E1BA 3BYZA 3UJCA 4GMKA 4YRLA 4IEEA 1JQDA 2JKVA 2FI1A 3H83A 1IPHA 4DG9A 4X41A 3U4MA 5JMTA 3PE3A 4A1OA 3A3PA 2DPXA 3RRZA 3B6JA 1F06A 4LQ4A 1II8A 1YT5A 1ZKMA 1GQFA 1QVAA 4IHJF 1ZJ4A 3HP7A 4JJ8A 1FQJA 1IHYA 4MS3A 5MFPA 3R3VA 4MNTA 4Z7NB 1PL6A 4TM7A 2W2VA 3VO2A 1M2JA 4CL0A 4W5RA 1AT1A 1GZHB 3Q2KA 1PLJA 3BGSA 1QK5A 2J6IA 4KAFA 5F4ZA 3EVCA 3SFZA 2PVCA 5AM1A 2VWPA 2SNIE 1YSCA 1ZMTA 2G08A 4WKPA 5CMLA 3FDJA 2GJ4A 5KKNB 3LUBA 3FOFC 2FRDC 1QK4A 4HATA 1N1GA 5H70A 3G7SA 1DIBA 1I4OA 4BBAA 1Z0FA 1XRPA 4Y6PA 5E6RA 3T34A 5L8VA 5BN5B 2PUBA 3INYA 3LPCA 1E2MA 1XVIA 4N03A 3NO4A 4EY8A 1H6AA 2XD9A 5EMHA 1E2FA 1G4HA 1P9OA 3O8QB 4PPGA 2A7XA 2AZ4A 3QP9A 1LSUA 4GQBA 2X14A 2BOVA 5EGSA 3W06A 5LQMA 3QE9Y 1TU4A 5K3DA 3TIVA 3S27A 4R1PA 3UCEA 1ZSYA 3UPDA 1G6Q1 2E87A 3R5JA 3AG6A 4X5OA 1K08A 4PLPA 4RF5A 1WCV1 3WLNA 4C21A 2H1FA 1W0JA 2FHPA 1Y1SA 5B1IA 3SICE 3TWOA 5K05A 2WU1A 4LRYA 4N48A 1NLMA 2H1LA 1JEQB 2XUIA 3IPCA 5DM70 1V8PA 4BRZA 3PGKA 4L02A 2ERXA 2PMFA 2HLNA 2WK1A 3BSFA 4H7FA 5AI8A 1OFVA 1FLAA 2EX1A 3ZY6A 5C1OA 3GMIA 3MGBA 1T2CA 3OCYA 4DUGD 3H3JA 1P3Y1 1T43A 4N3NA 5BY2A 1HWYA 4AWBA 5L3QA 4GX0A 1KZHA 3LCMA 4XVQA 1QR6A 5HKKD 1F20A 1EJBA 4MQMA 4TLLB 3A9TA 1DWOA 1P62B 5IJWA 2OSBA 3GY0A 4E14A 2VF2A 3BL5A 5I4CA 4G26A 1K68A 1IN4A 3KR2A 1YKSA 3N75A 3TRKA 4M9RA 3LRPA 1PWXA 1X9GA 3HVKA 4RY9A 2IPNA 3A6EA 2HJSA 4OLFA 1NFRA 5FV4A 1FNSA 1T0UA 4WK4B 3QKJA 1Z2CA 3O0TA 1WA5A 1ZQ9A 3W6OA 1JPVA 2XMBA 1BCSA 1U7HA 2I71A 2JAOA 1DIRA 5A7GA 1RYBA 2I6QA 3NALA 1N92A 1J49A 1USIA 1HT1E 3QELB 4P4GA 2VNHA 3UICA 3TQTA 5FL3A 3B1ZA 1FPQA 4YRCA 3K16A 1N75A 1M8PA 1XQXA 4YPFA 4C05A 3OFNA 1K63A 3E58A 1LS1A 3WY9A 4LFAB 3N2GB 3B9QA 5D2CA 3TSOA 2ZUTA 4QDKA 5A6VA 3RRXA 4IMIB 1Z29A 2V6JA 2WWIA 5DW3A 4ZCPA 3T7AA 1RP7A 4G09A 4OGWA 3I4LA 5ALUA 2ZM6B 1IVSA 1AZLA 1N9GB 4UTXA 1F3OA 2VEDA 3CYFA 4R8MA 5JRDS 2I29A 5AT1A 4M76B 2AUTA 1OROA 5I8PA 1LTKA 3AIKA 2F8LA 4OQEA 1H5NA 4URFA 4NDNE 3ZHCA 4R8LA 5FUWA 1XZCA 4F3RA 1FDWA 2ZVQX 4CM5A 2LKCA 3ESQA 2EEZA 2OGWA 4G4SP 5TQ0A 4MKZA 4MUAA 4C1NA 3VI3B 3RODA 1BU5A 1L7VC 2ECKA 3DDZX 3GEPA 4DQ0A 1YWGO 4C04A 1G8GA 2KWIA 4IRMA 2XOKA 3SQWA 5AW3A 4QECA 1Y80A 1UBRS 1CHDA 1GAWA 2H2WA 3AKYA 3D4NA 3IR6A 3RB8A 1EBBA 2CEAA 3NWJA 4L22A 4ZAVA 3U3ZA 3TXAA 1FFAA 4ZHQA 3OJXA 1CEQA 3M8KA 5FI3A 3WG9A 1VCOA 2R6JA 3HY6A 4P4NA 1S2GA 1M7GA 4RZHA 1CRWG 4GE0A 5E7JA 1JZTA 2WWRA 5HE9A 3W5SA 1RJFA 1S02A 3TBHA 1H1LA 2DF8A 5K1ZA 2ZRAA 3M4NA 3SHFA 3V80A 5IN5A 3IV9A 2V7PA 3TEJA 2TMKA 3HB4X 4WOKA 1WS6A 3LZCA 1YDGA 2ZR7A 1BE0A 1NI5A 2AMVA 2Q4RA 2V5UA 2B9VA 3MIZA 1Q19A 1OLUB 4KB5A 1B8UA 1LJUA 2O9JA 4FWIB 4MHSA 1N3LA 5E3JA 4BNWA 2OB2A 2HQ1A 3QBJA 1NYRA 1TOAA 4MRAA 5DT9A 4BKUA 3FPLA 1SKAA 1FX0A 2VJMB 4HYEA 4JLAA 3VPDA 3ZE0B 3RG2A 3H4MA 4OXYA 5A0FA 3IE0A 2V7BA 3C7KA 2A4KA 2P4SA 1KQ3A 2BBTA 2LBPA 2EFCB 2W83A 4PCAA 1FRFS 1LWNA 4EAAA 5JQGA 3OIVA 3NNSA 4UDOA 4F97A 2ZTLA 3DFIA 4M0FA 4NYMQ 3Q9NA 4AF6A 3IUMA 5CG2A 4MB0A 3A6JA 1VBFA 4OFWA 1W5TA 2PKRA 3ND7A 3VKFA 3WRXC 4A0FA 1H42A 1LLFA 2NO6A 4MP6A 4Q9HA 1U3UA 5KJ6A 1MF7A 1QHEA 2GD1O 3KZCA 3WNBA 1IM2A 2OD7A 3DEAA 3ZWWA 1QFZA 2QRNA 3KOWA 1C1DB 2M6SA 2EARA 5JSKA 3ICEA 1I51A 1QR2A 3KYCB 1T6NA 2NQTA 4IGFA 2Q3EA 4W1SA 2J0QA 4FE4A 5BN3B 4DNOA 3G59A 3U0BA 4N3BA 1MU0A 3LIPA 3T3PB 1W5SA 2HV8A 3QSYA 1NJ1A 4M55A 4CV2A 3QV1A 4B7CA 1C30A 1U3VA 3SZMA 4U8GA 1VDMA 5BP7A 3PNKA 4R1OA 2ZJBA 4IGIA 2AHRA 4Y6QA 1ZNXA 1OAOC 2GKGA 4BZQA 4YAOA 1JLHA 2GXSA 3LSYA 4ZAYA 1HT0A 5MHTA 1YJBA 3GIWA 5KYVA 1P1JA 2OCBA 3AF0A 3BRCA 1O2DA 1FSZA 2R11A 1NVVQ 2HDNB 1ACJA 1Y82A 3BBPA 2Q46A 4ZALA 5HZGA 2JIOA 4N9WA 3UO8B 4NFYA 4DLTA 1ZU5A 4LY0A 2FSFA 4JBWA 1LX6A 3EEQA 5FUXA 2DFDA 5DHQA 4YXFA 1NKVA 1N6RA 3M6XA 2F48A 2I65A 2QK4A 3JYLA 4O8ZA 5DBOA 3MJ4A 3QBTA 2NM0A 4FTWA 2QUJA 4LRXA 4DLNA 3VTZA 1RZRD 1RLUA 2OXCA 1XRJA 1OV6A 2D5BA 1D4AA 2ZIAA 3LHSA 1H85A 4QUEA 4KDFA 2IYTA 1OX6A 2VAMA 3QVGA 4PZZA 1HXHA 3ORHA 2TMYA 3C4VA 3A14A 1Q16A 3EQ9A 2HZ7A 5ESXA 1Z25A 2P2CA 5IBPA 4M9XA 4B75A 3PEWA 1LXCA 2A1IA 2DR2A 4E33A 3G2OA 4NYJQ 2XEXA 5CT9A 2QHXA 4BPBA 1BU8A 5TSDA 4TWZA 2QN7A 3IV6A 4Z1OA 1ZGCA 1E66A 4IINA 2P2LA 4NZYA 4RA6B 5EJGA 1BHQ1 5H5JA 1FTQA 1JDBC 4GKKB 1QRDA 2XA2A 4QASA 3SHTA 2CB0A 1RABA 4L0QA 1MW9X 3AK4A 4CI0B 3DSRA 3HCRA 2QX6A 1DAMA 2FWJA 3HL4A 4HQ0A 4JBYA 4ONEA 2YW2A 3BFPA 1GQYA 3VDRA 2ARKA 3VYUB 4AKEA 4XWOA 1EHIA 4XZ3A 4DEVA 3RUPA 1S4QA 4HUQB 1XZKA 4OHKA 3BIXA 4Q9KA 3OZBA 3ZD6A 3FVVA 2DMRA 1HG1A 1FX1A 2OGSA 9LDTA 2QNIA 3KVOA 2AMYA 2CFOA 5EYPB 1MW8X 1IHOA 5FA8A 3EF1A 1VPWA 2O54A 1BVRA 3WYNA 3A9UA 3EXEB 1ULSA 2PS3A 4D4KA 3ZHTA 4LK2A 3D3WA 1EQUA 2WT4A 3O1JC 2VJKA 4IDQA 2F4VB 3OJCA 1N0HA 2VUUA 2AI1A 1ZIXA 3NGLA 3RIEA 1TK9A 1LDNA 3G0GA 1JKIA 5E1DA 3WRWA 4C2TA 1X8JA 1QKIA 1GZ7A 1X7WB 2D1FA 3KLMX 5EZYA 1XHFA 4CUKA 1DGQA 3ZXSA 4GUAA 2O8BA 1R18A 2SBTA 2Y66A 4OATA 1DBVO 1SG9A 2ZTUA 2GCOB 2OE2A 4MVJE 4XIFA 1Q0UA 2ZUBA 3W6UA 4WOCA 5B3LA 4QIHA 3VNRA 1HNNA 2AB0A 3BTUA 4G8BA 1HG0A 1PFGA 5FNZA 1O9BA 2O2EA 1JQEA 1DO0A 3G9QA 3SDSA 1KFEB 1SZCA 1DAKA 2F3PA 2FWIA 3EE6A 4O4HA 5E3IA 2Q1WA 2W2QA 5AKYA 1QRUA 2PGLA 1L6RA 4O3FA 2RKWA 2WRZA 3D6VA 3KL4A 5FJJA 4OB6A 4Z5XA 2ZPAA 3BF8A 1OOEA 3LH5A 1GJRA 1DKPA 1NV9A 2WB4A 3AY6A 3CNHA 5AOAA 3AI1A 1QU3A 1CEYA 4F4JA 1UBNA 3DEZA 5AM5A 3IBFA 5EXEA 4KR2A 1VIVA 1CF4A 3PF9A 4DQXA 4BPRA 1QJ4A 5KVVA 4RDCA 1O5IA 5EWMA 2AZDA 1KOGA 5K3FA 2C9YA 3B3AA 2L2QA 4O2RA 4O4JB 1NY6A 1DG3A 2O07A 3M3DA 4B3CA 3V8MA 3FDXA 4PNHA 1ZNQO 2SKEA 5K8JB 3SZUA 2VIIA 1H0RA 3FBGA 4FCTA 2PLNA 4MV3A 1C0KA 2NUTA 4DA7A 2PE5A 4XWKA 2WSBA 4M9QA 5J2TF 3A4MA 1P5RA 3GHHA 1ECBA 3UAVA 4D5EA 1ZD1A 4QHYA 1NW5A 4ZANA 4IIYA 2H9YA 3ITKA 1X7DA 3I9V1 4U9HS 3PCXA 4RHYA 4ZI2A 1JJIA 3VR5A 2XNHA 4DSOA 1JPJA 4HRAA 1CDEA 2R00A 3I2FA 3LC1O 4II7A 4IHJA 3INTA 4F1KA 2C2ZA 3KQQA 4E13A 3GA0A 1YHYA 4RD1A 2OPHA 3S29A 4BNHA 1AURA 1HH4A 1HO3A 2XA9A 3OU2A 1D5CA 3ROFA 5IT0A 3JWEA 4C7JA 2Z09A 2ZS8A 3NHSA 1XQVA 2GDJA 2NZ8A 5K9ZA 2VP2A 1A9QA 1DPFA 1EK5A 3ANTA 5CH8A 1WDKA 4ZOLB 2PX2A 3T52A 3ZHUA 1S3GA 4MB2A 5C1DA 3WTBA 4JDUA 1EK6A 2DWUA 4XQ0A 5ICEA 1SC1A 4OAQA 3AEQA 1KDZA 1MO4A 1SBHA 1GARA 3C3AA 5EKUA 3VMMA 4QPPA 3KHTA 3HB7A 3GLHA 1POXA 1J23A 2PAAA 1L4EA 1BA3A 4D5GA 3THYB 1IZ7A 1M74A 4UCWA 2FVYA 2W6NA 3OLVA 5FTMA 5TMPA 1S3IA 5A5GA 3W7AA 3ONFA 5BSGA 4N5LA 5IK2A 3SFVA 2VYND 5AW6A 1CUJA 3A6KA 1OZFA 5C1PA 3D8NA 1BHSA 1M33A 2VBGA 1HK7A 3FFTA 2RH9B 1E3WA 1LSJA 1SUSA 1GSAA 2ODGC 2EX4A 3H75A 4JODA 2IH5A 1H2YA 2X1LA 3CUYA 1T5LA 3GJRA 2JATA 3INGA 3JY6A 3NKFA 4GP6A 3ZZTA 4P8RA 4H3VA 4LF7B 1J22A 5ER6A 1G9SA 1WXHA 3ODPA 4B40A 4OU5A 5CU7A 2IH2A 4LGCA 5A4JA 3S28A 1JAXA 3HBJA 1UPUA 3BCHA 2OHJA 5DLPA 1DXYA 2QR2A 2ZB3A 3FMPB 1W1IA 2Z9BA 1RLTA 3H5WA 1ADJA 1AUVA 3JSAA 4UBOA 1KQNA 2UUCB 2ZT7A 5C3MA 1K7EB 3UB4A 4EX6A 3DBHB 3OURA 1E2LA 2FUEA 3HKBB 5KNCA 3RQIA 2R87A 4NLLA 4IP0A 3PFBA 4AKHA 4A10A 4W6QA 4MLZA 3K7EA 4FEEA 5FFFA 4WLNA 1NSTA 3PRHA 5JDIC 1WLSA 2GN4A 2QL5A 4J4BA 1A27A 4J03A 2V74B 1J07A 2YUTA 4OQNA 4P36A 3KJGA 4IDBA 2RHMA 2ZBRA 4LJYA 3DEKA 1PJAA 1P1RA 4XASA 1BDJA 1WL8A 3S8MA 3WMRA 2K7FA 3A6LA 4BQRA 2GD6A 2ZSJA 3Q1LA 5F5NA 1XD8A 3ZLUA 3LD9A 3MRVA 4TOIA 4F91B 2JLWA 3PEVA 1D2MA 3I2GA 2QAJA 5D00A 2OK7A 2F8TA 3IHWA 5I7EA 3OQMA 2OO3A 3R6TA 2EL9A 2J85A 1ULHA 2J9YB 4XCQA 4CU2A 1II8B 3F5MA 2BFPA 4M9ZA 2ZI6A 2QT9A 3EH1A 1WNFA 4RVHA 2FFBA 5EAIA 4YRMA 4RJTA 5ICSA 4J43A 1I6KA 1BH2A 4A9AA 1SOWA 1U8CB 4ENUA 3H4VA 5L4SA 1N8KA 3DUFA 3BM5A 3KYDA 2YWHA 4YI5A 5IBCA 1OH7A 2Q4BA 3ZJ5A 1XZQA 2PIAA 1J06A 1BNCA 3ED1A 1W30A 3EH2A 5FP0A 1IZYA 5ALSA 1B76A 3I6MA 3GFSA 2AW3A 4UW9A 5E6RB 3LVFO 4HFMA 4MW1A 1U90A 3JARA 4O1IA 3ZDYB 4EW2A 4GYKA 2M1XA 2DFKB 4PAWA 4BN4A 1VXRA 3ANMA 3UXYA 2HIMA 4F4CA 1DQPA 5J4VA 1ZN7A 4RXTA 4F84A 2JANA 3GEIA 1SK8A 1KVRA 2EFYA 4CRWB 1G4AE 4L4UA 4DVJA 4XM1A 2ZUFA 2Z04A 3FOZA 2ZYSA 1PU2A 1ORTA 1QBGA 1JB1A 3QU2A 4FHGA 4EFKA 4EJMA 5TEWA 4EL0A 1SHLA 2I4IA 5SY9A 4F72A 1XZPA 2LD7A 2ECPA 1E1NA 1NF8A 1QVZA 4Z49A 4WK6A 4F7DA 4M54A 4DCPA 1YZQA 3ZEAA 1I0ZA 1E99A 3M5WA 2P2GA 3BE8A 3DWIA 1WMSA 1RBQA 4KSBA 4K5QA 5JJLA 1UDBA 3EBOA 1F51E 2E55A 2XZTA 3DE6X 1PDVA 4FEAA 4Y8VA 3BQNB 1JXMA 3B3GA 3JTEA 4HS9A 2O6HA 4RFVA 3KTAB 3Q10A 3QBVA 2KVUA 2PFKA 2BTQA 3ILSA 1RD4A 2EHJA 2JK1A 1K89A 1PR3A 3LWDA 4HNAA 3P0IA 4NIMA 5JAUA 3LI2A 5L3QB 2ZIGA 2RB4A 1XVTA 1ILEA 1Q84A 2XYGA 3HNPA 2QEQA 3ZU3A 1E6KA 1MEOA 1EXWA 3MJEA 4I1SA 3U3MA 4KQ9A 5I8WA 4QPZA 3PJDA 3H5OA 3TXXA 1Q1AA 4GPD1 3NT5A 2C7OA 2AA3A 2OBBA 4YCSA 1MB9A 4O2AA 4GRDA 4LQCA 4PO9A 5FBRB 4JI5B 2ZRFA 2VT3A 3NTXA 2Y4OA 2AEFA 3QOFA 4DKXA 1SCQA 2AF3C 2JBWA 4JYCA 3RK1A 3AHHA 3KKLA 2C61A 2CD7A 2HH9A 3FVTA 5NULA 1AG9A 1SXIA 2QAGC 2XXBA 1EK1A 3V4FA 5AKEA 1M34E 1R9GA 5MF6A 5E1OA 1L7PA 1SVLA 2WHRA 3F1KA 3H7IA 2YS7A 4QGGA 2ECQA 2H31A 2YN0A 4US2R 3K1ZA 3NRBA 1AMOA 1NLUA 1UOPA 3NPAA 1KZ4A 2E4VA 2J3QA 2Q6KA 4CQMD 4OAPA 2CUKA 3LCVB 4DM3A 1Y9EA 4YUAA 1QYRA 4XFDA 4E7OA 2BGJA 4BNNA 5LLDA 1QHNA 4PHCA 1FUEA 2D2XA 3NEJA 3REFA 3DXYA 3CLRC 4XDGA 1FFYA 5BQ5A 3ZDZB 1RAHA 4EKYA 4HF7A 3MIIA 4FCVA 4LHWA 5DLQC 1DFIA 1KP9A 2BFBA 1JVBA 4A3SA 4EEZA 1L4MA 4CFZA 5TQ0B 1T6XA 1XP8A 1K0UA 3ITNA 1BTOA 1CX9B 5AJYA 2XF8A 3V9AA 2ZZNA 4TLDA 4DXHA 5EHZA 3Q8LA 1YS6A 1SCDA 2ZAOA 4IV8A 2E4ZA 4KVGA 4ZHQB 1IMJA 1FDSA 3WGKA 3DNPA 4LTDA 3KTOA 2OVBA 4GNKA 4QU5A 1H6BA 2KBFA 3W7VA 5LCXA 3QI7A 4RANA 4BO2A 2Y9PB 4MQ5A 1H1LB 4UTZA 4X71A 4AJIA 4LYAA 3IQWA 5ALXA 2ZG6A 3MTDA 4OI4A 1IXRC 1VL6A 1SAYA 4C2AA 1E2QA 2A9KA 2WF6A 2QX8A 2JJQA 3CZRA 2I2BA 2W2MA 3V32A 1UP6A 3PFIA 2PSDA 3DWFA 1H9FA 2Q5JA 3ETGA 4WXPA 1NLFA 3HHEA 3FKSD 4TS3A 4B79A 1NVFA 4UOEA 5ADWA 1K2VN 1T2AA 3DZJA 2ZTMA 4AO6A 4RK5A 2ZCUA 3LK7A 1FX0B 6REQB 1VKRA 3N0TA 1UIRA 4FFNA 2AV6A 3G0BA 3UJAA 4NR0A 1U65A 2ERYA 1JSXA 3UTDA 4UTVA 5KYYA 5DOVA 3ZVRA 4O4IA 4QVIA 5JQGB 1AXRA 2V59A 1XWWA 1U2ZA 2NU7B 4FW9A 5COBA 3ETJA 1ZIOA 5JMPA 4C03A 4CU5A 1KU0A 1W1UA 2CKMA 2EXXA 1TYCA 1HTBA 1WVGA 3LDHA 3PDJA 5G3YA 1R5JA 1C7IA 5E4TA 2CNDA 3WGNA 4H9GA 3AU9A 3KJIA 1Y02A 1G7TA 1WBBA 4N0PA 4IJUA 1UC8A 4EYGA 1EU1A 2JFFA 4FOPA 1EM8A 1B74A 3UQZA 3V1MA 3T1HB 1E2GA 1TEZA 1PBNA 3NMUF 1MN6A 4ZV4A 1WXXA 1JKXA 1QQ5A 2HPHA 4KTTE 3BIOA 1KDVA 4MLDA 4I81A 3EGIA 4Z8YA 5KWVA 5LMUB 4B3HA 1N5LA 1U2GC 3EZXA 4LG1A 4EMSA 1R6UA 3DW3X 1HE2A 5DOZA 4RACA 4TV8F 3HC7A 3EZGA 3JAWB 1ABBA 2FPRA 4H6PA 1D4OA 5CNIA 4X00A 2X7JA 2Q3HA 4EVIA 4PRLA 2G17A 2HMWA 5DYNA 4OU4A 3B5IA 4D56A 4Q66C 2C9BA 1EWVA 2Z5GA 3VTKA 1VBMA 3CNEA 3EAQA 3I3SR 2QRUA 2C3MA 3MYYA 4JN6B 4EY7A 4KX5A 4F2WA 5E9QA 2PS1A 4P4SB 2DR3A 3G0DA 3IPAA 3ZE9A 3IVGA 4MCAA 3OHMA 4FUTA 2V8OA 2JAHA 3EXG2 1G1MA 3C5WP 721PA 3L7YA 4MYCA 3MJFA 5EQJB 1QF9A 2ODAA 2Q50A 2ZCVA 4R2LA 5ICMA 4MJLA 4Q93A 1OXTA 5GM2A 4UU7A 4TRJA 2XOXA 3HCNA 3K71B 4R69A 4K6FA 3KWMA 4P7GA 1JG1A 2RSLA 4UM7A 5PGMA 3K0BA 1MVOA 5K4GA 5EWJA 3QVGB 1L5VA 1Z38A 4K9MA 4LMBA 4HWTA 5AI9A 3BIFA 2VH1A 3D3JA 4QOSA 2R7NA 3FWYA 2QYTA 3BK7A 1OAOA 3CS3A 4EG7A 2QY6A 3BTVA 3G2NA 2BLLA 5J2TA 3GAFA 5CFLA 4HX2A 4Q4LA 5DGXA 4DEYA 3MLBA 1DQRA 4B7AA 4X20A 2C8VA 3ADKA 1PS0A 2I4NA 1BEUB 3BE4A 3L43A 5EG5A 5LXTF 3SIRA 1QO0A 4FGJA 3K6SA 4BMDA 4X94A 4NNPA 3JQRA 5AMXA 4NMXB 1EWTA 5L4LA 3AVUA 3LFUA 3GG9A 3WV5A 1E4EA 2QR5A 1UEXC 3H8JA 3LP6A 4BWVA 4O4LB 1QP8A 2VSXA 5IULC 3LOUA 2ZXFA 1Y1LA 5EXSA 5FAXA 3NH9A 4E5UA 4B3MB 3A1FA 3H5RA 3N74A 4XJXA 3HXOA 1Y63A 4TWAA 1NC3A 3M4ZA 3FZEA 3Q6MA 1FDRA 1U04A 1YDEA 3V8NA 4HWGA 3TCKA 4Z4HA 2CZCA 5IJZA 1ZC4A 2CHQA 1M73E 3VNSA 5IF3A 3E23A 5CTAA 5AI4A 5BSUA 4Y1RB 1X7XA 3CRMA 2WWYA 3BXXA 1R16A 4CE6A 3D3WB 5DI3A 4YRZA 1IEVA 1IJKA 3LLVA 4BATA 2IEGA 2QY9A 5EIBC 3AVTA 4MINA 1B6RA 1ARZA 4WXEA 5JNVA 3E53A 4BRUA 5EZYB 1G20E 5FPYA 1MCZA 1GSIA 1FJ2A 3W5BA 3SYNA 3RTEA 1ZPDA 3T06B 2O8BB 3KQKA 3PVCA 1YNSA 3IEIA 1J2RA 4K28A 4UZSA 2CZGA 2P5SA 2Q3MA 4AJ9A 1FRNA 4OQLA 3LBYA 4KR9A 4D7AA 2NP6A 2Y6UA 3P52A 3AUKA 1FJHA 4QOHA 2WVHA 3RIYA 3FYCA 2XADA 1Y4ZA 2PCLA 1WJGA 2GBLC 3DL4A 1MR3F 1MRZA 3I5MA 3ZX5A 4BMYA 2VDVE 3QVMA 3WJAA 1SHKA 3PBKA 1GAJA 2QTNA 5JZOA 4KQCA 3B1VA 1UADA 5FWAA 1AHPA 1W0JD 2BRUC 2Q0QA 2G9NA 3AH8A 1H5QA 1U9ZA 4NRDA 4OQQA 2ADOA 5EWMB 5JLAA 1CU1A 1ST2A 2RAFA 1T24A 3IA7A 1Z4IA 4GYYA 5K3FB 2OBFA 1HFEL 3CZ4A 3G2QA 3K4PA 1VHWA 1S96A 1V45E 2G76A 4C14A 4DSAA 4ZVKA 1I2MA 1NBAA 2ZRKA 2QRQA 1TU3A 5KBYA 2PZGA 3EVGA 3KKZA 4K03A 4L5CA 4KR7A 3Q7PA 1WUHS 1IWBB 1QH1B 1GTRA 1O54A 4Y7CA 2NUBA 5LP1A 1P2DA 3MCTA 1C7EA 1HLGA 4C3OB 1UK6A 4MWOA 3DB1A 2V0NA 1EX9A 4HDSA 2R6AA 5ERYA 2PQ6A 4NI5A 2VCHA 3K09C 4Y9DA 3LXUX 1LBSA 5JDCA 4IHJB 3VOAA 3RNLA 2VHTA 1Q0PA 3E7PA 2C2KA 4NHOA 4UE2A 2TRSB 4AJHA 4IMRA 3JALA 5A0VA 3PI6A 4KFTA 5I6DA 4HDCA 3K8ZA 2CLLB 4LRTB 4FB5A 1OH8A 2J4FA 1NN3A 4RTLA 2IP4A 2ZE5A 4I4LA 3V2IA 5HUJA 3AEQB 2YXDA 3A32A 2GNPA 3BL8A 3PQEA 4UU8A 3TD9A 4KTVE 4L5AA 5FR2A 4JBLA 1A9PA 1FTYA 3PITA 3GLHB 2FR0A 4Z4FA 1JIJA 2PO5A 1C50A 2WJ3A 4O59O 3BWVA 3GH1A 3OFND 1J70A 2F43A 2JCBA 2RH5A 1J6UA 3MQ2A 3RVKA 2QDXA 3ZD7A 1XCOA 2FW6A 2QW8A 4BVEA 1VGRA 2YMMA 4M3NA 5C35A 4MDYA 5CM9C 1X1CA 1YQTA 1UDWA 1DUVG 1I10A 1DBRA 1XPRA 4Y2HA 1E3WB 4B4OA 4CCAA 2WINI 3WZLA 1R0SA 1RXVA 1E7YA 2QTBA 2HQRA 1N5DA 4PQRA 1GL3A 4FYMA 1PJLA 2WP0A 1E3MA 3G13A 1DC7A 3UAXA 5LZ8A 5FYDA 2IVFA 2O1SA 4MRVA 1NAIA 1R12A 3O0DA 4R31A 1DT3A 5A1JA 1Z8DA 3SHVA 5AW4A 1NQOA 1ZUWA 3I52A 3MTQA 3UK0A 1CULC 1LDYA 2XOKD 2NO5A 3DE1X 2NUPA 2RC5A 3L5KA 2F4NA 1YB1A 2H00A 4KE6A 4JLPA 4JD5A 2VQEB 1TFRA 3A9SA 2WIGA 2C3YA 3G1UA 4PC6A 3HP4A 2FK8A 4CF3A 1B2RA 2FN8A 1K92A 1GGFA 4FBMA 1KSFX 4ZI7F 4RD6A 1V9CA 2VYFA 3TI7A 3TUJC 4DA9A 4JI0B 2ECFA 1REQA 1VA4A 5JT1A 3LT1A 3TJRA 3PE6A 3DG9A 5HF9A 1GQSA 1JSRA 2VEOA 4OQMA 5EA2A 3WLJA 3A9RA 2GTIA 4BY9E 4AROA 2RGEA 4OP3A 3JSXA 1FL9A 3P45A 1R7RA 2HQSA 5ICCA 3K1TA 2AMLA 3VTFA 2D2IA 4MUFA 3ZWKA 1CDZA 5JCZA 4GX2A 4WN3A 4UCXA 4XRRA 3OX1A 4M87A 2IA5A 2JBHA 1KQPA 3GRPA 3JQ9C 3PPWA 2KVDA 3QH4A 1AZTA 1GT6A 1Q6YA 1VMKA 1T1JA 2BHSA 3AR4A 3JR7A 4NEGA 421PA 4C5CA 3KFVA 3BQMB 3HPQA 1I6WA 5HE8A 4ER3A 1F17A 4N39A 3A3YA 2MTBA 4JOQA 1JVSA 3UW1A 1FSGA 3DUFB 3KYDB 3NTOA 3BSWA 3QMVA 3IPRA 1UZNA 2KLHA 3O8DA 4ZVVA 4HWPA 2JVKA 2ACVA 5JDIA 4DKJA 3PRKE 4M9UA 3E7DA 3JARB 3LT2A 4YJDA 2QTMA 2B3TA 1MNAA 1O87A 4KWIA 2UYOA 4KIUA 3BORA 5EIOA 1WETA 2O2HA 3F7TA 1ZM4A 2DFTA 1SURA 4OOFA 4QEDA 5C31A 3QKIA 4JJKA 1MC5A 5BRAA 2WUFA 2HSGA 4KXFB 4F9FA 3PQ5A 3S55A 5JO0A 2WZBA 3KSDO 5HBRA 1CG6A 5JS2A 4DDTA 5GIPE 4MYRA 2QZJA 3P0FA 1VYTA 4BZPA 4RTOA 4R6WA 3L9XA 3WGUA 2HQOA 1U7XA 4GI7A 4IDOA 1W36B 4EJFA 3UUGA 2YDXA 4OL0A 4BJ1A 4OMCA 5BMOA 3QFFA 4RVCA 1KBOA 3TXYA 3JWHA 3KSMA 1XMIA 4K1LA 5BYKA 2R751 2BTQB 3PUVA 3EVAA 3E9EA 1LBTA 4N6GA 2XDWA 4HNAB 1OGJA 5D86A 1JKMA 2WSYB 3NM5A 1OX4A 1JWAB 2IELA 3AVVA 1EFPA 1XPJA 1EXMA 2AOXA 2P69A 4Z7OB 2RHOA 3EXHA 3PD0A 5H3LA 3T3OA 4OHVA 5HOQA 2YVUA 5ALJA 1EK0A 1PZFA 4BO1A 2ZWIA 2CJFA 1VJGA 4WVFA 5C4MA 2HCBA 1JX6A 2L17A 4KNVA 4HVCA 5EE3A 2OCDA 4EHBA 2MSEB 4INZA 2O2SA 4R3WA 2JKYA 4U1RA 3ZNOA 4HQLA 1NZDA 4Z1MD 2J6CA 1FFEA 2I87A 3H9CA 1DFGA 1KJNA 3CEMA 3LW8A 5DLYA 2D13A 2Y1EA 3I2JA 3MT7A 4NWIA 4TT3A 1H0SA 5COQA 4BWYA 4KLRA 3KQNA 3N8NA 3CLVA 1Q22A 2AF4C 4EFDA 10MHA 3AXTA 4JY7A 4FXOA 5KWEA 1FMFA 1NXPA 4G0UA 4ARIA 1A9SA 3JQAA 3NRCA 3OBBA 1ODKA 4L4ZA 3IHTA 4Z4EA 2O57A 4B33A 2IXTA 3T8YA 2H85A 4HN9A 1QIKA 2I67A 1X92A 2QV7A 2XSZA 4UTNA 2R62A 1WUKS 3SMQA 3A4NA 3F6CA 3OC0A 1WRBA 5ERXA 1F0PA 4UKDA 2D0DA 2ZSAA 4JA0A 2W6IA 4KDCA 2H6EA 4OM7A 1QP0A 3EPJA 3SJBA 5ALWA 2PUFA 1G17A 2I5PO 2BGMA 2C9OA 2GQ0A 2LPMA 3QPDA 4RY0A 5F4BA 2V7EA 3T1TA 2FSVA 2BFBB 3HBLA 1FSFA 3L05A 4ML3A 1IY9A 1QGOA 4M0KA 1VJCA 4HAZA 4EEXA 4YUYA 5CP8A 1Y8CA 4V0QA 5KOIA 3UBTA 3NT4A 4ME6A 3RARA 4Y2VA 2AFHA 2OPBA 3BB3A 3OCWA 4HLUA 1EJ0A 3SSNA 5KZMB 1OBVA 5HJ2A 1VM6A 2QAGA 4G97A 3ZV5A 5IHXA 5FHQA 1PFVA 2FX2A 1UJMA 2OBLA 2XQFA 4BB9A 3FTCA 1Z5UA 1T8PA 4H1UA 4IV5A 3CMMA 1EGAA 1WOMA 3F4KA 5AP9A 2ZQYA 3GXOA 1U0JA 4IMJB 1XV5A 3VZQA 3AHEA 1W35A 1ZN9A 1PZHA 3DNMA 3IC5A 3LJKA 1K0FA 4RGQA 4DLXA 5IRCD 2HK6A 4K05A 2ZBUA 1MENA 1C4WA 4KN6A 2P27A 3WTCA 1KZ6A 1CNFA 1BHO1 3CR7A 4OMDA 2HL6A 2Z8YA 3FZNA 4V1CB 5KJFA 5CCXA 3A2LA 2C7VA 3DKPA 4NXMB 4N0EA 1PKXA 3TVYA 1U7WA 1G38A 3VPSA 3ST7A 1SEVA 2X0EA 4OI1A 2W2LA 2A5YB 3K92A 3CO0S 2GZMA 2Z57A 1EP9A 2R5FA 3GZ4A 3IJEB 3MC1A 4IMPA 3WMXA 3ZV7A 2IS2A 2EGUA 3ZWMA 3H1PA 1NDUA 3OFJA 3NP7A 4ZJPA 4DV3B 5LXTA 4WJLA 4N3AA 3A6HA 1GG9A 3KTFA 1RXYA 3KCQA 4ROTA 5F5LA 1A9XA 3HACA 2D54A 2EHDA 4JWTA 3SLRA 3Q0IA 3VBEA 4KI0A 3UH1A 2G5PA 1DO8A 2P5UA 5T3YA 3IGFA 3M33A 1R6BX 1IOZA 3UENA 3UH0A 3AILA 3USES 3GLFA 1LPMA 5CFNA 1IAQA 1IK4A 1M10A 5FWYA 1RVDA 2IDKA 3BH7A 4N18A 2RKOA 3P2YA 1LF5A 1RNLA 2PNJA 521PA 1T91A 2G71A 2MSDB 1G4UR 2ONCA 1X70A 3WL6A 3N0VA 3ORYA 4DCSA 4BYMA 4E12A 4FHDA 5KWIA 2FETA 4X8OA 3RS8A 1PDOA 3VR6A 2VH5R 4EY3A 4OMFG 2QSUA 3JATB 3P19A 4QLOA 5U4QA 4D46A 1EVYA 1Q0SA 3WI7A 4OI0A 1T29A 2IPMA 4IIDA 2GLUA 1Y8RA 2GYVA 4OFXA 3TR5A 5AESA 3HFRA 1G6KA 2OQRA 1LK5A 2JFQA 5TF0A 2IXDA 1RBMA 1CUCA 1Z33A 1SKMA 3BAZA 2HKIA 3ICVA 1XZGA 3QA3E 3REQA 1KDPA 3STXA 3U60B 1DXQA 2C3OA 3ZY2A 4WHMA 2BY4A 3DDSA 5EJIA 2JIRA 3DKRA 3UC5A 4EG0A 1GITA 4G8CA 2E48A 1P8JA 2RI1A 2I66A 2ZIXA 1ZRNA 5GOTA 1JAIA 3H9GA 5HKOA 5K0LA 2BHNA 4KQWA 5IK2D 2PUAA 3S2SA 1I7SB 4XARA 4B2YA 4U7JA 5A9SA 4LX8A 3IAHA 1NBME 4C3ZA 2HA7A 1YZKA 4HEQA 3WLPA 1T8UA 3IDZA 1OC4A 2AN3A 3BOSA 3R41A 4MYSA 4DGSA 1RJDA 4EEKA 4FILA 4CTOA 5AVUA 2B0JA 2BP7A 3ZTWA 1FUYB 2VPXA 1PQYA 4KN9S 1KNQA 8LDHA 3PZBA 5FUBA 3PQFA 2W6OA 5EINA 1FLDA 3LP5A 5EWJB 3ZTYA 4R6XA 1TKRA 2PZMA 3N8HA 1U2GA 2VK8A 1E79A 3TYXA 3ASUA 1QIEA 1XVAA 2W6JA 1SHUX 3FMFA 5KNCD 3WZ2A 4B6SA 1MC4A 2JIMA 5J2TB 1OILA 2GF2A 1TEVA 3OIWA 4IDCA 1FE8A 4JU9A 4X20B 4RYLA 3ZYZA 2I6XA 5EJMA 4B6GA 6ADHA 3EOZA 3J81k 3JYOA 4EUEA 3PWSA 5KWJA 5LP6F 1EWRA 3QVXA 3K6SB 3SXUA 1A8QA 1CUDA 1TI7A 1WE2A 3RG8A 3JQ6A 2ZYTX 3UC9A 1E4EB 1CC1S 2EV9A 4NESA 4FSXA 4Q3AA 4AMGA 3WHKA 4RETA 3SOPA 4G0WA 4XCXA 4ILEA 3WZMA 4J7UA 1J21A 4M1ZA 3DBOB 4QAJA 1V6AA 3KAJA 4A0RA 4QM6A 3D4LA 4Q15A 3BD7A 4KMMA 4MMXB 2LCQA 4DA8A 3O8LA 3DAGA 1FDIA 2NZVG 1NW8A 4JBXA 4WEOA 1X7XB 2HWWA 3SQXA 5BVHB 1G2QA 1I24A 1ABFA 1T35A 2VZLA 5DI3B 1YRYE 4JX8A 1ZD5A 4JHLA 5FLKA 4JC8A 4S1VA 3K0SA 3I09A 2A9QA 4RFSA 1YC5A 3KT0A 3UQYS 3V55A 1D03A 1F2TB 1FYEA 2XRYA 4DS3A 1QRTA 1NJ5A 1GADO 1TTPB 4W8OA 2B5VA 1I3NA 2IHTA 3ZXXA 4N6NA 1CQPA 3KOUA 3PHCA 4X7MA 1THTA 1YQQA 4FJ0A 4TN5A 1TJNA 4ENPA 3X1MA 2OHXA 2DY1A 4X7RA 1JDBB 1MOQA 1P2VA 4E70A 4PSAA 5DE3A 5J3JA 3V4SA 5TRTA 1ZY2A 1SHZA 3LW7A 2IZ6A 4QATA 1H05A 4LV6A 3VQTA 1KZ1A 4ZI3A 3RVRA 4RZUA 1TZJA 4FI3F 4BKRA 4UNSA 2FQXA 5IUKC 2ID7A 1NJSA 2Q27A 3AFMA 3OLQA 1LW7A 3MLEA 3N86A 4J0EA 2GEFA 2PZKA 2WJGA 2YJ4A 4U6QA 4ZGWA 2X76A 1Z8NA 4TLEA 1RE1A 3PKZA 1KMNA 4CF6A 1EA5A 3H9UA 1UBHS 1YE3A 4JAVC 4C88A 1W94A 5F52A 1RPNA 1W36D 5A04A 4XAQA 2Q21A 4D79A 1YOVB 4CLRA 3LLUA 2Q5HA 1R0BA 4IH4A 3KCNA 3IBCA 1TMGE 4UHEA 4ZI7A 4Y3UA 1X1AA 1N3YA 2JLRA 2N0SA 4UM9D 3HYCA 1ITZA 1GNRA 2ZITA 4H7PA 1QIJA 4O2LA 5SY4A 4CR8A 5BPFA 3FRIA 1TTHA 1ISIA 3QBDA 4E2FA 4QODA 1RYDA 3GJTA 5DN6A 3E27A 1YR9A 1FA9A 2ODBA 2NO1A 3DMRA 1FUIA 4ZK6A 2ZAYA 3C43A 5LQUA 2PHZA 2VPTA 4HDSB 5AVSA 4PYOA 4A23A 3GZJA 4E6EA 1TX4B 4ZCRA 2XXJA 3U9TA 1C29B 1D1TA 1UBCA 1N6IA 2WQZA 1ZBQA 1GU1A 2OB1A 4Q4JA 4LF4B 5D5QA 3T3IA 1JIIA 4M99A 1OTHA 3EULA 3JALB 1NQAO 2JVIA 3JQQA 2YOGA 2E7ZA 3KB8A 4YV2A 3Q5GA 1EP1B 2ZDQA 4Q4HB 3FNBA 2EG9A 4L4YA 4TVKA 1QH0A 2IP1A 1Q3TA 1UKZA 2QLLA 1VRWA 3HCWA 4DEXA 5HGXA 1L5NA 4ESEA 3OJ0A 4Q9NA 3CZMA 1ZXBA 4AUNA 3N0XA 3PEYA 1BWPA 3WJ7A 2R4TA 4HNHA 4K6KA 3F3SA 1FFDA 1ULTA 3GJ6A 4IO0A 4ZCTA 3WGHA 1N6NA 3FG9A 5KO2A 1CR6A 3ICWA 5HG0A 1VTKA 2BBWA 2F43B 1Q2UA 3D6NB 4YMLA 2G1PA 3B12A 5D3ZA 2I4TA 5FEUA 4E5YA 3NYIA 4J29A 3ET5A 2GM5A 1J24A 2H92A 4UMEA 4E5MA 3SIXA 3WBKA 4RVOA 5KNDA 2QW0X 5F2OA 5F78A 2HLPA 4E5DA 2PLFA 1XDZA 2O5EA 1MH1A 4HJRA 2KLBA 4QREA 4R1LA 2W48A 4JQYA 1M66A 4X45A 1YS2X 1AV7A 4UATA 1FXUA 3KU4A 1Y0BA 2ENWA 5E4FA 3GFRA 3WGTA 4HBZA 1RC8A 2ODWA 1ODCA 4O8CA 1TGVA 3Q12A 1DRKA 2R68A 2ZIVB