1ZS9A

Crystal structure of human enolase-phosphatase e1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
254
structure length
253
Chain Sequence
LSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords E-1 ENZYME
publication title Crystal Structure of Human E1 Enzyme and its Complex with a Substrate Analog Reveals the Mechanism of its Phosphatase/Enolase
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 253
sequence length 254
ec nomenclature ec 3.1.3.77: Acireductone synthase.
pdb deposition date 2005-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.60 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1zs9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zs9A01
1YV9A 1PW5A 3ED5A 3DNPA 3ZVNA 1LVHA 1NF2A 3N8GA 3QUCA 3WKCA 4AS2A 4RESA 2GFHA 4DWOA 5AVXA 1RDFA 3L0CA 4YCNA 1Y8AA 1RQNA 3L1UA 2YJ6A 1CR6A 1RRCA 4KX3A 4Y2RA 2FUCA 5IT0A 4CF4A 1TE2A 1KYTA 3N07A 3L7YA 3B9RA 1QQ7A 3QUQA 1YNSA 2EAUA 4ZEWA 4PNHA 2YJ4A 5ALEA 3PGVA 3AR3A 3MMZA 3L5KA 2QYHA 2JAUA 3QU7A 4CE6A 3WK5A 1Q91A 2HOQA 3U7HB 5ALLA 2G09A 3WKAA 4YIKA 4F71A 4J2TA 4H1WA 4NAVA 2EATA 1RLOA 1U7OA 3E58A 3W5AA 5AW7A 1Z4QA 2R8ZA 2FPRA 3ZVLA 1ZS9A 2HF2A 2RB5A 5ALKA 1YMQA 3N28A 2G0AA 4UM7A 3SLRA 1T5TA 3F9RA 3UMBA 3ZTWA 1L7NA 1J97A 3EF1A 1RMTA 4JDPA 1U2TA 1RKUA 3I76A 4NABA 5ALFA 1VJRA 2IOFK 1EK2A 3MC1A 4L6CA 2R8YA 3E84A 4G9BA 4BKMA 4KN8A 3DV9A 5AHXA 1O08A 1WPGA 5T41A 1ZD4A 1O03A 5AIBA 1WZCA 1FEZA 5AKJA 1L8LA 2FPSA 2IA5A 2PQ0A 3QUBA 4DW8A 2MU1A 2YJ5A 2YBDA 2FI1A 2HF7A 2JAOA 3WGVA 3U7FB 3HLTA 3FVVA 1N9KA 2ZG6A 1Z4LA 4RETA 4DFDA 1SWWA 2WHEA 3CZ4A 4ZEXA 3KC2A 1Z4OA 4Y2PA 3W5BA 4FFDA 4OCZA 3J7TA 2RBKA 2OBBA 2B8JA 5AM1A 1TA0A 3TLMA 5AM3A 4Y2YA 4IG4A 4Y2SA 3ONNA 4YCLA 4QQFA 4MUMA 5JJBA 3QX7A 3R09A 4GIBA 5ALQA 5AI4A 4OD0A 5AICA 5AKLA 4Y2VA 5ALWA 1U02A 3MPOA 4KNVA 5ALXA 3ZW7A 1Z4KA 2ZBEA 3IB6A 4EELA 3P96A 4CNQA 5ALVA 3WK7A 2NO5A 5AI5A 2I34A 3L0BA 5AKYA 2I55A 3QU9A 4Y2QA 2B30A 1CQZA 2GMWA 3OCUA 4EX6A 4UW9A 2D2VA 1L7MA 1Z4NA 2I33A 5AW6A 1Z88A 2YMQA 2ZOSA 3KBBA 1Z4MA 2GO7A 4UASA 4C4TA 3ZX4A 4UU1A 1IWOA 2IYEA 2GHTA 3WGUA 3W5DA 1NNLA 4UM5A 1YDFA 1T5SA 5AK5A 1L6RA 2C9MA 5AI9A 5A3SA 2G80A 2PR7A 3K1ZA 3NALA 4JB3A 3VAYA 1ZRMA 3FGOA 4BEVA 3FPBA 2PKEA 3HYCA 3ESQA 4XQ0A 3AR8A 4OFZA 3WKDA 3ZWDA 4BX0A 1Z5GA 2DQSA 5A3QA 3AR5A 1MH9A 1ZJJA 3R4CA 5ALZA 3S6JA 3IJ5A 2JARA 4YCMA 1Z4JA 4BYGA 2JAWA 1U2SA 1RLTA 4UMVA 4BX2A 1L8OA 3AR9A 3DAOA 1J8DA 1XVIA 1SWVA 3AR7A 3AR4A 2B8EA 1XP5A 4UMFA 5AKXA 2W43A 3QU2A 2OA0A 5ALRA 2YMPA 1RC8A 1X42A 2W11A 5ALUA 2ZBDA 3A1EA 2I6XA 4BBJA 3QYPA 5AW2A 2HO4A 5AKGA 2Q4RA 3PDWA 5AW1A 3GYGA 3SKYA 4EENA 2BDEA 2IOFA 2WF5A 3NAMA 2VKQA 3NANA 5A3RA 2FEAA 3E8MA 4AS3A 3ESRA 1Z4PX 5ALMA 4HGRA 4NWIA 4CF5A 3SF0A 5AW0A 3BA6A 4F72A 5IS2A 4OHFA 2G1AA 3RF6A 4EEKA 4YIHA 4HGNA 2BDUA 4NV0A 3M9LA 4KNWA 3CNHA 3PGLA 5ALHA 5AW9A 5ALJA 4HAIA 2YFYA 3FPSA 2WM8A 5ALPA 2B1RA 2YMMA 1L7PA 5IT4A 2G08A 4HGQA 1L7OA 2ZXEA 4Y3UA 3KZXA 3U26A 5E0OA 3AR6A 1ZD2P 2R8XA 2OM6A 5AW8A 2WF6A 4FE3A 1NRWA 5AW5A 2G07A 1RPZA 4BEWA 5AKHA 5AIAA 2YMLA 4UAUA 5AI6A 3BWVA 3N1UA 3OTQA 3W5CA 4QJBA 2MSNA 3R9KA 1TJ3A 3FM9A 5AM0A 2QLTA 1YS9A 5ALNA 1S8OA 2P9JA 4EZEA 3I1YA 5AK3A 3UM9A 2IOHA 3ZVMA 1VFPA 2HEGA 2EARA 4YH1A 5AVRA 3KDPA 2HCFA 3FZQA 1AQ6A 3PCTA 2FDRA 3U7EB 3A3YA 1RKQA 1Z5UA 2P69A 2FPWA 4DCCA 2HI0A 2YN4A 5AM2A 1TJ5A 5AVQA 4HGPA 4KX5A 2FPXA 3WK8A 3EF0A 3ZU6A 3SKXA 2HDOA 2JGAA 3UMGA 1ZD5A 3L8HA 4IFTA 1RMYA 3WKBA 5AESA 2ZBGA 2R8EA 3OCYA 4UMEA 3L0YA 2B1QA 3M1YA 5AKEA 3L1VA 5AKKA 1QYIA 2AH5A 2ZBFA 4Y2UA 2Q5EA 2OYCA 3L8GA 2CFSA 2AUTA 1ZD3A 4Y2XA 2C88A 2WF8A 4AP9A 5ALIA 2I54A 1SU4A 4MWOA 3NUQA 1ZOLA 3OPXA 3OCWA 1K1EA 4C4SA 5AM4A 2WF7A 1RMQA 5ALYA 3B8EA 3OCVA 5AKIA 1RLMA 3U19A 4KYTA 4FYPA 3L8FA 2AMYA 4NFLA 4BX3A 3OCXA 4UATA 4J03A 4UMDA 2X4DA 2C8LA 3A1DA 2HHLA 5ALTA 1F5SA 4HGOA 4Y2JA 2W4MA 3QGMA 3QLEA 5AVSA 1JUDA 3U13A 2B82A 2Q4TA 4B6JA 1QQ5A 4GXTA 2FPUA 2NO4A 4XOUA 3N5KA 1EK1A 3B9BA 5AVVA 5FP0A 3SMVA 5ALGA 3U7GA 4EX7A 1WVIA 2I7DA 3QU4A 4C4RA 4UARA 5AK6A 5AVWA 4XE5A 2BY4A 3IRUA 3ZWKA 4XPZA 5AKZA 2CFTA 1QH9A 3ZTYA 3QNMA 3QXGA 3RFUA 4O8CA 4I9FA 2GHQA 3QUTA 2C8KA 3KD3A 3A1CA 3EPRA 4BNDA 4I9GA 1Z4IA 1QQ6A 1YJ5A 3DDHA 5AVYA 5AM5A 3NRJA 4UU0A 1RQLA 1ZRNA 2CFRA 2AGVA 3ET5A 3ET4A 4ZEVA 3NASA 5ALDA 3QU5A 5AW4A 2G06A 1TJ4A 2B0CA 3AR2A 2C4NA 5AVTA 1U7PA 3ZUPA 2YJ3A 5AI0A 2HSZA 2O9JA 1Q92A 4UAVA 4HYTA 3MN1A 4G63A 3WK6A 1N8NA 1S2OA 2YY6A 2P11A 2RARA 2RAVA 3I28A 4Y2TA 3WK9A 1RKVA 5ALSA 3EWIA 2P27A 4L6AA 5AVZA 1XPJA 3SHQA 3ZI4A 1WR8A 4CF3A 3I6BA 1T9ZA 2O2XA 2ODAA 5AW3A 3NIWA 3E81A 3WK4A 2HX1A 3D6JA 3KOOA 4YGYA 3SD7A 1LTQA 2NYVA 2FUEA 2WF9A 4L57A 5AK4A 3OCZA 5ALOA 3L8EA 1VJ5A 5AVUA 3ZX5A 2CN1A 4E88A 2WFAA 5AI8A 3WKEA 4BNDB 3UMCA
chains in the Genus database with same CATH superfamily
1DX9A 1GUZA 4E2YA 3K6SB 2EZTA 3C4QA 1UJ4A 1IUKA 1YZTA 2V7PA 2BMVA 4MRRA 1L5GB 3SC2B 2R7AA 4QOGA 5LQMA 1LI7A 4TXHA 1MZVA 2BM0A 3JQQA 3IH5A 2KX7A 2PT6A 4OLJA 3L7LA 2YIMA 3A4VA 3EVBA 2QMEA 2WVAA 3LBNA 3SHTA 1VMIA 3HVUA 4K9QA 3P2MA 2XECA 4AZSA 2BTQB 2ID4A 4KFCA 5F1OA 3AG6A 1M66A 3A6LA 3NV9A 2PO5A 4H1VA 3V1UA 3BJMA 4OBEA 4QYIB 4ZGGA 3BS4A 1KC1A 3U4HA 4DCNA 5JCJD 1U7ZA 4HLNA 3WL5A 2JK1A 4X85A 3ER9A 4M1MA 1QM5A 1G8KA 3SX4A 4XWAA 1OB5A 1V1MA 3IBSA 3JQ7A 4R7TA 2VK4A 3DHEA 3OLQA 1OGYA 4PWYA 3O93A 3SM3A 4AD8A 2QJOA 1JDSA 3KQMA 2CNNA 2Z09A 3PGVA 4ENTA 4IXNA 1BYIA 5BW8A 1JDZA 4D82A 3G9QA 2YINC 2MTBA 4UZSA 1JEYA 5EJ5A 3PXEA 3F98A 4A0FA 4XDZA 2C5AA 3LPAA 5AQ1A 1XDBA 1US8A 1XRPA 2FEXA 3PL5A 1JQJC 4YIKA 4YQEA 1Z8DA 5LBTA 1FXUA 5B6IA 2NPOA 1WV1A 1YRBA 2YJGA 3QKSB 1E9SA 4EVRA 2QUJA 5GTDA 1Z0UA 1QP7A 3TIGA 5CIUA 3W06A 4KWIA 3A6JA 2PKXA 1UZUA 4NZMA 3SX0A 3ZVLA 3H05A 3M6MD 5CGZA 2F3UA 1DEKA 4OHVA 4JA0A 4CMKA 3W8NA 3FYUC 1O5IA 1HFEL 4MUJA 3SLRA 5ULLA 1E2FA 3TW0A 2IS4A 1P62B 2ZE7A 4O6VA 4LI3X 2K87A 4D9NA 1MX1A 4CV0A 4OFBA 1FMJA 1NVVQ 4Y6QA 5L3SB 1O95A 3ZD9A 4CM4A 2JEOA 4ZRDA 1BVRA 4A91A 4RNCA 4PG4A 5ALFA 5CA1B 5KX5B 4EJFA 5L6MB 5KOJA 4J1SA 3KZNA 3DDNA 1AK1A 4G5XA 1A8QA 2V96A 5DBEX 5LZ7A 2NTVA 2D4HA 4FI3C 1KZ9A 1ZD9A 3L6UA 3QMVA 4DS3A 2Y1CA 1DOZA 4RCYA 4DLAA 4J29A 2QTTA 4KHZA 5FNVF 1CP2A 1Z5WA 5K0GA 4GP6A 5DU2A 1ACLA 3VSCA 3IA7A 4RWZA 2YWFA 3IJEB 1NJ2A 1I9CA 1T9GR 2RE8A 4LVNA 4MS4A 3W9SA 2WJJA 2J09A 1GDDA 2PL3A 3LX8A 4Q9KA 1ZJ5A 2OCBA 5TQ0B 1KF0A 3HFGA 3UOWA 3ZYCA 1G5QA 1U2DC 1SWWA 2GPYA 4AKSA 1R27A 2JHPA 5E7IA 1QK3A 4FFDA 3NGMA 4IJQA 4OCZA 3E9YA 2YHBA 3TLMA 3WP1B 4A10A 3OUUA 5CDYA 4OG2A 2OXFA 4IG4A 3N58A 1VRWA 1DQYA 4LHWA 3GZJA 3A6KA 3MPUA 4LZAA 4MUKA 3TUJC 4D81A 4D25A 4L2IB 5B3JA 3OLWA 4TKUB 2WE8A 4JA2A 3FDJA 2WJZB 4RQTA 4YTEA 3LOPA 1G5HA 3R0XA 1M34B 3D1VA 2YJNA 3GN1A 3LKDA 4N6OA 4Q6WA 1F2UA 1AHPA 3ROKA 1COWD 1W44A 5EEHA 3R7WA 3VUFA 2QLNA 4K8OA 1NZJA 1ZD1A 4HNAA 1OGJA 2UZAA 4CM8A 3EN0A 3IVCA 2W22A 4EA9A 1JHZA 3HCWA 2QE7A 1V4NA 2AMJA 3A4IA 1Q50A 3CH5A 1SU6A 3WK7A 4DQVA 3BT7A 1OA1A 2QTVA 1OXXK 4UTOA 4Z4CA 1QU3A 3LQQA 2CLOB 1JR6A 2ODEA 3OLZA 1XVUA 4B6EA 2J6BA 1FOEB 3GUZA 4RAQA 4EB6A 1IULA 4R51A 5TF4A 4V0RA 2VYND 1HZZA 5EE5B 1J0CA 4N6NA 1IRXA 1LPNA 3DUFA 4ZEOA 1C30B 3T7DA 5A71A 2D1FA 4I2VA 1UMBA 1FUYB 4UPEA 2RD2A 4CGZA 2RGXA 1JSRA 3DL0A 3VU3A 1Z88A 1SA0A 3L82B 4ZT2A 4AJIA 4ANFA 3AW8A 4QJIA 4YRIA 1EG2A 2OCYC 4D3DA 3DOOA 1BFDA 3OOEA 3RUPA 3RYCB 3B36A 3OPMA 3WSTA 1DKPA 4U7JA 3Q7RA 2F8MA 1YGYA 2Q3CA 3IUSA 3A9UA 2PLNA 1TM2A 3DF7A 1PV2A 3RRYA 3GGDA 5AK5A 5KNCA 2VTVA 1VKZA 2EHJA 4B3HA 5GONF 2JH8A 2YV2A 4DSZA 3AHGA 1SRQA 1J33A 4QEZA 1IPHA 2IYWA 4C7OB 3TQOA 4L4ZA 5E2BA 1WVGA 3MJSA 1KIFA 1OFHA 4YRSA 4HN2A 3UOAB 3S68A 2JIDA 3ZZUA 3N8IA 1J8FA 5J5VA 4QHSA 4NOLA 2GF0A 1ODTC 4MWSA 4BVAA 1WSDA 1SVIA 2VPQA 3DL7A 3HJAA 3QXHA 1FFBA 3AKYA 5G0UA 2AF3C 5IARA 5L6LB 1RE1A 3MUNA 3QWAA 4G4SP 3CRW1 3PUXA 1KDTA 3EFHA 3NO4A 3PDJA 5H5JA 1C7IA 1R9MA 3CR8A 3W1WA 3ZH9B 4F1WA 1P73A 2C99A 4A4DA 4LF7B 2FFRA 3MTAA 1F48A 2ZBVA 3K15A 3OX3A 1DIBA 2IW3A 3CPHA 6ADHA 2KBEA 1NFRA 2EJTA 1Z25A 1P5FA 4Q02A 2C7BA 3WLOA 1M8KA 1MJ5A 2NVUA 3S6JA 1BGXT 1ECJA 2OCGA 4EG6A 1Y6FA 3FW1A 2ZJ6A 4GUDA 3GL9A 5TQJA 1PW7A 3RB8A 3ZV7A 4CCYA 3HR7A 2C31A 2WWWA 4XGQA 5H68A 3TR5A 1BW9A 2R8RA 4HDSB 4QFDA 2DQYA 4K7JA 1RRPA 5KTYA 1FTQA 3PE4A 2L0XA 4BP3A 1JJIA 1E1NA 4F7WA 3M6WA 1ZINA 1U2EA 4L15A 5GOTA 3UJDA 4AJ4A 2ZROA 1HNXB 3EVEA 1FMFA 4LMPA 3T5DA 4UEWA 3TLCA 4BTEA 5ITVA 3HDGA 1QV7A 1ZGJA 2JFUA 1DKRA 3QU2A 4CQMD 5LQJA 3Q5GA 5AR1A 1AB6A 1KPIA 3WGLA 3I9FA 2FFAA 4MCHA 5LP6F 1KOGA 2RGCA 3M82A 3OAAA 2H5LA 4HQOA 4LDZA 5K4HA 1NXPA 1MX9A 4U6QA 2BF7A 3NP7A 5K3DA 3H5OA 3VYUB 1HLFA 2VL7A 3WB0A 4AJKA 4LNUA 4RK7A 4K9DA 1NVWQ 2EG9A 1JFFA 4AICA 3QPDA 4BJ1A 1OPRA 2J9RA 3SBEA 3A2MA 1J8MF 1C8VB 1U9YA 4QTZA 2Z4RA 5GM2A 1W5FA 4YV0A 1N36B 3ZDBA 3F1LA 4WXHA 2KYRA 1JDUA 4FTWA 1L6IA 1TL7C 5FQNA 3GJYA 4FDUA 1NVXQ 1X7WA 3Q15C 1K0UA 3I6IA 1YE5A 5JHGB 2IYPA 2YW2A 2XAAA 4XJTA 2VBIA 4EA7A 4QTYA 1V8BA 1N75A 1NLFA 3E53A 5CLFA 3HG7A 1O97D 2G9QA 1IJKA 1X13A 3DBIA 3L7BA 3PIIA 5ENDA 4ZCTA 4B3IA 2YMMA 3FY4A 3AESA 1VA5A 2UYOA 3IUBA 3GK3A 1Q5PA 2EFGA 2Q9UA 1OY1A 1QRDA 1XDWA 3DH0A 3PL1A 1UXGA 2EWMA 2J48A 2PX0A 3E9MA 3EIFA 1KBOA 3MJEA 5EPOA 4A0QA 4COOA 5BNFA 2XYVA 5AW8A 1KMHB 2YHUA 3SEAA 4KGXA 3TPCA 1IRIA 3HU1A 4QJ4A 2B20A 7REQA 2Z2IA 3ZU4A 3AI7A 1ZLXA 3O3OB 5K03A 1OAOC 1K8YB 2TMGA 3HPRA 3N1UA 3IHWA 5ER9A 1E1CA 2WKSA 4I5IA 4TMKA 5D5QA 3EY4A 1W47A 4GZ3A 5K6RA 4ZANA 3IQWA 4A9AA 2AS0A 1GWNA 1GR0A 3FMVA 5AK3A 1XG5A 4BNKA 2ZBPA 2PRKA 2RK6A 2XUJA 1OJLA 3CJRA 2IU3A 3NIBA 4IXWA 5G40A 4ZK6A 3UW3A 4ER0A 4DHEA 3ACCA 4RY8A 3AUTA 1Z7BA 4GOKA 1EX9A 4UEKA 5K3AA 3V4RA 1WS6A 1S9HA 4JEIA 4WJLA 4H7HA 1SK8A 3U1BA 5EGNA 1G21B 3CB2A 4KAFA 2KSQA 1WRBA 2Z2KA 4I5DA 2BGNA 3UB3A 5KVCA 2PD4A 1MDFA 2V7UA 3EMVA 1UZLA 2P69A 2FPWA 1R2QA 1FDWA 2GHRA 1H2RS 2HRRA 3HKDB 5F4ZA 3GLGE 3JQ8A 3IT2A 4FINA 4LRWA 1EUCA 1PLJA 3CY6A 1E8MA 3SYRA 1P9OA 4NXNB 1ZCAA 1HRKA 1LS1A 1CUSA 1Q1EA 4URFA 3SHVA 5DXFA 4BNZA 1EDOA 2O2EA 3EISA 3BQ9A 4FHZA 1O77A 4KH1A 4LZWA 2XMRA 2ZBGA 4URYR 5IAEA 1PWZA 2F8TA 4NRDA 1L1EA 2DPMA 2OP1A 1RT9A 2COKA 4QUEA 5E6RB 4HV4A 1PGPA 3WYGA 3E4CA 3QK7A 3TW8B 1X7HA 3FUCA 4RWEA 4AJNA 1YQTA 2ZBFA 5EYPA 2KI5A 2QAGC 3L8YA 2O2JA 2GK3A 4E5KA 1K4MA 4EUFA 2CFSA 1ZVVA 6YASA 2KHZA 3FOWA 5A9SA 4OA8A 3RS7A 1TCAA 3MGKA 3I2YX 1FQWA 4URWR 3KCNA 2QMOA 3IV7A 5HX7A 2ANBA 1VE5A 2QM7A 4IYJA 3F5SA 3OE4A 3NRCA 2BEUA 5HKAA 2Y1LA 3NT4A 3DM5A 5FDFA 1CJCA 2V9PA 4HVCA 3E8XA 4GWLA 4MV9A 5AM4A 1VG9B 5FLYA 3LTNC 3EXG2 3EXG1 2O2HA 1MD9A 3UMRA 5TGDA 1AZSC 4CV1A 4ZZ0A 4TN5A 1T2VA 2Y3IA 5ALYA 1N5LA 2Q3FA 4MV1A 4A0HA 8GPBA 1KI7A 1FYFA 2EKLA 2IX9A 2ZYHA 1AURA 4DXDA 1H2WA 2G72A 4F9TA 10MHA 5ERYA 2DBVO 4DC1A 4K6KA 5EQFA 2ATVA 4HAXA 4HDOB 4M46A 1IDOA 3S5UA 3VM6A 4IRMA 4JLSA 4LJ6A 3BJZA 3FHOA 2V4ZA 5HEKA 3UOGA 2LC3A 2CK3A 3IBTA 3G2LA 3NFYA 5EJ8A 1IEQA 4PS1A 5EIWA 4IDNA 3T6KA 4EGJA 3T94A 3DDZX 4UHEA 5EKDA 2WHPA 1UK8A 5E3JA 4B6JA 2WD8A 4OO3A 4CT5A 1MAUA 1RXUA 3NU1A 3ETGA 1GFWA 2IXEA 4XOUA 2PKYX 1YVUA 3ANTA 3KQSA 2IDJA 4MSUA 1P0MA 2FW7A 2ZJ8A 1A50B 1T3SA 1LV8A 4CI0B 4EAQA 3OTOB 3U7GA 2FN8A 1H5NA 2HJSA 4FYIA 1O8BA 5FPPA 2YASA 4JC8A 1B41A 1C3LA 2D5CA 2ZYUX 1E2PA 1NBMA 4TWAA 1FRFS 3GOHA 1K89A 4DEYA 4I5FA 4NAUA 3QX3A 5KB3A 3VR4H 5FR2A 5GIPE 4IFEA 2VTBA 2YIDA 2OHHA 1TUEA 4KGVA 3S1LA 3SYLA 3ENWA 4PO9A 4CMBA 3A06A 5E9QA 2FEKA 5I9IA 5DGCA 3I6MA 3FTPA 4OMDA 2XX3A 5IAJA 2K2WA 5HKKD 4Y67A 4ZO9A 5DVZA 4NNJA 1KDZA 1NVEA 2RG1A 3CO0S 5KC9A 5G41A 2N1MA 1GSOA 1HUQA 1G5IA 3E48A 4RVOA 5IN5A 1QDEA 2HMTA 3PE3A 4Y6GB 3VR1A 3K35A 2HPVA 5D2CA 3WJ7A 4BGEA 3WGHA 3UAVA 4KK3A 3AEZA 2FG5A 2OM2A 3OZFA 2OHIA 1ZM9A 2W83A 3LUGA 3HFJA 4I1RA 4MVJI 3QYJA 2IYYA 1IE3A 5BPHA 1YR2A 4I4IA 4D42A 3SHWA 5JZ9A 1SEVA 3B1KA 4XASA 1X38A 2A9FA 1E2NA 2R65A 2V58A 4JBHA 4KFRA 2LBPA 1XDDA 2ONZA 1VSBA 4LZNA 4UEQA 4H2DA 1RKBA 2HSZA 2XZDA 1TUGA 4EW2A 4QYMA 4LBVA 5DHQA 5JD6A 1H9EA 3JYQA 1BHJA 4OLBA 3HYLA 1QZTA 3FGZA 3I6ZA 2WFLB 3F3MA 3KSDO 2Q8QA 2YY6A 3VZQA 1I13A 2PUGA 2VOJA 1L4EA 2P9GA 3KXDA 4OSEA 3SSNA 2HU2A 2ZJ1A 3HRIA 1U3GA 1CT9A 4C4YA 1J1IA 2LCIA 3VNRA 4JV5B 4ZAFA 1I5OA 4RTJA 1G4HA 1AS2A 3GFPA 3SHQA 3V46A 3TLAA 3Q2KA 4CKWB 1MIOA 3ZG6A 3Q10A 2EVWX 1EGAA 1SPBS 4W7SA 4TSKA 1NHWA 4RVFA 1W5BA 3A2KA 4QUGA 4R1PA 1PR1A 3HXPA 4H3SA 2I2BA 4YRGA 2PR2A 3WE7A 1ZJYA 4O02B 2FUEA 2FWIA 3Q8XB 4UE3S 4YWHA 2PN1A 3GVPA 4N39A 4RGBA 3S5JA 1CRPA 1Y3IA 3TNFA 4HF7A 4JUCA 3OPYB 2PNFA 3EIWA 1AA6A 3GHHA 2HMSA 2AMLA 1ENYA 4W5TA 2WSSD 4Q3OA 3HA7A 4ES6A 1G2OA 1Q77A 2BM9A 4Z7NB 3UGJA 5AI8A 3G8YA 3EOZA 4LTNA 2QAIA 2H29A 1JFRA 5ER6A 4DVGA 2XWQA 5KQLA 2BFCB 3PNLA 2WT9A 2ECFA 2PBRA 4HYYA 3CV3A 3H2GA 1L7XA 5HE8A 3DNPA 3M4NA 2QIPA 1LB1B 2ZSFA 4L51A 1NF2A 3IUJA 1NDQA 1XAIA 5T3UA 4GLFA 2UZIR 1E8NA 4ALIA 4FDAA 5F1KA 3VMFA 3JQEA 5JS6A 4DT1A 5I7SA 2IOQA 5FYQA 1SGWA 1PJBA 1RVDA 1S8FA 4R8SA 1YT5A 3IIEA 3BICA 1WMAA 3HGMA 4LQDA 5F9HA 2QXTA 4Q4AB 1DBVO 2BISA 3EMDA 3HBLA 1ZVKA 4FE4A 5DWQA 1F3LA 5KTMA 2IYUA 3ITDA 1CUXA 3PTZA 2O2YA 2AE1A 2HU7A 3FOZA 5EY5B 5J5AA 2GEBA 2OO7A 1NW4A 2FSVC 4JLKA 4XXHA 2E85A 4PYJA 1MG5A 2COEA 4XVCA 3NPMA 3KEGA 1KRHA 1P75A 1RI2A 2IT1A 3HEAA 4E32A 8LDHA 5K5EA 4RM2A 1IN4A 4BV9A 2YKGA 2PY6A 3QVUA 4ZZ3A 4INZA 4P93A 1J0XO 3NONA 3WLIA 4DLRA 5JFGA 3VNUA 2YY7A 4YECA 3IBGA 5FKJA 2HA6A 1H4VB 1PS9A 3WKAA 3C6MA 4J2TA 4BP9A 4H1WA 1FRNA 3PGXA 1WETA 121PA 1RKXA 1N0WA 5BSEA 1SCUB 4UEOA 2VR1A 5JVDB 4RX1A 5DCUA 2IUYA 1KAMA 3LUCA 2QR2A 5FL3A 3UHAA 1C7EA 4J9VA 4RABA 2ZTLA 4F2HA 1ZO8A 3QFSA 1L8QA 2HF2A 2RB5A 3M1AA 4KQ9A 3K9CA 3O4HA 1DAHA 4MVJD 3QH4A 3NG1A 3A8TA 4FFWA 3PEVA 1TJNA 3GFGA 2HBZA 2X0RA 1E99A 1E9EA 1FVXA 2Q5HA 1R6BX 3SSAA 1RPAA 1JU3A 2X2FA 3PQ2A 5FLXA 1EK2A 1HTWA 2GAOA 4ZICA 3ASYA 1H2EA 3IPCA 3AVXA 1V9SA 1RHKA 2GYVA 1L8XA 1ZHFA 1IWBB 1X2EA 3C8DA 1NMZA 3GRRA 1R3DA 2C97A 2XYHA 3SXJA 4B6PA 3DC7A 2A9RA 5C0OE 1HR0B 1NF8A 3MG9A 3RKUA 2FR0A 1G59A 2I4NA 1Z39A 5E1MA 5CNMA 3ZGLA 1JU9A 4DCTA 4FMDB 5K0LA 1X1DA 2TMKA 4MKFA 2NPFA 2WMOB 4ZT6A 4BVKA 2C2YA 1ZI6A 4S1WA 3PFWO 3V6LA 4WNCA 3IT1A 3SFZA 1NN5A 2X7HA 2EGHA 5B58C 3VH3A 1JR3A 3WGVA 4DLXA 1X8JA 4P81A 2R2GA 1EWKA 4V02A 2WYOA 2EL7A 1MABA 1QQTA 2ZDGA 2ZUDA 4YAFA 1JDVA 3UJBA 3QNWA 2IL1A 3Q11A 2OFXA 2OV6A 4DFDA 3ZJTA 4LDPA 1PGQA 1T9KA 3DZFA 3IDZA 4EPXA 4Y2PA 5MDHA 1N4AA 4HPXB 3FKJA 2XVXA 1IXSB 3GJSA 1RWVA 2AC7A 2AFIE 3IKJA 2J0UA 3L4SO 4HLUC 3OOYA 4D0RA 1CDEA 3GJZA 2WPDD 1ZIOA 2M6KA 1FL9A 3VC1A 4RD3A 3ZWBA 4N0QA 1IOLA 4TV8F 4YMLA 5E7JA 3K1TA 4HLDA 1DLJA 1SAYA 2BTOA 2GBLA 2DK4A 1Y5RA 5JO9A 1GQRA 2EKQA 3MPOA 1U4OA 1SD2A 1K7FB 3ZVKA 2CFIA 5H59A 3IB6A 3ZLJA 4EELA 4G56A 4E11A 3QV2A 2CFOA 1VMAA 5LBIA 5IHPA 4EW6A 2D2IA 3L0BA 4LYFA 5KYYB 2JW5A 2ZBUA 3SF8B 2PPLA 2QTMA 1PL7A 3FKSA 2OHFA 4UAGA 4BEJA 2I2CA 1GQ2A 4H27A 3CRZA 4IICA 2QDKA 3UFXA 2Q1YA 3OZEA 4DYHA 5I8WA 1EX6A 2PRSA 4C3VA 3L4BA 5KNBD 2QV0A 4PHTA 4JUFA 1APBA 3CEHA 1R0LA 1QHEA 1X8KA 3HU2A 4NE2A 1YB2A 2G70A 4WK4B 4YP7A 1WY7A 3THYB 1A82A 4DIFA 4KRYA 5FOTA 2GHTA 1RAAA 4OIFA 3KPUA 2VI5A 1CEYA 3AGPA 4LC9A 4D9GA 2RHDA 2RJ3A 5A04A 1Y6GA 5EIHA 1PF7E 2RFLA 4H7JA 4NU5A 4R1NA 3ZXSA 1T4MA 5I3CA 1VP9A 3GVHA 2H08A 5EWMA 1XZDA 3NHMA 4KL8S 4XZ3A 3PGKA 4RL6A 4NMHA 2BBWA 3KJXA 5IJXA 3ROMA 4BFWA 4RJIA 5COBA 1KP2A 4JI7B 4MW1A 4N03A 3IVRA 4MUXA 3PSHA 1L2TA 5DN6D 2E4WA 4PLHA 1AN0A 4X1IA 1OZ0A 3EVDA 3KJEA 4N3NA 4MICA 1NUUA 1JA0A 1PK8A 2YFKA 3OA0A 4OFZA 3EQZA 1K92A 2OV1A 1E4EB 3O0DA 3ITNA 1U63A 1UQUA 5THQA 5FLEX 3OJWA 2BFFB 2J85A 3KWMA 2Z56A 2DQSA 1W94A 3FYDA 3PDHA 1M2KA 2PX2A 2JCGA 3K8ZA 3DTTA 3R4CA 2P68A 5DN9A 1XMJA 5G02A 3TPZA 4UHJA 4CFZA 2WQ7A 1JLLB 1K6JA 3DVAB 1P81A 3RAEC 1I7SB 2UUAB 1J39A 3LS2A 3HFRA 6LDHA 1XTUA 3PU6A 1XQ1A 5PGMA 4A15A 1MB4A 2WC1A 4US0R 3KQLA 3NCHA 2WVJA 3AR7A 2FW1A 1GZSA 4X94A 3RYIA 3FCEA 3THSA 2P1RA 2DERA 1W73A 4KR6A 2QN6A 3W4IA 1WDTA 2OAEA 3G1TA 5TF0A 4L1KA 1I3OA 1OMOA 3HWWA 1VPWA 3EXIA 2PUAA 2GI4A 4X66B 3O83A 1JEJA 3DXXA 3FNEA 3FHLA 1PJSA 3EC2A 4MZDA 2XCQA 4JEUA 4MI3A 4J0IA 1TU3A 2JFGA 1SXQA 5HXAA 1CUAA 1QFZA 4J43A 5DPMA 5JZMA 4HEA6 3E8MA 1WIWA 3O4GA 4Q19A 3STHA 3HFSA 2F1OA 3W2TA 1A2KC 2KWIA 4GHWA 4Q9DA 3U7QA 2DHQA 5HTOA 3SKVA 1UWCA 4M83A 4BIMA 1Z63A 4RV5A 1OIWA 2E4AA 4F56A 3WWOA 5DYGA 4UOQA 1NM5A 3AEKB 4L9RA 3P9RA 3BA6A 4F72A 3RGGA 5E3HA 4PAWA 2B4KA 5JC1A 2DHRA 3NHKA 1ESEA 4FHGA 2O0MA 2I6FA 4HQLA 2JGRA 4DRYA 4EWLA 1DG9A 3A6DA 2PUWA 4FNGA 1PR4A 1VJCA 3P9ZA 4Z9BA 2BE7A 2MSWA 1OFVA 4X95A 4I55B 4ZVPA 2UAGA 1TK3A 3PGA1 1FX1A 2FJPA 2O0KA 2XGMA 2JD2A 2W2MA 3BVPA 3CG4A 5CD1A 1XTZA 2HDNB 2QZ4A 2I3GA 1ONBA 1YQDA 1Y3AA 2VUHB 1JFTA 3RRZA 4HGQA 3R20A 2DPXA 2CLCX 3AHHA 4KREA 3ANYB 1ZD2P 4Y9RA 4UVEA 4WKBA 2OM6A 4BITA 2BONA 5T6MA 1XRLA 4CODB 4MIKA 2WE7A 4MYRA 4G84A 1UZAA 3KZMA 3NGLA 4KYVA 2RK4A 1ZIXA 3N2GB 3MTDA 4BFXA 4Z3KA 2H7YA 3HS3A 4G0QA 2O3TA 1TJ3A 3KKMA 4PZEA 3I42A 4IMJB 4EKIA 1TGVA 2A92A 1KR2A 3KCQA 5IDYA 4KPFC 4AY5A 1PFKA 4RCZA 4EZEA 5FPSA 2AG1A 1T6BY 1OGIA 1GU0A 1LBQA 3UAZA 3CZ9A 3DE7X 1YHNA 1P72A 1ZNYA 4A1FA 1ZSNA 2LUOA 3SJ7A 3LYUA 3NYWA 1ETUA 4B31A 3KPWA 5CXUA 1IQUA 5TDHA 4X8HA 5DP2A 1JWBB 1BROA 2OAP1 1T2FA 4Q7LA 4O1MA 2Z2ZA 1T9DA 1JSLA 2PBZA 4M1OA 2O20A 1UBLS 1YJQA 1SOUA 4LMBA 1LRLA 2QN1A 4PSUA 1UPBA 1GM5A 4FFPA 4HGPA 1NYQA 1XTJA 2FPXA 1GKIA 1KJYA 2X40A 1V26A 1BX0A 4R6XA 1DZIA 2FKNA 4WDRA 4BU1A 4R8RA 1BVUA 5LYJB 2IHBA 2NW6A 3LWBA 2EIHA 1AXGA 3EQ7A 4L22A 3WDSA 3I4CA 1JLKA 3FTEA 2IITA 1WCXA 1DIHA 3OJXA 2H5EA 4OXNA 4UNPA 3P4YA 4X3CA 1IUOA 1B2LA 4BWYA 2HCTA 1XL1A 4H0FA 5CVVA 3U6KA 1T15A 2EEPA 4TQ9A 1RYEA 1U98A 2W0SA 4U3JB 1Z2AA 4U2EA 3UHPA 3MWKA 2VZ8A 4JUDX 1M7GA 1YCFA 3OJFA 1J90A 4LECA 3W7BA 4G1FA 5LZ2A 1NZDA 4JLBA 1E9FA 1JI3A 2O57A 4OBXA 2OYCA 5A6SB 4AIIA 1B2RA 1CR0A 2M6RA 5L3QA 3N8HA 2R87A 2NO6A 2RCYA 2YTZA 2A1IA 3F6CA 2WHRA 1JFLA 3G7SA 4JSRA 4P5EA 8ABPA 1IZ7A 3Q1LA 3JZIA 4RHXA 1QTNA 1LSJA 3N8NA 4IHKA 1NJ8A 2A5LA 2N47A 3GCWA 1S3FA 1MOQA 3SZGA 3TQCA 1DWOA 3U60B 1EXNA 5FYDA 1M8JA 4GOMD 1CETA 5I7OA 1Z08A 5TPZD 3MAGA 5DULA 2XB4A 4CHTA 4DBZA 4N0EA 1PNVA 3TQIA 3HKCA 4K2HA 4UATA 4ML3A 3A4YA 3QENA 4BFLA 4D57A 3A1DA 1C0PA 1BX3A 1V2GA 1G6OA 4YLEA 3RIHA 2XUQA 4QBTA 3JALB 4BCCA 1UWKA 1QLHA 4BO0A 2QW8A 2W4MA 5K09A 2YY5A 5CA0A 3V32A 5A4FS 1VPEA 3GOQA 5HIJA 1XZQA 3N6RA 1R0RE 4G5GA 3U13A 3RS8A 5DWDA 3QEAZ 1UJ6A 3S1SA 3HB7A 1WY5A 3ZE7A 3B9BA 1OFUX 4CLOA 1KNXA 1O89A 1TQHA 3C3JA 4GKAA 3MERA 4US2R 1D7AA 1Z12A 2PMWB 2XXAA 3BC1A 4LNAA 5J63A 1DJPA 2F9MA 4AURA 4P4NA 1WF6A 4XPIA 2FRVA 3GJ5A 4FYXA 5BSGA 3CSSA 4ENWA 5DTQA 5AVWA 2I29A 4ZKDA 2C54A 1UM9A 4U7DA 4XLTA 1T4GA 4IIJB 2PZJA 3A0UA 1WCIA 4MX8A 1JIIA 4UTXA 4BVHA 4UDOA 2RHLA 3RU2A 1LU9A 3ZTYA 3PENA 3ONVA 3QX9A 3ZTTA 3FWPA 3UMMA 3P8ZA 1RWPA 3IAUA 2D1SA 3DOUA 3Q40A 2JLWA 3ZWQA 2BKAA 1V9LA 2BEWB 2IPLA 5C7IO 3LFTA 4N8EA 4BY9E 2PX5A 2Q4EA 4KDCA 5C4IA 4JYZA 4ENQA 5BMVB 1EWTA 2IEIA 4WHMA 2H2HA 1P77A 1SUSA 4TMXA 2EFJA 5G53C 4F1JA 2O1XA 3OPNA 1GQFA 2BEVB 2DFTA 2O7SA 2C5BA 1BE0A 4E08A 3SZLA 3K96A 2XGJA 3KL4A 3JWJA 2PGXA 2Y76A 4AU1A 5U1PA 5J1SB 1UBNA 4QNMA 3T7RA 3WL7A 3DJFA 1C14A 2FKAA 1BWQA 5ALDA 2YWBA 3HEMA 3URMA 1T3LA 1E1RD 4UBKA 3THXA 1JR4A 2WA1A 4URVR 3I9NA 4DPKA 2X8JB 3NIDB 3TG8A 3A14A 2ATCA 2WG2A 2Y1KA 3F7TA 3K70D 4TLDA 2PQ6A 1DEXA 3DNFA 3JAKB 2P9TA 1PJLA 3KAQA 4N5IX 1XEWY 1VYHA 3C3CA 5KYNA 2QUIA 1S2IA 3B5IA 4UD6A 5C32A 3WBJA 4X6UA 4FT4A 4NICA 2EP8A 1RC8A 4PGGA 2WSMA 2XITA 1XZLA 2QM0A 3UG6A 1U7UA 3L40A 2XPCA 2C9YA 3L7NA 1Z45A 1WDKA 4KR0A 3TG2A 3W6UA 1QVAA 4LF5B 3M7IA 4CMGA 2M9MA 5CD9A 5AD1A 4W6ZA 2VNIA 1UPXA 1PSZA 4W1PA 1IOWA 5T8KC 2J41A 3RYFB 4DG5A 2J33A 3FYUA 4OKSA 4RVNA 4TLAA 1TEVA 3KO8A 4H77A 3ILYA 4PYIA 1YQQA 2E7ZA 4YJ3B 3KEMA 4BEBA 3DLAA 2ZSEA 1N5MA 4LF6B 3NX4A 3VKVA 1MAAA 2E5FA 5FBKA 1R8SA 4M0PA 4C6TB 2G83A 4YV1A 2TYSB 1QYXA 3DE4X 3AUFA 4N5LA 2X0EA 3CEJA 2ZYGA 2GR9A 3ZX4A 2AMVA 4YRFA 4NMXB 3BGIA 2AXPA 4M6WB 4FWTA 4JNKA 5DWVA 3DZ8A 4O2BA 2CCKA 3D6HA 3LK7A 4HX2A 4O8ZA 4UXIA 3TOCA 4NY1A 4DCOA 4F6CA 4WZBE 3QM1A 3F8SA 4IY1A 4B83A 4OTZA 3GG2A 4BO8A 2F43B 3AWDA 3N2NA 1XNJA 1B42A 2EX1A 5FTMA 1CJVC 4KX3A 1JIXA 3U44B 1W88A 1UXJA 1X14A 2EERA 2OE2A 3K2BA 1A5AB 1CUBA 1QDLB 3LLVA 1KYTA 3N07A 3UENA 3VYTB 5HZKA 3PJEA 3GUCA 3HUEA 2VDLB 5I7WA 1R0BA 3QEKA 5BN1A 3BE6A 2LNDA 1E0JA 2YW9A 4IGFA 4W5WA 5EVCA 4MRPA 3VYRB 2VVTA 5ALEA 3CXUA 3PIRA 2OXRA 3EDYA 3PP8A 5FPTA 1OFIA 5LMUB 1DCKA 1OLUA 4YDQA 1HKHA 4LJ4A 4E7OA 2P9BA 2REQA 2ZPAA 4Z2YA 3JARB 1XRMA 3HJBA 3R74A 1JG6A 1ZKDA 4QM6A 3HVJA 1HL3A 4PR3A 3J81A 1UXKA 5J23A 1IAVA 1DRKA 3KT0A 4BQNA 1J7KA 3FGPA 5PNTA 4G41A 4B1FA 2AUNA 1VCHA 3UVEA 3UT5A 1V5EA 1N3YA 3LI2A 2NT3A 2W6ID 2KB0A 1KI1A 4XH9B 4E5UA 4X97A 1TVCA 4NFSA 1SXJD 1ZRSA 3KKZA 3PFCA 1Y9AA 2VQSA 3MGGA 5ALKA 1GGMA 3IKVA 3NHUA 4PG5A 1KWGA 5EA2A 1HA3A 4OGGA 4X7MA 5EINA 2VRWA 4CLRB 3IOMA 3ZDAA 4CKCB 4MIOA 2AI1A 2LXNA 3JXEA 4IUBS 4ZOLF 1K3TA 4TL9A 2H48A 4G1CA 3UAWA 2EP7A 4EHNA 1VJRA 2CLSA 4KRFA 1VHTA 2BUAA 3AP2A 2R8YA 1PGJA 2IGTA 1ZCJA 3ZCXA 2X1VA 2RGWA 3DBVO 3HYTA 3S2FA 3U0VA 4LFAB 4LF8B 1RBYA 1O08A 1YCGA 4JLDA 4PR0A 3DO6A 5LD2C 3GUVA 4XX1A 4BFTA 3HYSA 4GM4A 3BD9A 4G65A 3AHDA 1TO2E 3V3TA 5AIBA 1WZCA 1VCIA 1EWQA 5HS6A 4HDQB 4HDKB 4NDZA 5LC1A 2NU7A 3O4IA 4ZREA 5AUPB 3K5IA 1FF9A 2WIKA 4WNIA 5FFFA 1E2HA 5KYVA 1B6RA 1E2IA 1XK6A 2XVZA 9ATCA 1X19A 2ALJA 3L02A 1E7LA 2W6QA 2ZG6A 4J0EA 2LIVA 4KSCA 2Q4OA 3HUDA 1R9NA 1E9RA 5BV7A 3SIXA 3LC0A 5K2OA 3NBKA 1Z4OA 2QJWA 3KQVA 4AXBA 4R1MA 2RBKA 3B6ZA 3DVLA 1ZK1A 3GVIA 2WIGA 2B1GA 4QOFA 5I9BA 1BDJA 1TTPB 4YASA 3O1LA 3AL2A 1N2OA 4HQ6A 3OG9A 2OD7A 2OOKA 1UH5A 3LHKA 4R2JA 3EHEA 4FS3A 3H8JA 1V43A 2P4UA 1H2XA 2P4HX 3T7AA 5ALWA 1TAUA 1TZKA 5EXTA 3IQEA 3AETB 1O6CA 1KA9H 1SVWA 3D8SA 3NUZA 3MWGA 4Q1BA 3BE8A 4Y6SA 3VAAA 3L0OA 3O8QB 3ZGVA 2Z3ZA 3N70A 4HDNB 4BNVA 1EUDB 4LXUA 4R2WA 1BDMA 1WXEA 4YFVA 4DJAA 4X6XA 4F4FA 5EQDA 2D0DA 2VZEA 2GPBA 5KYWB 2XA9A 2HIHA 1MXFA 3C6XA 2I22A 3DXYA 3GNSA 3T7KA 3JPYA 1YR9A 2I8LA 4QASA 3QBDA 2GMWA 1N57A 4EG8A 2WTUA 3B13B 3SC4A 1EXWA 2A5GA 2QKYA 4HK4A 4QAJA 4MQEB 2Y0BA 5J2UA 2VUIB 5CCEA 1V37A 5BNZA 1C9YA 5CP8A 3NTOA 5GP1A 5KOHA 3AF6A 3N0WA 2ZULA 2UVQA 4FJ1A 2PX4A 2V7TA 1PR3A 3HVHA 1WBDA 1D8AA 1UDRA 3C39A 4UNQA 2BTEA 2H7VA 3IXQA 3H2JA 1HDGO 4EA8A 1CLEA 3QFHA 3OIDA 3C7CB 4TPKA 4Q3EA 5F2NA 1JMVA 2FSHA 3B7GA 1YR3A 1AGPA 1X77A 3OEYA 1RJ9A 2AYYA 1U5BB 3RVPA 3QBEA 4H1HA 3RWMB 4C0QC 2QOEA 4UQOA 1A7KA 1Y1RA 3S8EA 2P1DA 1JVBA 2Z2YA 3LJKA 3W6OA 1N2GA 1NWCA 3WC4A 3NW9A 4IF4A 3FGOA 3SS9X 3DDSA 4F3YA 4ESVA 1NI4A 5I8ZA 1NE2A 1UAGA 1B15A 1XD2B 5DCWA 5GADl 4RPHA 4QEKA 1ISJA 3TSAA 1R3UA 3DTVA 1MF7A 4AMZA 1J8QA 4NMLA 1WVMA 1XFAA 1XN4A 5JALA 4JMLA 5DNWA 1Z6GA 5DW3A 2AF4C 4CEHA 3K9GA 2ZUVA 4CFYA 3RAJA 2YYSA 3LC1O 4HNQA 1VI2A 4EO4A 3C5WP 4QO8A 1QJCA 1I4LD 1QHNA 5EG5A 3V8MA 3VDQA 2ROQA 1PV1A 3I2KA 4J0GA 3MAAC 4RK5A 3WQRA 1N5RA 1DRJA 3MOSA 1PZHA 1OX5A 2VLIA 4RENA 3KEFA 3T8YA 2HT6A 2OUIA 1DDIA 1OAOA 3FCUB 2BPOA 3BL8A 3IE0A 2OXCA 4K81B 2Q27A 5JXJA 1AX9A 1ZFNA 4J07A 3H5WA 4MLPA 1HV8A 1SULA 2C2HA 1K4YA 2GZHA 2O2ZA 2ZIAA 4GO1A 4TXLA 2WJPA 2X4GA 5FUVA 3RS0A 4ZIRA 5KWVA 2C0PA 1DKUA 2CUZA 4HI0E 3P32A 4G86A 4IGAA 2QMZA 2P9FA 4Q82A 3ZHCA 4JT8A 4L72A 1KE2A 2FUG6 3H1FA 4UFOA 2A3RA 2J3KA 4XDGA 2P3LA 4CUKA 4B3TB 3BSWA 3MTQA 5ALUA 1FCJA 2L2QA 3OKPA 1R66A 5DGDA 3X1JA 4UCWA 1KJZA 2Y66A 5JV5A 3B8HA 3UAXA 4G5QA 3OMXA 1QMPA 3OM9A 1P61B 2ZS9A 4A26A 3BBLA 4U7PB 3DBRB 5A4DA 3HJGA 3WMRA 1WZEA 3RK0A 4CHGA 2WOJA 3M4XA 4W7IA 3WLTA 3M4ZA 2H59A 3B5JA 1C9MA 3G5AA 2CLHB 3ESRA 3K0FB 1Y33E 4B3RB 1NZFA 2X6TA 1XZEA 4L4UA 1GGFA 1KO7A 1M2EA 2WW8A 4CF5A 2ACWA 1M1XB 4IQ4A 3EQ9A 4OHFA 4EEKA 3TRFA 2B9VA 4UC0A 4RZ2A 1EZZA 1UT6A 1JHVA 1QH8A 2ONKA 3ROPA 4RJJA 3BERA 2DKNA 3AM5A 2ZI6A 3ASVA 4MIYA 3ZHXA 5M5BA 1QH0A 3KE8A 2G88A 4OGKA 3DQZA 3M5PA 4IJVA 4LZOA 1IM5A 4NE9A 3TNDA 5K3EA 2P6UA 3FMGA 2Z2XA 4MW6A 1T5BA 1I1QB 2IYZA 1JEQA 2F62A 2QAGA 1EWYA 3G0IA 4UDXX 4CRWB 3IIKA 4EKGA 1I2MA 1F20A 1ZICA 2IPAB 4AJ1A 4EFKA 3C5EA 4KN6A 5IBRA 1H9CA 2HA3A 2DPYA 4JLOA 4PCUA 4P5DA 1KMQA 1SCIA 2ZSKA 3WHIA 2FR8A 3AR6A 1N6KA 4N3AA 1DAIA 5EWLB 5EMNA 5SZKB 5LNK1 3SBOA 2VJLA 1U0RA 2VP4A 3LKBA 4QUBA 4R54A 4XFDA 4D0NA 3HKBA 1LS6A 2HK8A 1U9IC 3I9OA 4KE8A 3K4HA 3SQOA 3BCSA 3FSJX 1R6AA 1U28C 4DV7B 1BCSB 4J4BA 4EM6A 3HKEA 1NW3A 3LHDA 3OBBA 4L6IA 1FU8A 1O94C 4AJEA 4BUJA 2D0OB 2UVPB 2G5CA 4JJ6A 2CJWB 2OCAA 4LOLA 1ECFA 1BO6A 1JPJA 1SOMA 1SVKA 1ZG3A 3HNPA 3RSHA 2RGDA 3D4IA 2O19A 4OYYA 1U0BB 5G0SA 1E6MA 1Z2OX 1XPOA 4CKEA 4G0NA 1II8B 4W5OA 4BXOA 2NU6B 1GFZA 3N0RA 4WINA 5E9JA 1P0QA 2ZVPX 4G1BA 5FUBA 1HDOA 5A0FA 3OIYA 1K75A 1F0NA 1ELOA 1YULA 1V6CA 4OXIA 1J0AA 4AT1A 1F51E 4BCDA 1WXFA 5CFMA 3J7AC 2Q8PA 4LRSB 5JMOA 3UKDA 3VHXA 3OEHA 2H7CA 4NV3A 3U7EB 1VCMA 5LMCA 2JIQA 3FN4A 1THMA 2LV8A 3SHFA 3Q7EA 1T5HX 3T3DA 4DCCA 1JG2A 3WFJA 2P30A 1TIPA 2CMGA 2JLYA 1IC6A 3QFFA 2B3DA 1MU0A 2H07A 5CDHA 3JD0A 3FZGA 2GNAA 2AJDA 2FPGA 3ZU6A 4I6JA 1Y4ZA 4ZOBA 4OAPA 1N6IA 4QT0A 2AV6A 1EJBA 1A69A 2M1ZA 1GAJA 3S4YA 2VQ6A 3OCJA 4DR7B 1NOIA 5LOVF 5B7QA 3K8YA 3T5MA 1B7GO 2A5DA 3E3AA 5AJUA 5B7GA 2VT6A 4GL2A 4X93A 3EFOA 1QYIA 3WRXA 5DGHA 3WGOA 3LY5A 2JRLA 1E61A 1BGWA 3CVJA 3H9CA 3VYVA 1VL2A 2W2NA 1GU7A 5JSZB 1LGYA 1M2JA 1P9RA 3UAOA 1ESNA 5JBIA 3PDIA 1GGHA 2AUTA 2CSUA 5FTWA 2V4UA 4OQYA 4M1QA 5J58A 1MNAA 3A6HA 1CV2A 1U3UA 1ZM2A 1SBHA 3PQ8A 5ALIA 4AKIA 1EFVA 2QJRA 3CWZA 1LK0A 4HS9A 2QG4A 5JT1A 2OECA 2HCJB 4O3MA 2N75A 1H1LB 4K03A 3TX6A 5TGZA 3VOAA 4BNMA 5DM4A 4EFMA 3VKUA 1F60A 4ETIA 3CR3C 4G26A 2G0TA 4G1UC 1U0OC 1KR5A 4PBSA 3OCVA 1ARZA 1CD5A 5LQAA 1RLMA 1QIJA 2AZDA 4DCPA 4II7A 4JITA 4YMHA 1MDBA 1CQIB 3C4VA 1YGPA 3RU9A 3B9QA 1L5OA 1U90A 3L93A 1T4DA 4BN5A 4BZWA 4B44A 2VDPB 1QBGA 4R0MA 3DE3X 4F8EA 3EH1A 5CURA 5TGTA 4Z3OA 1LW7A 1ZLYA 2POCA 2Z98A 1LJLA 4ILKA 4ILEA 1DTSA 2QEQA 4MEBA 1O6GA 2RONA 4RDIA 5CX1A 4EATA 5ADUS 4BVLA 1EDDA 4JJGA 4ME6A 2MYPA 3F97A 7MHTA 1Y9EA 3W3AA 4ARCA 1K7EB 3U37A 4X7PA 1ZM3A 1VHWA 1KPGA 3FYCA 1XDUA 3GU3A 3RAGA 2JIZD 4MQFA 5ALGA 3FTNA 3RHFA 3VU9B 2P2DA 3DWEX 3U4IA 1FXSA 3OQBA 1EFRA 4RSMA 1XTSA 4UHFA 3MYYA 3EXHC 5AK6A 3L0IB 1MX5A 2NZ2A 3GNQA 4G25A 2ZR9A 5ILOA 2QVCA 3PYXA 2L17A 4FX2A 4R8KA 1KVQA 3F5DA 3NT2A 1QUEA 3KTAB 5CW1A 3ZHBA 3ZWKA 4DBVO 1K5GA 2DJ5A 4NENB 4DAEA 1PQUA 5K51A 3TOSA 4BJ5A 1FZTA 1XLWA 3C48A 1P7WA 3OLCX 5DP1A 3M5CA 1W85B 1A9QA 1AT1A 2NV2B 3EVFA 4OB8A 1LSSA 1CZKA 1NBME 4GPD1 3U40A 3W6PA 5G1PA 1NU8A 2BN4A 3M89A 3DWFA 5NLLA 1LY1A 3CN7A 1NYRA 2IFTA 2YHAA 3EAFA 1ZU5A 3EPRA 4BNDA 2DQZA 1J5XA 3GDHA 4ND8B 4DIUA 1IM8A 3DKRA 3PUYA 3ZNQA 1H0HA 3TD9A 5DM70 3PVSA 1RNLA 4H4DA 3G2KA 5IVIA 2RIRA 3VC3A 2OFPA 3I53A 4TWZA 2OORC 2RGGA 1J9GA 1RQRA 2FDXA 4WV3A 3MWYW 2O8EA 1RM5A 2A4KA 3RT9A 1OXBB 2BTQA 4ZEVA 3CX6A 4R6WA 3TLXA 2HZBA 3O84A 1O0BA 4PAOA 4WXPA 4QYIA 3JVEA 4GPEA 3V1MA 5CG2A 3MCZA 3L2OB 1UJBA 4RY0A 2C5SA 3CLUD 4NZOA 1DSSG 2VRCD 1DAGA 1Z68A 2O9JA 1G291 2FSVA 4QYXA 1OLXB 1K5DA 3WNZA 4IVRA 2LRHA 3BRSA 3PRYA 3ZW8A 2W51A 4DR2B 1Y5NA 3RSOA 1LKZA 4NYIR 4U02A 3I5XA 4AS1A 2J1LA 4KOAA 2P11A 3P5SA 3WP0A 3WOVA 2IV2X 3TSYA 1IJBA 1Z5OA 2CLEB 2HM7A 2P27A 4CNBA 1Z75A 3N6XA 1ECPA 3MIZA 1N2ZA 1OXVA 2PSSA 1JFVA 2P5SA 3GRUA 2CUNA 1M8PA 2GK6A 2F1IA 3H0EA 4IWXA 5EIAA 1HYGA 1TYCA 3S2YA 3VU8A 1G98A 3U7IA 5B36A 5KSYA 5J43A 4DV0B 3EPHA 3QKSA 1FMCA 4R01A 1RJFA 2HNBA 3RASA 9LDTA 3KOOA 4NX2A 2M2IA 5EP2A 3HBNA 3W1EA 4R2LA 4X6YA 1CS0B 3UG7A 4YT4A 2ENUA 1YDHA 2C5HA 3Q8LA 1MZPA 3IUYA 5AVUA 3BFXA 5ADWA 2P0AA 1H6CA 3N39C 3RT1A 3TRJA 5I8PA 1N6OA 2GEDA 4HH0A 1T24A 1VCNA 2RHMA 2WFAA 1ZW1A 4O2BF 4KQ1A 5I6DA 1I3MA 4Z1MA 5L3SA 1ZK3A 4YY3B 5KX5A 1NQTA 2GN1A 4EPTA 1ID8A 3NI2A 5CCBA 1E6CA 4C9BA 3PNPA 4PZ9A 1EX7A 3KM0A 5LJLA 2YZ7A 2SHKA 2X0IA 4BJ6A 4LK3A 4EJSB 1P4SA 4BO2A 3ZVNA 3V34A 1FFHA 2AFIB 6CHYA 4JX8A 5TC4A 4RESA 1MAHA 3D3QA 4L0CA 2E48A 4ECEA 3CEMA 4DNFA 1CVIA 1KYZA 1VIMA 2REOA 4N7JA 1TM3E 5FNVB 4O0LA 1A88A 3ZKAA 1R4ZA 5A4KA 3PQ5A 2YJ6A 5K45A 1OVMA 2I3DA 2F7SA 4FMPA 4I1OA 4FR2A 2X42A 4M22A 4R4JA 4WADA 3G49A 4B32A 2VSOA 5CFLA 1YHZA 3PVZA 5LDDC 3HP7A 1QQ7A 2FV8A 4PRZA 1F6WA 3PR3A 1QPGA 5TQ0A 3TQFA 4EHAA 2VHEA 4JYPA 4H35A 1QG6A 1YZUA 4C6SA 1RLUA 3R0VA 4L9AA 1P9LA 4NZYA 1NNSA 2YJ4A 3EVTA 3H2BA 5FRDA 3V2HA 1E9BA 2GEKA 2ZU6A 3UCFA 2FQ1A 3H83A 2JAQA 2XWSA 3GCGA 4DXHA 3JD1A 1FRZA 3QU7A 5ELLA 2QVBA 1O95D 2K2QB 2VYFA 2HK6A 2ZR7A 3LBFA 4L2IA 2Q4DA 2HOQA 1EA7A 4FYHA 4LQLA 5KQMA 2DKOA 2QTLA 2ZSDA 2G71A 3UATA 4F71A 4N3BA 3CW8X 1ZNWA 2IZ1A 2EATA 2VPPA 3SZRA 4P38A 2WAOA 1CJSA 2FPOA 2DFNA 4HX5A 5H70A 1N0UA 2Y1OA 3A3NA 1OXMA 4QDUA 2YBEA 1TTTA 4CMIB 3E35A 2HBYA 3EA4A 3V33A 4TGLA 4ARSA 1M9NA 4HAUA 3RVNA 4YRPA 3LWDA 1N2SA 1JS1X 1T5TA 1VL8A 4YC7A 2O1EA 1RJDA 5L8VA 3UJCA 1T8TA 1UBUS 4I50F 3EF1A 5HF5A 3HL4A 1ULTA 3MT8A 4PWZA 2BCJQ 4RHUA 2F1RA 3VR6H 5JE8A 2JASA 3DE1X 4GX1A 4P34A 4B09A 1CUUA 1RJGA 5JWOA 4M9RA 3U4QA 4BKMA 2YXEA 2I9KA 1GTL1 3DEZA 4WFKA 5LVAA 2B34A 4H6WA 5FPQA 3TECE 4OH1A 2EW2A 4PXSA 4A2QA 2HJVA 3AEUB 2NXCA 1ODIA 1EMDA 2PM8A 1GA6A 3G3EA 4EZBA 3PQ4A 3C3DA 2XGSA 3HCRA 5BSFA 1X9HA 4GE0A 2HLHA 5SZHB 3U3OA 1XLTA 4V0QA 3GT4A 3EXAA 4Q1VA 1PUJA 4K46A 5E38A 1XNHA 5GONB 4OHPA 4WOPA 4OMFG 3E9EA 2EQAA 4ITRC 3GFTA 3HSKA 2ZJYA 1B3RA 1W581 4FLEA 4L8VA 4C7OA 1R8QA 2QE7D 1E2MA 4AC9A 2AXQA 4RETA 4JUBA 1E9CA 1BXKA 4LJYA 1KHHA 5DLYA 3WQHA 4BGVA 3IR7A 2VATA 2ATIA 3V2IA 1I7DA 3KJIA 1DINA 3M83A 3JRNA 5KSZA 4C2TA 3JQFC 2QUHA 5F2OA 3T7CA 3R3JA 5L4NA 1NPYA 4UHHA 4BMPB 3L4EA 1XROA 4HUJA 1QP0A 1PK7A 2HN9A 1JR3E 3KVVA 4OH7A 3R09A 1CY1A 2VHCA 3O82A 4ZT3A 3ZHZA 5JH7F 1SOVA 3C3YA 2VBCA 4EQZA 1RAIA 3CUEF 4XVRA 5AICA 1JSCA 3WNBA 5EMHA 4K3UA 3JD4A 1O54A 1U02A 1Z5VA 5I7VA 2MINB 4EOGA 1X1SA 3ZDRA 2PG3A 2VHZA 3H99A 1DX6A 3B7WA 5KCMA 1XA0A 1C1YA 1GFSA 3C98A 4HDSA 4YT5A 4HAWA 4YAJA 2GBFA 1SG0A 5KNCD 1T3ZA 1T3GA 4MRAA 2IXDA 1OAAA 1IIRA 1JQ3A 5EXEA 2ISCA 2C8VA 3H9EO 3I04M 1CQZA 4EX6A 3UJ7A 2O7RA 4XCXA 2FF7A 3R3UA 2QL9A 1I0LA 2PS1A 1S7GA 4ED9A 2YMQA 3WLPA 3EY9A 4AG6A 3THWB 1JHRA 5LP6B 2CNOA 1L9KA 4OHMA 1ONNA 2JH9A 5IZ4A 1RJEA 3KBBA 5DOVA 3UFBA 4C4TA 4MUYA 3ANLA 3TI7A 1OZHA 3VV2A 1W75A 4UZWA 1EM8A 3HU3A 5SYAA 4WXRA 4JI1B 3HZZA 3WYDA 3ZY3A 1N5DA 3W5DA 2J3MA 2V8OA 3AF3A 3C87A 4EF4A 5BQXA 1SCQA 4LF4B 1JJRA 1MP0A 1RYMA 2DBQA 4O25A 4HT3B 1Z0ZA 2G40A 1V7CA 5K8IA 4YRKA 1Z5NA 3E82A 1Q7GA 3PHBE 3S44A 3DT6A 4YK7A 1LBEA 5KNBH 2GWHA 5FOUA 3ZWPA 3LNTA 1VLHA 5BUCA 3TM4A 5KTPA 4GMGA 4YJHA 5KAMA 2QBYB 1BHO1 3K1AB 3NMUF 3PX7A 3LAWA 4QL3A 1GR1A 2XMBA 2PUVA 4PNZA 1M2VA 2ODBA 5IMSA 1RS0A 3WXBA 2F4VB 1NVAA 2J3HA 1B74A 2ZIZA 3OX4A 1UPTA 4IFBA 1QZUA 2X2EA 4DRZA 2A9JA 1LZLA 3BGSA 2KFVA 3LHSA 4C3OB 1Z3CA 3U1VA 2AEMA 2VJMB 5TT1A 3Q4GA 4FGKA 3RS2A 4YRJA 2C2OA 4J1QA 3K9HA 3OAAD 2GSWA 4KE6A 1G60A 1T6YA 3C3EA 4QOEA 5CNIA 2F17A 4FDTA 4HWOA 1RI1A 4KR9A 2X13A 5DT2A 3PJFA 3MXTA 5B1DA 1KMHA 2B1JA 2HREA 4O29A 1BQ3A 4P53A 3SIWA 3ULKA 4UMVA 1N7JA 5BWBA 1NN3A 3F5QA 1YZHA 4US1R 5TMPA 2Z5GA 5HS4A 1RM0A 2JLZA 2FFHA 5FL7D 2VF4X 3VPSA 4DV5B 2VP2A 1M3SA 4ETWA 2OP0A 3TB4A 2E4XA 3UJ6A 1M1UA 1KZYC 4YO7A 5JYCA 4ESOA 4QQKA 1MEJA 4HDAA 1YBAA 2JFNA 2D7JA 3D5TA 3PRJA 4ROTA 4HVLA 1LEHA 2YL2A 3Q2IA 5EJFA 2Q7OE 2YCLA 4YRCA 5MGBA 3U3DA 4LZZA 1T43A 3KEQA 2IKSA 1ONSA 3KYCB 3Q6MA 1ATZA 3RBAA 1W4BA 2E4VA 4D74A 4F6LA 5HGXA 4BVGA 2UXDB 2IS6A 3RSZA 1HF3A 2IYLD 3HVKA 3GYGA 1VIYA 1G21A 2IOFA 1L5KA 3EWAA 3GFQA 4MRNA 2AFVA 5TR9A 5WRFA 3ZCRA 5L7TA 1PV4A 2O8FA 4HKTA 4ZRMA 2AK3A 4BLSA 3B7PA 2MR6A 4ZO4A 3HKDA 4AP6A 3F3KA 5TPWB 5BR8B 2ODTX 4J3FA 4MVCA 4YEDA 2VYVA 1VIAA 5FV7A 3O1JC 1U7WA 1PYOA 1FVOA 2NWQA 3S1AB 1I6KA 4P0TA 4QD3A 4C29A 5KKNB 4QG7A 4ZN6A 2E21A 2HWUA 3DUWA 3RVQA 3C45A 3EJ6A 4JWKA 4HUQB 4DZZA 2AN1A 4CEIB 4NEQA 5JYEA 3NHYA 3EHDA 2VPTA 4DLPA 3I5AA 5E6RA 2O2GA 2X6RA 3RI3A 3AUKA 5FOXA 4CM9A 3ELDA 2RHJA 3EBPA 1J99A 1Y4UA 1CY0A 3KU4A 4QLOA 3ZDQA 2H85A 2XCLA 3UPUA 1QVRA 4DWWA 1VDMA 2F59A 1KI6B 3QVTA 3OZVA 2PKQO 3LW7A 1GITA 1UBGA 2XYPA 3L4KA 2NV0A 3PNOA 1AZTA 1PWXA 1KZGB 4DNQA 1VMKA 1C1XB 2IXAA 4IX9A 1NKTA 1S2LA 1TAGA 1ZUD1 2MSNA 3DMFA 3FVWA 3VH1A 1FFXB 1HE5A 2E5WA 4KLRA 1I01A 2O4CA 1UMCB 2PUHA 3DFFA 4ZYXA 2JA2A 4EYEA 3SYNA 1DRUA 1KYWA 1LPSA 3EGXB 3KDAA 3MVEA 1E7SA 3WSVA 4KE9A 4LJLA 3LZCA 1EN7A 2IOHA 3WL4A 1RRFA 1DBQA 3GG9A 1LBTA 4QDZA 2BFDA 3EYWA 4N48A 3IP5A 4RW0A 4UBNA 4JDUA 1QZXA 3T7IA 1UXHA 3ERCA 5AWFC 3ISVA 3ROGA 3GB9A 3P45A 1NP3A 3AI1A 1Z7GA 2JIPA 3LRXA 5FADA 4BZQA 1NAIA 4G9GA 1Z0JA 2MMCA 2ZZKA 5JSKA 1SC6A 1B0AA 2WSLA 4GOND 1TLLA 4HDMB 5IH3A 2Z3VA 4NEHB 2ZKIA 2FFJA 3GJ4A 3KHKA 1W96A 1C41A 1H9BA 5T4HA 2Q3DA 3GEEA 1TM5E 3O94A 4M1YA 3FDZB 3RYHB 5KYTA 4RYLA 3UKJA 2ZI3A 3LDUA 5IZCC 1HQYE 3NWPA 4L16A 1RMYA 4JLPA 4HNRA 4G4IA 3WLMA 3OF3A 2H31A 5FBVB 1T6ZA 2DUJA 3B52X 3BTSA 4XA8A 1UJCA 3ECAA 4L4YA 2LPMA 1C5KA 3BREA 3HV0A 4ZV9A 3ZV6A 4IOJA 1YOVA 1ADBA 4YR9A 3ZD8A 2K5UA 3PDCA 1RYBA 2D06A 4NBTA 1QHHB 3CBQA 4JB8A 1A8VA 4INAA 3M1LA 4RVSA 3JQCA 4XOIA 3T5TA 4AJ9A 1G7CA 2IP1A 2QYTA 2VP9A 1YQXA 1H23A 4FQ5A 1ISHA 1BWSA 2NO7A 3KXPA 2PZMA 1JJVA 1GTVA 1SD1A 3OQ6A 4JIMA 1YIOA 1SCAA 4N65A 4CKBB 2FZ5A 4MLZA 1HG0A 1KAHA 3RJZA 2CK3D 5EHZA 4QBFA 4KPUB 2PTGA 2ZWPA 2PH3A 3QE2A 3PRHA 1QV6A 4P2GA 4NZZA 1G8JA 5DHSA 2DOKA 1K1EA 1U0GA 1QIMA 4H7KA 4YROA 3T1QA 1DKLA 3ORSA 2GB4A 2V7VA 1MO4A 4OI0A 1JECA 5EKTA 4FYKA 2JLAA 1W29A 4NFHA 2NZWA 1LRKA 4ZYVA 2B6NA 1UCFA 5AOBA 1EP1B 5HDBB 5KTRA 2EF0A 4GRIA 1GTRA 2BLLA 4ZYLA 1NBMD 4KIFA 1EH5A 2Q6OA 5ALTA 3HGQA 5HILA 1F5SA 3AVTA 4YAIA 2DH5A 2ADFA 3VJRA 1M0SA 3BGWA 3QF4B 2O5VA 4Z9YA 1IN8A 3UB2A 2CBZA 5A5DA 1AY0A 3W6NA 4C0XA 1I0ZA 5AHWA 2M6LA 2JCXA 2O2SA 1X80B 3MCWA 1CFZA 4KBFA 1Z7EA 5ILQA 1PG5A 2RH4A 4JR2A 4B2LA 1UK7A 1WLYA 2BGGA 1TTQB 2JFZA 3GEDA 1BNCA 4XTRA 5IBCA 1B6GA 1OU4A 4BBPA 3GBSA 1KFJB 2NU9B 3U3KA 3CE6A 4S1TA 5AHOA 3MYRA 2I7DA 2Y1EA 1YDWA 1G8FA 4JCOA 4EGSA 2O59A 1STOA 4CKWA 2I5PO 2UUPA 2VSYA 3MD9A 2YNMC 3IEVA 1YS2X 2CMKA 1Z83A 2BI7A 2ZJAA 5T8KA 3G17A 2FGKA 2X77A 1YQ9A 2QRVB 1NXXA 2IZZA 3HACA 2ZJ7A 4HX9A 4WZBB 3TRDA 4WBNF 1F7VA 2JHFA 3ZE6A 1NSFA 2GD2A 1RTTA 1LLQA 1IL0A 3RC9A 1PDWA 2PGNA 3N7TA 4E6EA 2B7BA 5K7SA 3UMJA 3KLBA 2AUMA 4RLQA 3WB9A 4CG2A 4F92B 3OPYA 4AZWA 3BB3A 3RQSA 2XKAA 4LX0A 1Y8CA 4NESA 4DSNA 5JTTA 2BV3A 4AMGA 3R7SA 3FNGA 1P1BA 3ZIAA 5B7NA 1CUIA 4LHSA 3WLFA 2ZRBA 1XF1A 3ETCA 2PJDA 2EFDB 4URXR 4IDAA 4UXHA 3UH1A 1A27A 2J5KA 1SK9A 3Q98A 5AXBA 2XUPA 3MFQA 4CDNA 5EXXA 2HA5A 3D7LA 1XV5A 1DARA 1ENZA 1XQXA 3CISA 1LD3A 4FIZA 4FZ3A 4QNRA 4ZQEA 3RLIA 3UT6A 3JVDA 1M5TA 5EZSA 1A2OA 2DSNA 5FPYA 3EGEA 3T5BA 2CEAA 3U4DA 2AGVA 3JQ7B 1IPEA 1W4LA 4M89A 5KPJA 4ZAYA 3RO7A 2RNOA 1IZ8A 3CX3A 1VE3A 2XWPA 2XNJA 3T9FA 1QGAA 1TJ4A 3AEQA 3GZ4A 3IT0A 1JDBC 1YZQA 2P2YA 1QUFA 3BAFA 4JGBA 3E18A 4Q4AA 4K3VA 5JNVA 2JD1A 3VI3B 2D8AA 2UDPA 3FUTA 1NYLA 3Q3IA 4GBGA 3G0HA 1O6FA 5CJ2A 2HH9A 2CLIB 3LZ6A 1KQFA 3MWDA 3NOQA 1Q17A 5EE1A 3PKIA 1KAQA 3LUFA 4WLVA 2JCBA 4XLLA 2X2PA 1DCMA 3ED1A 3NUGA 5THXA 3SJZA 3LBYA 4JJKA 1CUWA 1N8NA 1BYUA 1P5ZB 1XKLA 2WWIA 5AJHA 2XBLA 5JLJA 2YXDA 3OT5A 2IODA 821PA 1A63A 2EZ4A 2X23A 3KSBC 3FRJA 3L5OA 3ZV5A 3SXPA 4ERNA 2ODNA 1QORA 2DFVA 2DE0X 2HK9A 3EWIA 3FKQA 1LX7A 1PLKA 3PUJA 4L0QA 5DXJA 2VSFA 1YRQA 2D3TA 3GGCA 5DK4A 3KQHA 1MV8A 2MIIA 2ODAA 5K99A 1S1MA 1FS4A 5A0VA 4TQAA 1V8OA 1VHQA 4TVKA 1I7LA 4UM8B 1YB4A 4B3DA 3PF9A 3TQTA 4PEVA 1USUA 4ARZB 4W5NA 4M98A 1SCUA 3O8CA 5JVDA 2EKBA 1VA4A 3L7AA 4CM4B 3EXEB 5JRZA 1R8JA 1X1RA 4MHSA 3WIOA 5KOJB 1VJ5A 4ZMRA 5A3JA 1WTAA 1BH6A 1AU9A 1BXRB 1OHHA 1THTA 2XB6A 3C3AA 3F1KA 3OA2A 5E9AA 1KMIY 4LHVA 1Z74A 4IEIA 2B5WA 2I1QA 4E4RA 1VCOA 3S7TA 2FX5A 3ZQUA 2Z8ZA 1WDMA 4JASB 1JFSA 4ECAA 3LC7O 3ZZ1A 1N77A 1MQ9A 2NXEA 3VZCA 1E5TA 1F38A 1MGPA 1QHYA 1N2EA 3ETDA 5C81A 3I4LA 4ZJYA 2NUTB 2QN2A 5CDGA 3WR5A 2W8BB 4Y2GA 1E5QA 2YV1A 4CJXA 1DZ3A 3RPEA 2W4IA 1RDFA 3A9SA 4GNRA 5FAXA 1XRJA 2VWGA 2XYQA 3JCZA 3L1UA 3OLXA 1XB2A 2DZDA 4FFLA 3VR3A 2C7GA 2L19A 5JZVA 1DC7A 2HWKA 4G4GA 3KKEA 5JTUA 4YHHB 4Q24A 5M34A 5GM1A 3D81A 3IP9A 4TROA 1P2UA 1PBNA 2IWHA 3DLCA 5ITWA 1H6DA 4E12A 3L7YA 4OQNA 3AWIA 3QUQA 1SZDA 2VDVE 4JGIA 5FNZA 3EEQA 2X6QA 5DNAA 1ZK4A 3GRFA 3MJRA 2ORYA 3IMCA 3NXSA 5B5SA 2DB3A 1SZCA 3PXAA 1ZAYA 1PX0A 3QP9A 4MLCA 1F2UB 3TKYA 1GNPA 4FC7A 4GXRA 3EC1A 2OLJA 2X5OA 3I8XA 4WY5A 3WIVA 4AMBA 4CM8B 4HNAB 3A6PC 2JFVA 2VDUE 3H8WA 3R3HA 1EZ1A 4L27A 5F76A 3X2FA 2XZOA 4TV8B 2A59A 3BMOB 4IJMA 2QTVB 1NRXA 4IIFA 1QU2A 3CC8A 1U0FA 3D6UA 3G9TA 1TADA 3FVRA 4EB6B 4NK5A 1U7OA 1PG2A 1ZN7A 2AG6A 2QW0X 3L6BA 4NLLA 2C98A 2ECQA 3D0RA 1UPFA 4N8SA 4QELA 1Z2CA 3R3SA 4EL0A 4UNRA 2IW1A 3GFVA 4UKDA 3MSXA 1W19A 1PIWA 2FPRA 2YWHA 3ZIUA 4JI3B 4CMEC 4JI8B 3KQKA 2W6CX 1CY2A 5BUSA 2ZYIA 3N28A 1XZGA 3SF8A 4X8OA 4FEAA 3WSWA 2FN7A 1PSWA 3CMMA 3DA8A 3AP3A 3C3BA 2PRYA 2WD7A 2ZIVB 3CLSC 4DQXA 5KJ6A 2DBZA 3LTEA 4PVCA 1FNSA 2RGUA 1SQ6A 3FR8A 4LYEA 4RH0A 5IP5A 8OHMA 3O1IC 5LU9A 1YL5A 3KUKA 4KN8A 3J80A 1SBTA 4CPDA 3U5TA 1ESDA 3LG2A 4R1TA 1GSHA 2C83A 4E2FA 2DECA 4AMVA 1Q0SA 4B4DA 3EZ2A 2NVOA 2BGIA 1F5NA 3PWTA 5C34B 4QDKA 5JMPA 2MSDB 3RVSA 3BZBA 3VU1A 4TRRA 2ZUCA 4AYWA 2Q99A 4OOFA 1L8LA 1FFEA 1ZM4A 1QRUA 3L0PA 4U7FA 3PEEA 5IM5A 4C03A 1ZJZA 2CLLB 4JYAB 3DBLB 3WL3A 2G9VA 3NNNA 4XQ9A 4AYXA 5KTOA 1OOEA 1ISIA 4ZDWA 1ZL0A 3FSGA 3HUUA 3TLBA 1NLMA 1N9KA 3ANMA 3FVVA 2XMSA 1ISPA 2F1JA 1OC4A 3RV3A 4Y0VA 2GRJA 3IP1A 4A8JB 1NTRA 4ETMA 2EOAA 3JYOA 3LBIA 1NQOA 4ARBA 3H87A 3FKSD 1W6UA 5AM1A 4C0KA 2JJ1A 3EGDA 5AM3A 4C0WA 1R5OA 3IDAA 2Y68A 5JHHB 2O7NA 4IIDA 2PKQP 1F4PA 4TS1A 1R4NB 2BFFA 3HXMA 2GXUA 1GKLA 2HYDA 3FRHA 1BW9B 3LP6A 1GZ7A 3I52A 1MHPA 3R3YA 1U5AA 5JD4A 2O52A 2P77A 1TQ8A 3TK1A 2VCEA 3V4SA 4FN4A 5D7BA 3Q6NA 2HL6A 2DTXA 4OVKA 1KC3A 4C1NA 1PQ4A 3DVAA 2ZYVX 3EOAI 1SXIA 4JLWA 4CNQA 1LFAA 2PYZA 2JJQA 2XNDA 3BKXA 3OIVA 1IBKB 5DBIA 3COPA 1NSTA 2WMDA 4RA6A 4LXGA 4DLLA 2A35A 5JAUA 2J4DA 1FA9A 2B99A 1K3FA 4KIGA 4ZXPA 5LMNB 1FJGB 4ZVNA 3DCYA 3V1KA 2IPNA 3CM0A 1J09A 4DV1B 1GPYA 1QTQA 1RQ7A 5BQ3A 3GIDA 3BIXA 3N75A 3NH6A 2X0FA 3U16A 4P54A 4F9FA 4Z4FA 4TTRA 1MFPA 4PC6A 4ZI2A 1CEEA 3GNLA 2BMFA 3TGLA 3ESCA 3COJA 3L7KA 1T9HA 2E9SA 3WIEA 1OXUA 3I9MA 3BKWA 3TKAA 1EI9A 3MW8A 4WH0A 2O8NA 1T5SA 5G0TA 3UXHA 3LXUX 3R5XA 1NXQA 3NORA 2C9MA 5AQEA 1WKBA 2PVSA 4UE6A 1YRHA 2H1VA 2JGFA 4HEA1 2EL9A 5IEBA 3KKNA 3EQ6A 3AEKA 4IJUA 3NHZA 2ZYWX 4ESEA 1P4AA 4BFUA 1MG0A 1BFUA 3AESB 1T2UA 4CZ2A 1PD1A 3D2BA 1TCCA 3R5JA 1ZJWA 3BIWA 2YXNA 5KMGA 2EXXA 2WR8A 1J2UA 1M10A 1TU0A 4RDCA 5CU7A 1P80A 1T0UA 2FUNB 2GESA 4LOJA 5BO5A 3IJRA 4BMNA 2DFDA 4L8GA 2FOXA 4N54A 3AFMA 2NACA 3VYSB 4EK9A 2VS1A 3RD5A 7REQB 1RYZA 2JHCA 3R6LA 1DV2A 4HCJA 4HQKA 4B85A 3VPFA 5H9WA 3HTXA 1YI8A 1U9IA 1Z16A 1XELA 3TQSA 1LWOA 1N2BA 1U28A 5DXAA 2FN3A 1U2SA 1EVZA 4CCWA 1AMNA 3UWDA 1DG1G 1T8WA 1XVIA 3JZFA 3N2GA 3FCSB 3AEXA 3GLFE 1YR7A 5GVSA 4B43A 1HE3A 1V8FA 2AN3A 4PPFA 4Y7DA 3W5UA 1W4AA 4IO1A 2ODCI 1ODLA 3HJNA 4PX5A 4HMQA 3SS7X 2Y0PA 3AM3A 2P6MA 3NDBB 1V71A 2FSGA 1Y6RA 2CVZA 2W43A 3CURA 2OA0A 4H7PA 5HK9A 1QAQA 1SUFA 3EE6A 3DT9A 1EBBA 3H9QA 3TTSA 3LBAA 1M7BA 3IQFA 3CZCA 3IESA 2QNIA 4ID3A 4NBLA 4Y1EA 2WY2D 4BBJA 1M2OB 3ZKWA 2QRLA 2WG0A 1VKJA 4W63A 1I8TA 1G17A 1Y63A 5CH8A 3D1LA 3DYVA 4P4TA 5J3JA 1E3DA 3FDFA 1L1RA 4HQRA 2FUKA 2IE0A 3FJ1A 1A77A 2LCFA 3I5UA 4R0VA 4RTNA 9LDBA 3A1SA 2DY1A 2HXYA 2LDBA 1Z4PX 2OLEA 2R48A 4DIBA 1PVVA 1R0CA 2HTEA 2YQ4A 2X5XA 4P6VF 2XKKA 4BFSA 5GAJA 5E2IA 2MWMA 3O4JA 2ZE8A 4HD8A 3CO5A 1IOVA 3PGLA 4LXHA 4ZVOA 5LYJA 3ZE0B 5JNLA 1Z0FA 2FXIA 2XIJA 2O8DB 2WYVA 1WU7A 1U8EA 1V39A 2XLCA 5DHTA 2PRIA 3FPSA 3N59A 2ZJ4A 4WPGA 5CIQA 3MB8A 5DM60 2IYQA 5FUWA 1KYQA 3H5VA 3JQAD 5BW6B 1G55A 2Q6KA 4FCVA 1ZSVA 4C0AC 4U3JA 1JXOA 2WYWA 4NU8X 1EP2B 3E3LA 3II6X 1I2ZA 2M6SA 4HPWA 4IR7A 4J7AA 1JBQA 1EFPB 2OHXA 3MWJA 4I7EA 5IT4A 2ZSIA 2ECOA 4C14A 5KU7A 1PRYA 3MLEA 1TM1E 2ZJOA 3NBXX 3T4XA 4CETA 1K7SN 5A6SA 1U1FA 3FFTA 1NRWA 2XUDA 4INPA 2I4MA 4O59O 3RVLA 4NP6A 1VLVA 3O8OA 5AIAA 4HJXA 4IW3B 4OQLA 1IXRC 2WJIA 3BWVA 3FUUA 1W5AA 3L6DA 3OTQA 5ARCA 1D2NA 3QITA 3R9KA 2W5UA 3KD2A 3DHNA 4TTAA 3VRHA 5JJIA 2I99A 2QGNA 4NVRA 5FOQA 3HNOA 1U9JA 2R11A 3K9FC 2MSCB 4ZJZA 2Y93A 3UM9A 4QREA 4UJ3A 3UAYA 5HKOA 3ZVMA 4ER3A 3DGFC 4QYSA 4MCIA 4BU0A 4HBZA 5FBLB 3AB8A 3JWPA 4I4LA 4K9LA 4LRQA 4X84A 1IJFA 2AD5A 4MW5A 3ILVA 1TFUA 2BRUC 1WXGA 1OLOA 2FEPA 2VC2B 3KDPA 4I4CA 4J4HA 1CULC 1F06A 3LLRA 3PC3A 4Q47A 4QO7A 3SK0A 4E5YA 2HYIC 2ZDQA 2HPZA 3A3PA 3G6KA 4X63A 2HHJA 2O1SA 3OPVA 4H3KB 4TYWA 1V1RA 3C74A 2HZ7A 1T29A 4CU5A 3NBUA 1KJNA 1ZN9A 1WNFA 2PWPA 2QRJA 1JB9A 4BRZA 3D8BA 4GYYA 4F8YA 2VBGA 1XVAA 3RIGA 3OQVA 1AMUA 5JI2E 4BLPA 1J8YF 1XQYA 2C94A 3D4OA 3KZOA 2AZ4A 2PUCA 4UDNA 1VMEA 5CDUA 1K6XA 4Q1EA 3MS7A 1NV8A 1S6YA 1B0UA 3ZHUA 1P39A 3W5JA 3E05A 3H1GA 2ZT6A 1E63A 2R60A 4WT7A 1E7MA 5GJWC 1FUIA 4PV7A 2JFYA 3FUXA 4IIJA 2JFXA 5GPBA 3RTEA 4BO3A 1N0IA 3AH8A 1YS1X 3T5PA 2P6RA 4LBZA 4W5QA 2QORA 4JLUA 4ZRNA 4IV5A 2H63A 1WP9A 1SIBE 3GRYA 3ZOKA 2I9PA 4YLGA 2E0IA 4M87A 3LA8A 3USZA 3PJDA 2W9XA 3PSAA 4TV9F 1X8XA 2Q29A 3H16A 2PNJA 2OAQ1 5KDLA 1A5TA 1GYQA 2FMHA 3T7SA 2C88A 4RTRA 4S0ZA 2DTDA 2XADA 4AP5A 3NUQA 1JEDA 5BMVA 1TPZA 4E07A 2WKQA 1A8UA 2Y71A 3GEMA 4PC1A 1QCDA 4HFMA 4XSHA 1NOJA 4QLAA 2Y0CA 3KUDA 2OORA 2FRXA 1XSEA 4O4IA 5CBKA 4XYEA 3HN2A 5LUBA 2GM3A 3WFIA 1F3OA 4XCVA 5FFNA 3RC8A 1EX1A 1RRMA 1Q