1ZS9A

Crystal structure of human enolase-phosphatase e1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
254
structure length
253
Chain Sequence
b'LSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-1 ENZYME
publication title Crystal Structure of Human E1 Enzyme and its Complex with a Substrate Analog Reveals the Mechanism of its Phosphatase/Enolase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 253
sequence length 254
ec nomenclature ec 3.1.3.77: Acireductone synthase.
pdb deposition date 2005-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.60 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1zs9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1zs9A01
3ET5A 1Z4PX 2GMWA 3U7GA 5AM0A 1L7NA 4B6JA 3I6BA 4Y2TA 2EATA 4GIBA 5AK4A 3ZX4A 3M1YA 4UMVA 1Z88A 3NALA 2GHTA 4EELA 4UARA 3R4CA 4CNQA 2O9JA 1RKUA 5AKJA 5AHXA 1L7PA 4UASA 1RLTA 1RMQA 1RLMA 3NUQA 3SKXA 1MH9A 3OCYA 4UU0A 4BX2A 3W5BA 5AK5A 5ALMA 4FYPA 1JUDA 2HEGA 3ZX5A 3ZI4A 3U7EB 2FPWA 3WGUA 5IS2A 1TJ3A 1YDFA 4OCZA 5ALKA 3AR9A 2R8XA 5AW1A 1YMQA 1VJ5A 2ZOSA 2R8ZA 4BBJA 3AR3A 2FPXA 3N07A 3FM9A 4Y2QA 3WK6A 1S8OA 1QH9A 4HYTA 2B30A 3B8EA 2YJ3A 4OHFA 3EF0A 4DCCA 4G9BA 5ALQA 3AR6A 5AW3A 5A3RA 3CZ4A 2HDOA 2Q4TA 5AIAA 3I28A 3QU5A 4ZEVA 2D2VA 2YJ6A 3W5CA 2EARA 5AI5A 3N8GA 3BWVA 4YCNA 2CFSA 3L8EA 2CFTA 5AKYA 5ALHA 4DFDA 3L0BA 5AW2A 1YJ5A 5ALEA 4NABA 3NIWA 4NFLA 3B9BA 3FVVA 1ZD3A 4Y2RA 3DDHA 2YFYA 2WFAA 2PQ0A 1U7PA 2IYEA 5ALZA 4EX7A 3TLMA 1ZD2P 2WF9A 1K1EA 2B82A 5AVUA 4O8CA 3N5KA 3QGMA 4XOUA 1TE2A 2I33A 4L6AA 5ALGA 3ZTWA 1SWVA 4CF4A 3U13A 3E58A 2RBKA 2I7DA 4CF5A 4C4RA 4UM7A 5ALLA 1ZS9A 3E8MA 5AIBA 1O08A 4YGYA 2NO5A 2PKEA 2GFHA 3CNHA 3A3YA 3IB6A 3ED5A 2YMPA 1Y8AA 4EEKA 3L1UA 2WHEA 4Y2XA 2DQSA 2IA5A 3F9RA 2IOHA 5AK3A 1S2OA 3R09A 3MPOA 1SWWA 1Q91A 4Y2SA 1CQZA 3QLEA 2WM8A 3SKYA 4YCMA 1RDFA 4BX0A 3OCZA 3AR2A 3DNPA 5IT4A 5FP0A 3ZWDA 1L6RA 5ALNA 4AS3A 3ESQA 1ZJJA 3NAMA 4CF3A 5ALRA 4HGPA 2NYVA 5AICA 5AKHA 2W11A 2AH5A 4QJBA 3OPXA 3U26A 2B8EA 2G09A 5AVYA 3QU9A 3SLRA 4HGNA 4KX3A 1XVIA 2WF7A 3MC1A 3FZQA 1RQNA 2AUTA 5ALPA 4AS2A 4EENA 1L7OA 3AR7A 2YJ4A 5E0OA 4KNWA 4YIHA 3IJ5A 1WR8A 1ZRNA 4L57A 1RMTA 3HYCA 3OTQA 3QUCA 4IFTA 4EZEA 3QXGA 1EK1A 2G08A 3EF1A 1U2TA 2OBBA 1KYTA 2YMMA 2I55A 4UU1A 3KBBA 5AKZA 3QU4A 2OA0A 2HF2A 3ET4A 5ALIA 1Z4LA 1TA0A 3WK4A 3KC2A 3BA6A 5AI9A 1J97A 1FEZA 3PDWA 5AVWA 5AVXA 1YNSA 2BY4A 3MMZA 2P27A 2WF6A 4KYTA 5AKEA 1Q92A 4YIKA 2ZBGA 4DWOA 3WK5A 4ZEXA 3QU2A 4ZEWA 3SHQA 5AVVA 1U7OA 1QQ6A 3I1YA 1T5SA 2R8YA 3I76A 4UMEA 4Y2VA 2HCFA 3U7HB 4HGOA 3ZWKA 3HLTA 5AW5A 4FFDA 4Y2UA 2BDUA 4BKMA 3L1VA 1NRWA 1PW5A 3WKCA 3SMVA 2FEAA 3QX7A 2JAOA 4L6CA 1O03A 4KX5A 1L7MA 5AW0A 2C9MA 1RC8A 2C4NA 4Y2JA 1RPZA 2FDRA 1Z4OA 2FPRA 5AKKA 3D6JA 3QUQA 4C4SA 4IG4A 4BYGA 4F72A 2GHQA 1Z4JA 2FUEA 4XQ0A 5ALFA 3ZUPA 4PNHA 3KOOA 4XE5A 4HAIA 4AP9A 1Z4QA 1SU4A 2CN1A 4I9FA 1RRCA 3W5DA 4BX3A 4QQFA 2NO4A 3ZTYA 3E84A 5AVTA 4J2TA 1RLOA 3GYGA 3L0CA 1WZCA 4BEWA 1QQ5A 5AESA 2IOFK 1U2SA 2YN4A 2IOFA 2JGAA 3KDPA 2P69A 4EX6A 3A1DA 3SF0A 1Z4IA 3KD3A 5IT0A 5AM5A 3MN1A 2HI0A 2CFRA 2I34A 1F5SA 3QUTA 3NRJA 1WVIA 3E81A 5ALWA 3UM9A 1AQ6A 4BEVA 2YBDA 3ZU6A 2YMQA 5AI0A 1LVHA 2AGVA 4DW8A 2ODAA 3RF6A 5AM4A 1YV9A 5AW4A 5AVZA 3ZVLA 4RESA 4Y2YA 5AW7A 2X4DA 1T9ZA 2C8LA 2I6XA 4G63A 3EWIA 1LTQA 4HGQA 2FUCA 2HHLA 2HX1A 1X42A 3J7TA 5ALXA 4UMFA 2JARA 4MWOA 3N28A 3RFUA 2MU1A 1Z4MA 3KZXA 1EK2A 5AI8A 2AMYA 1ZRMA 4JDPA 5AI6A 3AR5A 2EAUA 3A1CA 3DAOA 3M9LA 2ZBDA 2HSZA 4OFZA 3NANA 3ZW7A 3PGVA 4UATA 3WKDA 3WK9A 3L8GA 1Z4NA 2JAWA 1N9KA 2ZG6A 4C4TA 3EPRA 2FPUA 5ALDA 1ZOLA 5ALJA 2G07A 1RMYA 4BNDB 2YY6A 4UAUA 3DV9A 2YMLA 2ZBFA 2WF8A 4HGRA 5ALTA 3WKAA 3ESRA 2PR7A 3ONNA 5AM3A 1XPJA 3PGLA 3A1EA 5AKXA 4RETA 3OCXA 4JB3A 4J03A 5AK6A 5ALYA 2W43A 3QUBA 5AI4A 4YCLA 2OYCA 3N1UA 3QNMA 3K1ZA 3P96A 3WK7A 5AW6A 1QYIA 4UAVA 4KNVA 1TJ4A 4Y2PA 4XPZA 1VFPA 2RB5A 5ALUA 3SD7A 5AKGA 3S6JA 3B9RA 2P11A 3UMGA 4F71A 2B8JA 5ALOA 4Y3UA 1IWOA 5T41A 4UW9A 1T5TA 2YJ5A 3WGVA 4H1WA 5AKIA 2G1AA 3R9KA 1Z5UA 2G06A 2RARA 1YS9A 2I54A 2B0CA 3ZVMA 3ZVNA 3UMBA 4OD0A 1CR6A 2HF7A 2P9JA 1J8DA 1L8LA 3VAYA 3FPSA 2C8KA 3NASA 2B1QA 2MSNA 2G80A 3OCVA 2FPSA 3L8FA 1NF2A 1WPGA 4UMDA 3L5KA 2QLTA 4GXTA 2GO7A 1ZD5A 1TJ5A 2W4MA 5A3SA 2BDEA 3AR4A 4FE3A 5AM2A 2QYHA 2B1RA 1RQLA 2R8EA 2RAVA 5A3QA 5AVQA 1QQ7A 2Q5EA 4CE6A 2FI1A 3L0YA 3PCTA 5AKLA 2ZXEA 3QYPA 2VKQA 1L8OA 1Z4KA 2Q4RA 1XP5A 3IRUA 2O2XA 5AVRA 3QU7A 5AW8A 5AVSA 2WF5A 4E88A 2OM6A 1RKQA 2JAUA 1VJRA 3OCUA 5JJBA 4MUMA 1NNLA 4YH1A 3U19A 3UMCA 3U7FB 3FPBA 4NAVA 4BNDA 3WK8A 1U02A 3OCWA 3L7YA 1ZD4A 3L8HA 1N8NA 1RKVA 3WKBA 3AR8A 3W5AA 4KN8A 1Z5GA 4UM5A 3FGOA 2ZBEA 4NWIA 2HOQA 4I9GA 5AM1A 2C88A 4NV0A 5AW9A 2G0AA 3WKEA 5ALVA 5ALSA 2HO4A
chains in the Genus database with same CATH superfamily
3U7GA 2WU4A 4DG5A 2WIGA 4MAMA 5AHWA 3PXGA 4XRRA 4P84A 1G18A 1NURA 3E35A 1QJCA 2VHJA 2ENWA 3IDAA 4DIOA 3ZLTA 3ZX4A 1GA6A 1IXRC 3L04A 4Z9AA 3NALA 4OK6A 4PX9A 2QRZA 2FEMA 3INGA 1JG6A 1Y9AA 2BCGY 3O8BA 4J0IA 4KIUA 4NDAA 5SZJA 3R4CA 2JVIA 3PJEA 1PJAA 5U1PA 1V11B 3H19A 3G13A 4Q16A 3V5NA 5AKJA 1MHTA 4IOMA 4BV9A 1F51E 1ZO8A 3BMNB 4XH9B 5FTMA 1OTHA 1ZICA 4ZIRB 4RLQA 5BW8A 1ZRHA 3KLOA 1T0JB 4OI1A 4ALLA 3A6ZA 5CA1B 2DZDA 2RGYA 5DNAA 3TSYA 2HA2A 2B8WA 4V3BA 2NO9A 1UK8A 3HKEA 1JUDA 2UUOA 3AXSA 2R4UA 3O90A 4Z3DA 2PUBA 3UA3A 1NRIA 2MSWA 4CKEB 3MCZA 4R71A 5C34B 5K6RA 4JWTA 1TJ3A 4GBED 4U2FA 1E3EA 4MWZA 4OA8A 3WSVA 1I6KA 3HNPA 2G9NA 4C20A 4RD6A 5JISA 1ARZA 2OZKA 5HFAA 3A4LA 4DYHA 4QEDA 2AFIE 3WZLA 1SCBA 1Q1ZA 3AR3A 1PNTA 4RSGA 2GCOB 2HDHA 3RC9A 1J0CA 2YS7A 4IDFA 4EKDA 2C2KA 2R0QC 3JVVA 4NH4A 1AO3A 3F6RA 4NNOA 3W3ZB 4LHZA 5HIIA 3JVEA 2ACEA 4C03A 1W7AA 1NNI1 3EISA 4AWBA 3Q3EA 2BGJA 4QFDA 3LT1A 2PT6A 1A8QA 3FDZB 2DBZA 2JNWA 4YCJA 4P33A 5F78A 1OI4A 3N75A 2ZVQX 3KT0A 4LY3A 2W37A 1K7EB 2EJWA 2QBYB 5EJEA 4CCYB 1OT5A 3JVUA 4YDSA 3OIWA 3T5MA 2ZJ6A 1W8IA 2XMZA 3DXZA 1XWFA 3MRSA 5DHAA 2GN0A 1UXKA 4O59O 4L02A 1A9OA 3LH5A 4KUGA 3G68A 2DT5A 3HR8A 5AXBA 3AEUB 1N9GA 2G5GX 3ZOKA 3GI1A 1L4YA 2EP8A 5CX4A 1N2OA 2IXAA 2Q8PA 5L4LA 3HCAA 2JFUA 2CHGA 1PZXA 1KDOA 2VN8A 2QD2A 2ZS7A 5BR4A 3TGLA 1DIAA 3FVVA 4NCHA 4LKRA 1D2MA 3UKJA 2YFYA 3C48A 1FDSA 1NN0A 5TX7A 2Z6QA 4W82A 1UQUA 1P1RA 3M0EA 1ZUNB 1G55A 2KYRA 4BATA 2WWRA 1KGDA 4TWRA 1KMIY 3KKPA 4CKCB 3FOWA 4EX7A 3OY7A 4RXTA 2J7PD 4LKOA 4QGGA 3CB4A 4HH1A 3U62A 4MA0A 4X95A 1KDZA 3Q10A 4IVNA 2CW5A 4A8JA 4B7XA 1TFUA 4E33A 1KAHA 2QM7A 2G1UA 1EG7A 1UM8A 1EUDA 1UZMA 2JANA 3EC1A 2OT3B 4IICA 4QECA 4YQZA 3RSSA 4RXUA 3L49A 3MWDA 1B8UA 3CEPB 3QSGA 1O96A 1SOWA 2OWDA 3B5EA 4NZZA 1W5TA 2FPPB 1RWNA 1QUEA 2YFQA 1YJXA 3D6FA 4LTMA 5FI5A 2FHSA 5KOHB 3VV2A 1G63A 1C8KA 1BXGB 1OVGA 5EKTA 1IHDA 3P9SA 3UF0A 3VZDA 5IJ9A 3V4OA 5ALLA 1FYDA 2X2OA 3OUTA 4KSBA 4YRBA 2ODTX 3QSYA 1ISHA 2OL4A 1Y4ZA 2VCYA 5EIEA 4Q12A 5ICMA 2FOXA 2GFHA 3CNHA 4J43A 5FBVB 1M1NA 2OFWA 2OXEA 2OCYC 3FI0A 1UJCA 5IYZB 1KEEA 4DTIA 3CUVA 3MGAA 2O20A 4QJIA 1N5KA 3TSOA 3T3DA 5KSWB 2XTZA 2ODQA 2FE1A 4MQ4A 1QU3A 3N0TA 1Z2NX 4R2HA 2CLFB 1Q91A 2WUVA 3NLLA 2C07A 2GCGA 2RHBA 3ME5A 2XNHA 2J30A 3NV9A 4DDVA 4Q02A 1Q20A 4CTOA 4TTJA 4K1LA 3SSAA 1CDDA 3C85A 3U7RA 2XUDA 3I23A 4QRIA 4TLEA 5LU8A 2GM9A 3U0VA 4BRUA 2HJWA 2VUIB 1H8HD 4HGPA 3EZFA 4DLLA 4WN3A 1C4OA 2C94A 1HLPA 3DFMA 4OTZA 5DT2A 3NORA 5DOZA 2X40A 2YQ5A 2OECA 1WCYA 4UBIA 1RBMA 2AI1A 2B8EA 3ZV6A 1X92A 4QT4A 3IX7A 3JASA 3WB2A 4B80A 3V3TA 5CLLA 5HMLA 4C2BA 1Y3AA 4BVAA 4OHXA 4R1UA 1OXBB 1V47A 3MJFA 2H7CA 1EN7A 3IUNA 3DMGA 4PBTA 1YONA 1MTOA 3BDVA 2D59A 1D03A 3MD0A 3PSAA 4TV8B 3N05A 1W25A 1CY0A 2PWZA 1QIJA 5E0OA 5KTSA 3TM4A 1DBQA 1USUA 2FQYA 1H8HA 5CK4A 1ID8A 4K9NA 3KHKA 2XKKA 4GI2A 1HL7A 4PNPA 1O6CA 2HSDA 1JHXA 4IFTA 4O4LB 1TZ2A 3ETCA 4W5QA 1U0HC 3EXIA 1O94D 2OYSA 3I72A 4IUCS 3FTPA 3E9CA 3W7VA 4JL5A 4M8SA 3J81k 1GAXA 1LB1B 2GN1A 3KNZA 2HF2A 3L8DA 1IJBA 3MILA 4D8XA 1DX6A 3Q40A 1DAFA 1B43A 1Y5LA 2ZEJA 2OGUA 3PEYA 4OQNA 4AZ3A 2FR8C 2WKSA 1TYCA 4HYEA 2PJDA 1TOAA 5JEDA 4CHTA 3UT0A 1NQXA 1OX4A 1CT9A 3PKZA 2GRAA 1JIXA 2WJJA 4N5IX 2RHDA 4G56A 3QA9A 4NYMR 4F92B 5I8PA 1DT5A 2PQ2A 3DL7A 3TCKA 1W2WB 2XGMA 4RQBA 4BV3A 4DBLC 3O8RA 3I1YA 2O5CA 2UYCA 2BP7B 4LUCA 4Q4DA 4CIAA 1NKVA 2ZIXA 2ZRFA 2IHJA 1SVKA 3ABQB 4OGFA 4Y2UA 1W88B 3VX4A 3T1YB 4BKMA 2PWYA 3E15A 2HCTA 4HUQB 3AI2A 3GJQA 3UWKA 4G1UC 2G9QA 2ZQYA 3KAKA 2CKDA 3PVZA 4JEUA 1NM5A 3Q0TA 3AFNA 2QL6A 4L2IB 1RR6A 2XUOA 2FQWA 3G5MA 3OECA 3AVOA 4KO4S 5E1OA 1R0ZA 1UT6A 4G97A 2BGLA 5AKKA 2P2LA 3BRQA 1CUYA 5EJ4A 2X4GA 2Q1UA 2LDXA 1G21A 1K6IA 2MSDB 4OA5A 5GJCA 1RXIA 5TGZA 4QPJC 2COKA 4JLSA 5CFQA 3ZUPA 1M0SA 1O95D 3FF4A 4ZKEA 1ZZEA 5J63A 5BNZA 5KI6A 2ADFA 1CUJA 3ZDRA 221PA 2A94A 3E84A 5FRDA 5TPZD 2LP4Y 3W2GA 1DO8A 4O1MA 3BOSA 1GILA 3B12A 5FBZA 3I53A 4C3UA 1V3TA 4ZYXA 2PDAA 5I7HA 5L3QA 3O94A 4R40A 3DHYA 5TY0A 1DNPA 3AHEA 3GNLA 5K3CA 3QRWA 3UUGA 1WXXA 3CVJA 4N47A 4FU0A 3KQQA 4LI3X 2WTBA 1X86B 2GK6A 4IOKA 2VPIA 3UO8B 5L95A 5IT0A 1JDTA 3INNA 4NBSA 4WASA 2VJYA 4BNLA 4MQFA 1HGXA 2CFRA 3HXQA 1Z36A 2ZYTX 2Q3JA 3K72B 1O95A 3BJZA 4XZ3A 3QUTA 2CDRA 2G0NA 1EUCA 3HY3A 3C1UA 1PYGA 5ALWA 4RTPA 4FNOA 4HSEA 2D0PB 5ULLA 5FEUA 1ODJA 4RMGA 1N6OA 2DC1A 2TS1A 1NR5A 3FCUB 1XCJA 4PFSA 4P3PA 4Z4FA 1DZ3A 3MA0A 3QKRB 5LM3A 2VTBA 4HQ0A 2ONKA 3G1WA 3G2PA 1H2YA 4GDMA 5LQSA 3U44A 3JD1A 4YUXA 1X7YA 1RTKA 2I4LA 3WLPA 1Q1AA 2FVXA 1XEXB 4P7FA 2FUCA 4LDQA 2W2KB 2I6TA 3CLUC 1UXGA 5TT1A 3N5CA 1ZD8A 2H65A 3OIGA 2C2MA 4ZCTA 3RJ9A 1YBHA 3KSZO 1Z5NA 1KJJA 3NEPX 1EDDA 1UBNA 2Q9UA 4BP3A 3VYSB 4LF4B 3AP2A 5KEIA 3I0NA 3RFUA 1H05A 3KDSE 3ADPA 3HR7A 3RRZA 4I4IA 4WNAA 5BSUA 4CMKA 2PJRA 4M89A 2JD0A 2QV7A 4Z0TA 2INGX 3MFQA 3PPVA 2WWWA 4UE2A 4II3A 2WD8A 1WDTA 2KPOA 4YDQA 4QNMA 1T6XA 2YZNA 3S5UA 3CUKA 1RJFA 1XZKA 3NHMA 3H9QA 4CIDA 4WGFA 4PZEA 3GN1A 4P86A 2HV8A 2CEAA 5G4LA 3D5QA 3NWJA 2C8JA 1NV8A 4LYFA 1M73E 3ZCRA 4EPXA 5C7LO 2BEKA 2OXFA 4ZOLF 2IUEA 1YRAA 2Q0HA 4HNAA 3RE1A 3U4DA 1P7YA 2IS1A 1H2XA 1VLQA 1R12A 2JAWA 4JEMA 4B6OA 3M3HA 4AF6A 3AUKA 1JDBB 3DCJA 2H0AA 4GW3A 4ARBA 1A7KA 1RMYA 3ZI0A 4NONA 4UAUA 4PZDA 3VHRA 1RAEA 4BV2A 4H4EA 4KXYA 3Q7IA 1ZMTA 4N12A 2HIAA 4RKYA 3T7AA 2VDUE 3K5PA 3EBLA 2YDXA 3NBKA 1WXEA 4QDXA 4R3WA 4D7AA 5KUTA 4QPPA 2R6AA 1GGFA 3WWYA 2VF5X 3PUXA 3RUCA 5JASA 2PR7A 4WL0A 3VR2D 1DQZA 1KP3A 1ZCAA 4CFSA 5B6PA 3UCXA 4XWYA 1SURA 5IJXA 2ZAMA 5T4HA 3TIGA 2HK9A 2R8PA 4UBNA 2FEWB 2WVHA 3UATA 3ZDYB 1LUAA 1REQA 3AY6A 4BGUA 4WK4B 2BZ1A 2HMTA 2PD4A 3GIDA 3ASYA 3H2BA 3IV7A 4MXDA 4ZGBA 2CL7X 1MTZA 4KV7A 1NG1A 1VIDA 1XTVA 3TQCA 1PUIA 1SVIA 2JGFA 5B4TA 4LYYA 4R0VA 3VISA 2R6DA 2X7JA 1TECE 3PX3A 3AVQA 3BK1A 2QRMA 4PLVA 2V96A 5EE1A 4B4OA 2Y0EA 4P7JA 1Y8RA 1PJ2A 4ALNA 1XEFA 1YBVA 2FW1A 4Y2PA 1R4AA 4P92A 3WGIA 3F4KA 4BFCA 2OPBA 1K66A 1OQAA 5DE3A 1GNSA 4C3ZA 3ROQA 2XZDA 4QJ5A 4Q00A 2B4QA 5KREA 1ZSYA 3KQOA 4MJLA 2GCIA 4LOHA 2P11A 3BUSA 2YIJA 4NARA 4QOGA 2QNRA 4PXSA 2XYRA 1BJTA 4X94A 5AXCA 2ZKLA 4BJ1A 5MN6A 3X2EA 3PU6A 2YHIA 5M3BA 3IULA 4RCVA 3ETHA 2XMDA 2PS3A 3CGGA 3THSA 1P3DA 3HKEB 3O92A 1AXRA 5HBRA 5T7BA 3N2LA 3KLBA 2AR7A 4ZOCA 1VB3A 4U2CA 4A4DA 5L7WA 4OBEA 3WGVA 3IR6A 2YFKA 3PDHA 1V4NA 2WWYA 2WLSA 3OE4A 4O63O 3WLLA 4EF5A 5KDDA 3IVCA 3SCZA 3WZMA 1Z2PX 1TZJA 5T57A 3S2IA 2UXDB 4ZQEA 3IUMA 1SIOA 4YJFA 4A6EA 3ZVMA 1IN1A 2AN9A 3HA5A 2HF7A 3CRNA 3OJEA 4FIDA 4H7IA 1OWNA 4D8VA 2PSHA 2YXNA 3H11A 3C6XA 3MJRA 2EQAA 4L22A 3SBXA 3FPAA 3AINA 1XPRA 2JFNA 2XQKA 2VXOA 1HE4A 2CBXA 2OCXA 3HWX1 3IOBA 3O4VA 3OCVA 4O2BB 4Q9KA 3BM5A 4Z9YA 3JAWA 3I5XA 1I8TA 3QKSA 1XLTC 1FVHA 1V39A 4XVRA 1K2VN 1NIPA 4NBUA 4AQYB 4F9GA 3ZW8A 3KVOA 4IX9A 3HL4A 1Q19A 3MUOA 2VRBA 3EDYA 4I5DA 3UMJA 3FR7A 3LT5A 3R23A 2EFYA 4F91B 4Q7LA 4Z3KA 1T43A 1M1XB 2QJRA 2FDXA 3GCDA 3IP1A 2B1RA 1SC1A 3ASVA 4JYPA 5LMZA 1JFRA 3DGFC 4NMLA 3BF8A 3HMKA 1MUUA 1Z2DA 1N9GB 4P4SA 2VAVA 3D8HA 5IEBA 3MQ2A 4U02A 4ND1A 4WHMA 1KSGA 2VKQA 1R8JA 1LX6A 5DHPA 3VPCA 1PU2A 3DS8A 3IRUA 3OI7A 4K05A 2PX0A 3PR1A 3NHKA 4TUYB 1SN7A 3LUFA 4JVNA 1B15A 1D2RA 2WF5A 4DDHA 2OHVA 3KSDO 1AGXA 2CFCA 1SXJE 1FPQA 2LGJA 5BV7A 2EQ5A 1JPUA 2OXIA 2O8NA 4KFRA 2BFEA 4FLMA 1WQ4A 3NBQA 2ZBQA 4FOOA 4J90A 4V0MA 3W1EA 2C5FA 3HDJA 4DDTA 1T34A 4ZGGA 3U19A 3RQSA 4OJYA 1FLDA 4F3YA 1A63A 2AEMA 3FYTA 3OCWA 5HFJA 4A8JB 3VJRA 3L7YA 4RF2A 1EUDB 3B1JA 3CLTC 4GPIB 4P22A 3V8QA 1PJBA 5JYCA 3MWDB 4J49A 1C4WA 1GDHA 3DMFA 1GQ2A 2IYNA 2X2EA 3HDGA 1KU6A 3KLPX 3LCVB 4QBHA 1TZMA 4EG7A 2DCUA 1D4AA 4PC2A 3PT9A 4N01A 1IIRA 1ZHHA 3GX1A 4DCUA 4LZLA 2L69A 4E1AA 4U3JA 5IJ9B 4LYHA 4C6TA 3PL1A 5ALVA 2QRGA 3HR4A 3WRYC 3LX8A 1Y3FE 4UNIA 5CVCA 4DWJA 1QRDA 2BPOA 1OBCA 1M1NB 2ETXA 2PZEA 3R77A 2A0UA 2IDMA 4B8WA 1AQNA 1DXOA 5GVRA 4Y1EA 2EATA 1YO6A 3VO1A 2FSSA 3M8KA 4B81A 1SVSA 1QFZA 2GZHA 3CCCA 3L2OB 1P72A 3HCNA 5CT4A 3VSDA 1WA5A 3ABRB 1FBTA 5B1HA 1CUAA 3PG5A 3W6PA 4LHYA 2JD1A 5G02A 3W2EA 3UMYA 2PS0A 1BMQA 4RSMA 3DE3X 4AUMA 4N48A 1MJFA 4UDXX 3RPEA 2UV8A 5BV2P 2ZUTA 4MQEA 2IYWA 1GFIA 4UFNA 2GXQA 4XUGB 3TR0A 5C9ZA 3M3DA 1PV4A 1UEXC 1XZGA 2QX9A 3FA2A 3NWBA 4R9NA 1GTZA 3WWZA 4A0QA 4RJLA 3BXGA 3A1FA 3BD6A 1W75A 1Z28A 3OUUA 2WU1A 2GK3A 5DNVA 2OM2A 1CIVA 4LXXA 4EZEA 2GTHA 3DWEX 3DZFA 3ENWA 1B6GA 2XWSA 1ESEA 3PHLA 3QLTA 3QY9A 3PEVA 3QPDA 5H70A 3R6LA 3R8FA 1M5RA 3NTLA 5T4EA 2FPWA 5H9WA 3JASB 1QU2A 1RPNA 1IQPA 3WJAA 2WY2D 4RPCA 1VSUA 3FCOA 3MGGA 1D0VA 1Z8DA 2J9GA 2WZBA 3C8UA 2EHDA 1KJNA 4FR2A 4R1SA 4BP8A 1QKIA 4IHJB 3RAEC 1JZTA 2ZOSA 3M4XA 4MCIA 3WI7A 3RRMA 2BISA 4ZXFA 4L72A 3T41A 4M9CA 4BCBA 3Q3HA 4Z49A 3ANSA 2A4MA 4Q3AA 1J5EB 3NTUA 3SNKA 1XLVA 1G0NA 2DSNA 2GEDA 1FNNA 2ZR8A 2XMCA 4AURA 1J0DA 3ELBA 4N82A 4EPYA 2D54A 4HKTA 3MHPA 4IIDA 3ECCA 2PKQO 3EG9A 3EXIB 1QGDA 1OJ7A 3BWCA 4EJSB 5LWHA 4AY4A 2B7CA 1N5DA 1KI9A 3DVAA 1MLDA 3ZUGA 4TS4A 4DIFA 3DDOA 2UUPA 1U1IA 2QVLA 2PXXA 1W9HA 4QYXA 5J3JA 2COUA 1UBHS 3F0TA 3NZEA 4ZCLA 1XAIA 3GRVA 3BHIA 3DMHA 4KDRA 5EUCA 4AZ3B 1YDWA 2J31A 4G07A 5C7YA 1M8PA 1U1CA 3OURA 4RYDA 4YCNA 3FNGA 1KEVA 1NWCA 1OX4B 4XDYA 1DDIA 2ZK7A 4URXR 2PT5A 1QWOA 5IC6A 1WXWA 4BO4A 3NT2A 2HLPA 3QXHA 2QX8A 3T1OA 2JFQA 2FY8A 4BB9A 4Q1BA 4FMBB 4WJLA 3JU3A 3NIWA 1FUIA 1S3FA 1E3QA 5HMMA 3HB9A 4C7OB 4F3NA 5IAOA 2O8DA 2O1EA 1RQ7A 1WCWA 2ZIXB 3AKDA 3DLCA 4P0TA 4BMZA 2C1ZA 1TZCA 2JJ2A 2WFAA 3VR3A 1ANKA 3WQBA 3BXHA 1TDJA 4ZHQA 2IYEA 2LIVA 2QRKA 3ICPA 4LDJA 1PBTA 4LW8A 4GYWA 4WT7A 1XDZA 5KWIA 1Z56C 5JVDB 2FWMX 3RJTA 1JKJA 3C15C 4HWPA 1UPAA 3H1EA 5ENDA 5FJJA 4E5KA 2D4HA 2IDJA 5AMXA 2R8RA 1YR8A 3DQZA 3U09A 2GCPA 3TLEA 16PKA 5ETJA 3S8EA 1D8AA 1KS2A 3K9GA 4DY4A 1NUUA 4XGRA 3T1HB 2Z4SA 3SYMA 2NXJA 3OETA 3PXBA 1QF7A 3O4FA 4P4UA 4WADA 1G21B 1QGAA 4I4CA 3QE0A 3IT3A 1EZZA 2C2OA 3SQMA 4ZZ1A 3B3FA 3G8BA 2FW7A 4YYEA 3W5SA 1JDPA 2YC2C 4CF5A 5B55A 3UV7A 3CE9A 2AFRA 3IDSA 2C2HA 4Q1FA 4CCAA 5EJFA 4E5PA 4GDFA 1GFZA 3WL7A 2Q6TA 3IAHA 4D3DA 5EQJB 4P2GA 3TL3A 4DC0A 2PWPA 2QY9A 4EO9A 1VYUA 1LW6E 1JIIA 1MKYA 4WE3A 5FWXA 1ZD1A 2XMSA 3P2JA 1OPXA 4X0EA 5L3QB 1ICIA 1XXLA 2PZKA 3CIFA 2FUNB 3FGPA 4YWHA 2IA5A 5JSYA 3RSZA 1GOTA 5HZKA 3PRJA 4KRXA 2AOTA 4ZDJA 1PK9A 1WU7A 5AUOB 3NHJA 1R6BX 2QRNA 5CR9A 1ZGGA 2OV2A 2RC5A 3QVVA 4HMPA 1KVRA 4MQFB 2BFDA 1YF3A 3GLFE 1XQ6A 1QBGA 3ZIUA 3ESQA 3IKMB 1RAGA 3OD5A 1ZJJA 4L15A 5FORA 5J43A 3PGMA 2X8AA 4WLNA 1N6RA 2D00A 3F5SA 3OESA 3NAGA 1Z2CA 3AM4A 3O21A 4R2MA 4Z4GA 2YWFA 2V4UA 3SYNA 3NXSA 1DP4A 1YKGA 4C88A 5EHZA 4R8VA 2A5JA 2EP5A 4G0XA 1B16A 2O23A 3AFOA 4XLLA 1NULA 1DWPA 4G01B 2XEXA 3V4PB 3U44B 4GC5A 2WJ6A 1X7YB 4M1KA 1DO2A 3MJSA 4NX2A 3FVWA 3WAKA 4BO5A 4F9FA 5BW4A 4QFBA 1JEEA 1NV9A 1WF3A 1JFVA 4NFYA 4II2A 5HQJA 2V7BA 3QG1A 4IILA 4UEOA 5IW8A 3FYUC 4H4DA 1CZNA 5TQ2A 2CB9A 4OG2A 4JVLA 1VIYA 2ZE6A 4Z1OA 2MINA 1XF1A 1FFWA 1TRHA 1J7KA 1XAJA 4KBYA 2W6ID 3TRKA 4NV1A 3W4IA 5LBUA 4WNAB 1W2GA 4N65A 5SICE 2OG1A 2R3SA 4P5PA 4W5JA 4YCDA 3VU9A 2I1WA 2QZZA 4LDZA 4UTVA 3V4FA 3OTQA 3KJQA 5C8DA 3NDIA 1I6LA 3L43A 4TRJA 3FW1A 1Y3DE 3GRFA 3WNVA 1YMVA 4D46A 4LE0A 1SAYA 1P7WA 3PPYA 1WG8A 1ZNWA 1JU9A 3T0IA 3T94A 5C4MA 5FUWA 4JLOA 5BNWA 2RH8A 5JNSA 4O08A 4PQRA 4HWOA 4HNAB 1NJFA 2WA1A 4BRWA 3W6UA 4FDMA 3PUZA 1GN9A 1RZ3A 5FPSA 2X5JO 4AJ4A 1X3SA 2GETA 5A4MS 5CG2A 4CQNA 1Q6ZA 1N5IA 1VI2A 1GPBA 1ZGZA 2GLXA 2WYVA 3FCSB 3GLIA 2YVAA 2CV2A 1I1QB 2XGSA 3H86A 2OP0A 2W6IA 4IY1A 2OCAA 1G3IA 2JRLA 4OQZA 2B3DA 1XVVA 3R40A 3BZUA 4HB3A 1COWD 2QRQA 1VL6A 1NUHA 4UE3S 1FPMA 1RJ9B 1J0BA 2BV3A 3H1PA 5CH5A 821PA 4JH0A 1W2HA 3G6WA 3GGSA 2CWWA 4ROSA 4GS5A 3HM2A 3V8EA 1U7XA 2C57A 4G65A 4RANA 1NRWA 5JTTA 2H4HA 2VWQA 2JEOA 2O3RA 3I9V1 4ZTZB 3UB3A 2GA9A 5FEMA 2ZYHA 3HKDA 1XN4A 1JQ3A 5AVKA 4D74A 2L17A 4H1VA 3WL4A 4I5GA 4EMTA 1MVNA 1Y8RB 3FPEA 3KZMA 1GZ3A 4B45A 4B4KA 1UJ5A 4YYZA 2EG5A 1YA6A 2CD9A 4G23A 2Y1GA 4KACA 1J25A 3SEQA 3CF4G 4IG4A 3T3PB 3QPUA 4AJLA 2IITA 1VA5A 5IMSA 1UH5A 3BB1A 4D99A 4AQDA 1UKCA 4EABA 1Z26A 3WIOA 2A5FA 1G2PA 2O1WA 2VHQA 4X62B 4BPRA 5BR8B 3RG2A 3CX6A 1F4VA 1FFDA 1T6YA 1VDZA 3CC8A 4YTEA 3R7DA 3RFTA 4C3OB 3QI2A 4DCTA 3CVWA 1P4GA 3PGKA 4H16A 1EFRD 2ABWA 2YHIB 3P52A 1VHWA 4MI6A 4W63A 721PA 3Q8LA 3IILA 4DR1B 3AVYA 3UK1A 3FOCA 4MUAA 2NVWA 4V1CA 1OGYA 3Q9NA 2YN4A 2VZLA 3H5OA 4NS4A 1A8IA 1F06A 1QIMA 2EBFX 1OWMA 1US8A 1V5FA 3KOUA 2J3DA 4YJFB 1VP3A 1W4RA 1ONOA 2UZAA 4S1NA 4B3DA 4WY8A 4BUZA 3UBTA 5F98A 1RKXA 3FMGA 2RHWA 3H11B 3A9CA 4FMDB 4Q66C 4X20A 1N75A 4MUGA 3FKSA 5CNJA 3S2UA 3H2GA 2A1TR 3EC2A 3HUFA 2XMGA 4KIJA 3C1AA 3UM9A 4BQOA 3QEOA 4UXIA 3WYCA 3G0OA 2NSHA 3URMA 1M6WA 3JAWB 4KG7A 3Q9UA 1TRKA 3QKSB 4QHSA 1O5IA 5KHLB 3F5DA 4P80A 3JR7A 1NYRA 3JD3A 1XZLA 4YAEA 3E5HA 4ZT7A 4JLDA 4RESA 2PIAA 1TFRA 1YQWA 4UVDA 5CGQB 3P9QA 1P73A 3L05A 1ODFA 1FIUA 2HX1A 3EVDA 3DBLB 3UQZA 3QPAA 2B9EA 1LJUA 1YJAA 1AKYA 1JGTA 4BFZA 5IXJA 3AY0A 4LFCB 3NOXA 4MWOA 3PD0A 2ATCA 4P4SB 4PO8A 4PYKA 1G8JA 3T61A 3OA0A 2AQ8A 3L4BC 1CRZA 4WERA 2H2DA 4ZOAA 1M7HA 1QE0A 2FW0A 2PL3A 4CF7A 2JLSA 4GQIA 3OZTA 4RULA 3GWZA 5KMGA 1XNJA 3A1VA 3EASA 4C78A 1NG9A 1Q57A 1JVNA 5CP8A 1DJNA 2VDVE 2Q21A 1AUOA 2HIHA 2V7PA 1J0XO 1VBKA 2O07A 3BF7A 3KAQA 3JAKA 4FX2A 4HFMA 4TRRA 4Y7CA 1JHOA 5HVNA 4ZRDA 2BFEB 2ZJ7A 4MUBA 2H1RA 4N18A 5IEJA 1AHIA 1RAFA 2CYCA 2X23A 4RSHA 5I4BA 1U0TA 2AG5A 4ME6A 1GPAA 1P0CA 1P4SA 3G5TA 2NX2A 1SQSA 5AJTA 4NXNB 3CH6A 3BYZA 3VR6D 4IXWA 5FBRB 3UH1A 3MCWA 3BJEA 4IJQA 4U7GA 2HT1A 2ODNA 1D7AA 4GX2A 4BGEA 2ZBFA 4JUDX 4RL6A 1QIHA 3GK3A 1B41A 4ZA2A 3RF7A 5KYKA 3AI3A 3GUCA 1PS8A 1R64A 1NMYA 1C9MA 4ZVQA 1KK3A 1BFUA 4Y9RA 3VVCA 1NVBA 2JCGA 2PT7A 1T5DX 2GD2A 3BVPA 4AJPA 4CDMA 2P8SA 2REOA 1ADYA 1YQEA 2XKJE 3FFBA 4M4SA 3GLHA 3RSQA 3ZCPA 3PFHA 3A1EA 3CF2A 3UAOA 4BNWA 4J03A 3KZOA 3UYLA 1UK9A 3B8HA 3FMPB 3GJ4A 5F9HA 2QW0X 3QVLA 3GFPA 1TYDE 5IABA 1MMFB 2F3UA 4LSMA 3H83A 1TI7A 2C2WA 3N1UA 4OHVA 3A2MA 4QT0A 5LUBA 5AW6A 4O4JF 1WRBA 1YRYE 4CG0A 1BQ3A 1DEOA 2EBUA 1NXXA 1XDGA 1N92A 1VYTA 4G9EA 4OOEA 2QTLA 3IOCA 4M1ZA 4LQDA 4R41A 4BITA 3TDKA 2R48A 4PCLA 2C5HA 3ZE1B 2I8CA 2O2DA 1XNHA 3LQRA 4WXHA 1CV2A 2PX4A 2CXTA 4MQEB 3DLHA 4OLHA 4YHHB 1QS0A 5AKGA 4ND8A 3A06A 4F7WA 2B25A 2PGOA 2ZZNA 1E3MA 3PFWO 4JC0A 5TVKA 3W3AA 4BZPA 1QPGA 1RABA 3DAYA 4FYHA 4LJAA 2EFCB 4B40A 1Z63A 4LCEA 1FS5A 3IL2A 3DOJA 4KLZA 3SX0A 4JBGA 4YCSA 4UW9A 1T5IA 1C29B 2NXWA 2C42A 4LAFA 3L46A 2PRYA 3JX9A 3KHTA 1AE1A 2R5FA 3DP9A 5FR1A 4J8PA 3UV6A 2VAPA 1V95A 4EHHA 5AW1A 1K4KA 5JCOA 1SVLA 2X58A 5EN4A 2Z30A 1VLMA 2RARA 4IH4A 3LYHA 5FLEX 4V39A 3M5CA 5LYJF 2JH3A 4G8JA 4HNGA 3BTSA 3OPYA 3OH8A 5D85A 3W8NA 3WL8A 4EAQA 1QHSA 3QXJA 5HFNA 3PIIA 4BVFA 1YQGA 2ATEA 2EL7A 2EJVA 3HL0A 4QNNA 5D00A 4UPEA 1LQ2A 1Y3BE 5DI3A 4RA9B 2BYTA 3G2NA 2G83A 4DB2A 1H42A 3BGIA 1NF2A 5DSTA 5EXDA 3DF7A 2AQIA 3EG9B 1L5OA 3K0CC 1O9GA 3LQ4A 2PX8A 3P2KA 3V9AA 2OR3A 3DVAB 2Y4NA 4LC9A 2I2FA 1LF0A 2GN6A 3RVMA 3KG2A 2BDEA 2WHRA 3LQYA 5BUZA 4DSNA 1GR0A 1KQFA 4ZYYA 2WKWA 3MBOA 4KXQA 5F33A 4KRGA 1W59A 2Y1FA 3DM9B 1NT4A 4G0QA 2IYRA 3VI4B 4DIDA 5G3ZA 4TYYA 3N7UA 3OMLA 1E7SA 2FI1A 1TIBA 2AN3A 5AKLA 2Y05A 1S02A 4K6MA 1QK5A 4FGLA 2RKWA 4CUKA 2HNAA 1FFAA 2P2ZA 3P94A 4OKSA 4N0EA 2OKCA 2WPDD 4QWWA 2CE2X 4WINA 3DL0A 2FN7A 4OH7A 3LLCA 4PHGA 1DX4A 1OC2A 4FCVA 2O8DB 1U3VA 3K94A 1U0OC 3QFFA 4G1VA 3V4RA 2VRCD 1YASA 4EKEA 1F60A 3A1UA 3ANTA 2PFSA 3JPYA 1EZ4A 4GPTA 2BAGA 5BW6B 2VBFA 1SD2A 2XXJA 2AJ8A 1KDPA 3I9LA 1CEQA 4J76A 3WMGA 2OSVA 4WRRA 4BNGA 1M1UA 2JJ1D 3T3MB 1MJGM 4XGIA 2I4MA 3MRVA 3SXUA 2I2DA 1JSRA 1BVRA 3S5JA 3LA8A 3LM8A 3T4PA 1RQGA 3GMDA 3PYMA 4UM5A 3GXOA 2GGSA 2VCHA 4N5MA 2HOQA 4E21A 1VBMA 4NBNA 2Q7OE 4ZOLA 1HORA 1FU4A 1JQAA 1XYVA 3DV0A 4OJKA 2MYNA 4JOBA 4P4GA 3THXA 3R5XA 4QDOA 3FFWA 5I5GA 5F1YA 4D4HA 2WR8A 2QUBA 10MHA 3A6EA 2RHLA 3FJYA 3MGKA 5LMCA 1Z4PX 3KCNA 5FWXB 1IU9A 1S2IA 3KYDB 1J24A 4OMUA 1Y5MA 5A0TA 4LXYA 5CLQA 2G63A 1SQ6A 4TT3D 4FFLA 2R8BA 2H2IA 3H8WA 2R1VA 4KZPA 1ND6A 1WO8A 2AOTB 2OHGA 3EH2A 4JHXA 2NZ8A 3JQBC 4PC6A 5ESWA 5HUQA 4DUZB 1TEXA 4HVAA 1QVAA 4ZDIA 4AJEA 1VKNA 2B5WA 2ZQZA 2XJ4A 3SYKA 3FMIA 4D4GA 2HU8A 3BE5A 3MWEA 2BFDB 3MG9A 1VKJA 4Y9SA 1WEKA 5AXAA 3TB6A 2VNSA 1Q5PA 3FGNA 5BOSA 3PFGA 4DCSA 2DWOA 1L8XA 2HB6A 1U99A 3AUJB 1R5BA 3T5GA 2Q8QA 3NOOA 2BELA 1KQPA 1NWHA 4AN1A 3RSLA 5THXA 3ZH9B 4NTZA 3GFRA 1LDGA 2C9DA 3LDGA 3KXPA 2R2GA 1ULHA 2HEGA 2PU5A 3K3PA 5EMNA 3MRTA 1UPXA 3N3BC 1YZVA 1N2BA 1N3YA 4RS4A 4EHBA 1POWA 3ZGOA 5KPJA 1NT2A 1LDNA 1XZFA 2O2ZA 3CTMA 5ANRB 4IXMA 3ODPA 1U81A 2Z57A 5TQ2B 3QLUA 1H3EA 3SJAA 1NPTO 3L3BA 4IH9A 4J7AA 2MINB 3WJ1A 5BWBA 1OI7A 3EUWA 4XQ9A 4FTWA 4K1XA 3B6IA 1Y4DE 3IA7A 1J09A 1XROA 4PZ9A 2NU8A 1GPLA 2E4UA 3L7JA 1OYVA 3O31A 3VU9B 2BCJQ 1CG6A 1LPNA 1E77A 4DCCA 5JNLA 1W6UA 4QOIA 4KDCA 3PUKA 5ALQA 3NTRA 4LNUA 4TYQA 4QICA 3VGPA 1TZBA 3RBVA 1BX1A 4OFXA 2HJGA 2MSEB 4ZO6A 1TLTA 3P19A 4J16C 4JVOA 4Q9LA 1QYDA 3IQFA 2IT1A 2M1XA 1DQSA 3T9FA 2D2VA 1ADGA 3KO8A 4FLEA 1HNWB 2XX3A 5L3SB 2VUTA 1BN7A 2X5OA 3DULA 3IKVA 4RELA 2QTMA 2FSUA 1Z5PA 1UBGA 3KE9A 3DMPA 3CLKA 1LPMA 3UC9A 3MD9A 1W0KD 4TS1A 4BVBA 4BASA 3LL7A 1IOZA 2Z4TA 4QOJA 1JEYA 2CDNA 4H4CA 3X1DA 2A0KA 3SDBA 3VDRA 1L5SA 4GI3A 4UAGA 4PCUA 1W87A 3V97A 2W58A 4KEAA 1WV1A 3P0HA 3R7BA 4FBGA 1G0OA 4U9HS 2V03A 1LK0A 4S0ZA 5AP9A 1U3DA 1PWXA 1S3SA 2C58A 5JZ9A 4J6FA 3JZMA 1NVFA 2V7QD 5JD6A 1PJZA 4BNZA 4ZAFA 5FCDA 3ZHCA 3IBFA 4NXMB 1Y1SA 2ZRLA 2UYHA 3NRCA 4Q34A 5HZHA 3WLAA 2XZLA 3V2GA 1TE2A 1U7DA 3RB8A 4CCSA 3CMCO 2XV1A 8GPBA 2GHIA 3DCYA 5KOYA 4BGDA 4LJRA 3TCNA 4DA8A 1IEXA 1QHEA 2F3QA 4V0LA 3K8OE 4JVSB 1LLUA 2O3SA 1CK4A 3ZTWA 1E0DA 3R6GA 4M53A 2FW8A 1GZHB 1ZIPA 3N59A 4FXOA 2FRVA 3R9XA 1K98A 1XDBA 2R4QA 1Q7CA 1FYFA 4OK5A 5CXUA 3OM8A 2RHGB 3HYTA 3OEHA 3GMTA 3Q2OA 1OFIA 4ZANA 4Q1AA 4DQLA 2CJXA 3LWNA 5J4LA 1UCFA 1Q3HA 3OKFA 1HDXA 5ARBA 5JQGF 4ZK6A 1N7HA 3H0KA 2QGZA 2Z4RA 2IHUA 1Q3TA 1Y8AA 2I7CA 2P3OA 2YUIA 4ZT4A 5GJWC 2EFEB 2ZWOA 3ZLJA 1HQDA 1F7UA 4JP1A 4UUAA 1ULTA 1FSSA 1UWCA 4Y6PA 4YDRA 3SQNA 4F5DA 4V1CB 4QTXA 4RWEA 2FU5C 1LPOA 2J0EA 2J5BA 4HNQA 1E9VA 5G41A 3K6KA 1M2OA 2M2IA 1I7LA 2ZU6A 2M6LA 2FSPA 4ZO7A 1RSZA 2QTFA 4U4AA 4D5EA 1X8KA 2XQVA 3V8NA 1N5MA 4QXRA 1ULUA 1XD9A 1PJTA 2HFKA 1H9AA 4LOLA 2ZBUA 5G4KA 5JWHA 1QGUB 1H9EA 4MVWA 4X20B 5LOVF 1T8YA 2PBRA 1JT9A 2FAXA 4IZIA 4JLWA 1SELA 3AX6A 3DE7X 5ESDA 5FOWA 2IYZA 5AKHA 4GX0A 2UYYA 3UMMA 4KR0A 1SXIA 1ZHOA 3BGOS 5BT8A 2AH5A 3G8CA 1NOKA 3IT1A 2G7ZA 1QF6A 1L4FA 3OPXA 4GRDA 3OT4A 2AN1A 4M1SA 4R7GA 5IHPA 1VDMA 3AVTA 2OBNA 2D1TA 4KL8S 5DH9A 1GGHA 4L8GA 2KE5A 4A0SA 4F9TA 1Y98A 1LV8A 2P4UA 3BSFA 3LX4A 3NH9A 3FZQA 3HJGA 4HDMA 4G5OA 2O2EA 4YRRA 4UOEA 3V2HA 2AUTA 3WXBA 2J0VA 4GT1A 4CG1A 1WB9A 2HEIA 4FD3A 2P6OA 5I9IA 2G1JA 4CODB 4KH1A 1FC0A 1JIJA 3HXPA 1DGQA 1TAHA 4L08A 4DCJA 5BPHA 2ZIZA 4BGVA 1LC0A 3USCS 1NFRA 1MIOA 2CLMB 5KKNB 3JQFC 3FWKA 5FYDA 3JAKB 3NBAA 4KUEA 1HMPA 3B70A 1E0SA 4JFRA 1Z29A 1SUPA 2OBBA 3E9RA 1KO7A 4LZOA 2IZ5A 1T4GA 1JBEA 1F2UA 2TSYB 4W9NA 4NE7A 2G9VA 3RC7A 4IVPA 4PLTA 1MJ5A 3E3NA 2AG6A 2JIOA 4W7SA 5KNCH 1BDHA 1QH8A 1SR8A 3GZNA 2VPWA 3Q12A 1RAHA 2GBLC 3BA6A 3FOEC 1GNTA 4C6RA 2CHFA 4JUBA 2PLAA 2B2CA 4YREA 1Z6PA 3FTEA 1OX6A 2PBFA 3EC7A 3PC7A 4GLFA 1ZCBA 2P77A 2SNIE 3SZ3A 2BKXA 2NAFA 3LKBA 3SHQA 4KZKA 1RAAA 2AOXA 3W5UA 4D8YA 4RIEA 4BWFB 1C7FA 5AQ1A 3QE2A 4XJXA 1EX6A 2FPIA 3D7SA 4HGOA 4QM6A 3GHHA 3DCIA 2ZUSA 4N3AA 1SB9A 1AV6A 2ERXA 4X7RA 3JQ9C 2CZCA 3FXAA 3L6DA 4G26A 4TLAA 3UJ3X 4D44A 1HQYE 3KUKA 4JT8A 4DQDA 3SZGA 2VNAA 5JV5A 2B7BA 2VQ3A 3C6MA 2ZIUB 3L41A 5I9SA 2EWMA 4KYIB 2QL9A 2QUIA 4OOFA 1YB6A 2JJQA 3PJFA 3HHPA 4XCXA 1X74A 5TV2A 4NC9A 3RYHB 3HYLA 3KYJB 1MU0A 4U6NA 4O4IB 4KI0A 4PSAA 4ZGWA 2Z5LA 1GNQA 1C0PA 4IDOA 2IWRA 3WGTA 4FFOA 3ZQ6A 3ZU2A 4MV0A 1LDYA 2GA8A 2ACWA 2FUEA 2VYNA 3H5RA 3PXXA 1W30A 3AG5A 3D4PA 4ND8B 2ZWAA 3ZHUA 1P39A 3ZY4A 3F4BA 2DHEA 3UW3A 1Z15A 2CN1A 2GO1A 2OAP1 2YYSA 2EF0A 4S1OA 4N41A 4YUYA 2PGLA 5KC9A 2ZM6B 3FX2A 4JOQA 4PS1A 1I01A 1JR2A 3D6VA 4ESEA 4ZZ0A 3TMKA 1TL7C 5C3MA 4GMGA 1H0RA 3TG8A 1WZCA 3TOVA 2BKVA 4Q9DA 4BN0A 3T99A 2Q9AA 1OI2A 4UUBA 2RI0A 1PQPA 2XQIA 2BGNA 3H1AA 5KWVA 3GLGA 2I4NA 3GD5A 4C0SA 3I32A 3E9DA 1N2SA 1PCXA 3M4YA 1A9TA 1JILA 1RRKA 4CFZA 2I4RA 3EEQA 3STVA 3FWHA 5AM5A 3TGWA 1F8UA 3OPYB 3OIDA 1HNXB 1SUSA 4KO3S 1BMTA 1RRVA 4J91A 5DM1A 3K8YA 4BLVA 1IXSB 4JNCA 3RUDA 4OHRA 5DI3B 1WMBA 3FYHA 3IOMA 1XCGB 4HNHA 3NJRA 4Q1VA 4F6CA 3V80A 5AI0A 1Y63A 3ZD6A 1NN5A 4ZVRA 3KYCA 1U9JA 5AM4A 3STTA 1AT1A 1A96A 1EK5A 2AYZA 4JLVA 1LRLA 3HA7A 4KW7A 4EY5A 4C06A 5AW7A 2E48A 1JPJA 4LGMA 1LTQA 2C3MA 7MDHA 5CIYA 5IVPA 1GCOA 4Y9DA 2HHLA 1CKEA 1QC5A 3DZHA 3JQDA 2B8NA 4NFHA 3NBZC 4A3SA 3Q88A 4JA0A 4BNXA 4C2TA 1PD1A 1QZTA 1WMDA 2QR2A 1WZIA 4HAWA 3WISA 3Q7TA 3VX3A 4JLAA 4OQMA 2N1BA 3WGLA 1Y34E 4H9GA 3ONFA 4EI8A 2J09A 3IQGX 2H17A 1HURA 3KJNA 4CG3A 1FXWF 4COOA 2J4CA 2BMVA 3OZ7A 3VMMA 2XADA 3KLNA 4E03A 4ND3A 3GRRA 3V6LA 1XKQA 1II0A 1NW5A 1UC9A 5J4VA 4OREX 3PNSA 5KTTA 3HJBA 3KT8A 2JHFA 4NCBA 5EKSA 4KMOA 4L8YA 4PIVA 2PGNA 3AJRA 4LXGA 3W7AA 1DO0A 4WJZA 1BH2A 4OGGA 4R8MA 1KYZA 2QX4A 2DHDA 3NDPA 1N6PA 4HN9A 4GO1A 4TTRA 4DMKA 3SIPA 5CFOA 4U39A 4HVCA 3KT6A 1NW6A 2HT6A 4BLWA 2AMFA 1T5BA 2QJFA 1I6MA 1PD0A 1KI7A 3SXUB 5DF1A 3VNUA 4GP9A 5IWCA 2IBTA 5A05A 2EHJA 1Q0LA 4L0DA 2IH5A 4FE7A 2C2ZA 2Z3ZA 3QJ5A 3ZWBA 4D96A 3DTTA 1PT9A 3QFTA 4OMDA 4ZOLB 1KMQA 3DV0B 5HJEA 1X1BA 3A6DA 4HS9A 2SCUB 3PTLA 3SI7A 1ZJWA 4C0JA 1PQWA 4NK5A 2VAMA 3EZ6A 4WVFA 2UUCB 3FYDA 4GUDA 3F49S 4PPGA 4DCGA 1G7RA 2V7GA 4M0KA 2C29D 3HFRA 1IZ7A 4FX5A 2W43A 2RHJA 1GZDA 2QM3A 4LHVA 4TYPA 3SS8A 1G6KA 1UQRA 3WTBA 2HGZA 1S7CA 4PG4A 4R7TA 4OHMA 2ZRJA 2R1VB 3IVRA 1GAJA 2D3WA 4XCVA 5HKOA 1J0AA 3ZDDA 5IU6A 1V35A 4AX8A 2GZMA 2O2SA 1YUNA 4FWTA 3ZCVA 2FYTA 1UKZA 3IKLA 3IRVA 3LVFO 4K87A 1Q14A 3H0EA 3VNAA 2FOIA 5A4FS 5FI1B 4K9RA 4NU6A 1ECCA 5BOSB 3SNHA 5KAMA 3U60B 2JIBA 3PITA 3WLJA 1WCV1 2X9LA 3RSFA 2ZRCA 1NYTA 1OIVA 1P9NA 2AVDA 3WLRA 1S8NA 1QCCA 5ILGA 1AN0A 3VOSA 1MOZA 1DAGA 1HFEL 2H3HA 1AUXA 3NHRA 4MI9A 4QGAA 3MINA 4NZPA 1SUIA 1T5TA 3GAMA 3WGGA 4JBIA 1TQHA 1Z3IX 4FFWA 1G20E 3Q7QA 1AKWA 5JFGA 1UDXA 1G7SA 3Q3VA 3MWKA 2IU6A 3VPXA 1GRNA 3PC8A 3RFCA 1DCKA 2VJMB 5K03A 4D9IA 2YHBA 4L4ZA 4POOA 3V1MA 4DA6A 4ENRA 3SEFA 1L8LA 3FMVA 4P7GA 3BIOA 4Y6LA 2NU8B 5LQKA 5CRIA 4YRLA 2Q27A 3RIGA 1PS0A 3TW6A 1YFZA 4WBSA 4QVGA 5D3MA 5H8WA 1C1XA 1PSZA 2W8BA 1G5TA 2ZATA 3GDGA 2WAYA 3T7DA 4AMZA 2AFIA 3OZSA 4KFCA 3PWZA 2DSTA 5F52A 1I1HA 3AWDA 1E6MA 3OTIA 1ISPA 4U2GA 3EVBA 2Q46A 4HQFA 1H85A 5DYIA 4MVYA 1I7NA 1S2DA 2H1WA 1I1NA 3HI4A 3A1WA 4L8LA 1EVYA 5FULA 3KKQA 1K0UA 4WZZA 4EQ6A 2NXCA 3BCHA 4H3SA 4BIMA 3D54D 3D7LA 1E99A 1N6HA 2FF5A 3JRWA 2PMEA 4Q4CA 1IPEA 1KEKA 1JLRA 3D3QA 5C7OO 2MOKA 1B0UA 1G1AA 3FY4A 1OWLA 2VAXA 1VL1A 2X0RA 1KKLA 1MC5A 4MCHA 3QU7A 5DWVA 5FDFA 1JEYB 3JATA 2W6OA 3WGKA 5AHRA 1QV6A 2JAUA 3BWXA 1UBMS 4JD5A 5KKAA 5EJ7A 1X7WA 1NLUA 2RC6A 2WA2A 1QCDA 4FFBA 3ICCA 4IIXA 4M1MA 3PVSA 4AJKA 3O3CA 4HEQA 1L4LA 1M74A 3DPUA 2OVBA 3C97A 3D1LA 3OMWA 2FPLA 4ZPJA 2I1LA 4ER7A 1OU4A 1WW3A 1GU1A 3CRRA 3NRBA 3FZYA 4Q15A 4UUQA 3EQZA 1U7WA 1YJCA 2YV3A 1Q0ZA 4QD3A 1N8NA 4TL9A 2COEA 2ON6A 4HHEA 1B3RA 1V8OA 3LMKA 3KT3A 5IAJA 1CVLA 1T1SA 2XNDD 3PQ4A 5KQRA 2XYQA 5C53B 1P2GA 1G8MA 5HF6A 3OD1A 621PA 3Q4GA 3B6EA 3R9XB 2VBCA 3KEFA 2O54A 4A2QA 1O5OA 2WFZA 2EZTA 4PGGA 4EHIA 1QFJA 3O6VA 4Q3LA 1NDQA 1NNUA 1IIBA 4IXDA 3PGJA 1EAYA 2CEKA 3IQDB 2RSLA 1T8UA 5EXTA 5JT1A 3WIBA 5COAA 3ENNA 3VNSA 1TJPB 5DMHA 2HJSA 1T8SA 5GM2A 3QFCA 4R2LA 4B6JA 1QWSA 3CNLA 4MR7A 2R87A 2A9VA 4D9FA 4E1BA 1JBKA 1N1GA 3CFYA 3MBKA 4MYDA 3UY4A 4X7PA 1M2OB 4UARA 3OF5A 5EI5A 2YOHA 2WWIA 3LUDA 1L5GB 4EG8A 2JASA 1N2GA 3H6HA 4OQ4A 2PMCA 5G4KB 4CV0A 3DB2A 3OEEA 1L5YA 3U9TA 4EVSA 2EXXA 4UASA 3O91A 2F1OA 4MWBA 1TM4E 4ODIA 3X1ZA 3KKEA 4DM7A 3CRQA 4FW8A 1K92A 1OXKB 5JJLA 2XJ9A 4LJSA 3ELDA 4O4JA 2A5YB 3LWZA 1EGHA 5EMMA 4BVLA 2O8EB 1ZVJA 4CNBA 3H84A 1C5KA 3ZX5A 3HV2A 3X2SA 4NR0A 1PFQA 1U11A 2MYTA 3SX2A 1QZ3A 1EDZA 1T91A 1RXUA 4HDMB 1ILEA 2FMUA 1N4DA 4US0R 1QPBA 3WHLA 2A1IA 1K8YB 3UPDA 1YQTA 1VJ5A 1BFKA 3ZC3A 3MQ4A 4M1QA 2JFVA 5DLYA 1JSLA 1SCQA 4GPAA 2CCGA 4NENA 1ZPDA 3U37A 5IDYA 4XLTA 1U1DA 3WRVA 1CYEA 3JCZA 4DNFA 1YS2X 3FMFA 4RKWA 4QOEA 3RJMA 3SE0A 2I8LA 1MIOB 5FH9A 3B3AA 2UU9B 4JLBA 8AT1A 2IHZA 2PUHA 1GRRA 3CR3C 1VTKA 3STHA 4BU1A 3DTVD 1SOMA 3K09A 2IEYA 1J21A 3ETDA 4XASA 5F3DA 4XSHA 3GNTA 5BXYA 1F2UB 5G0SA 3S0JA 4AO7A 1GU0A 3BT7A 5JAQA 5LYJA 5I7WA 1YJBA 1RM3A 4K7JA 4ZEVA 5JCJD 5JNVA 1PIWA 1WHSA 2PZBA 5J2UF 3FUWA 2NSYA 4DV1B 1B4DA 1QH8B 1E1RD 1TTHA 2YJ6A 3BPSA 3DKVA 3H4MA 5DDIP 4JYBA 3TRDA 1XXHE 2B4RO 3B9QA 3ISTA 3QMWA 4HDKA 3EIXA 1TMOA 2CFSA 2PYZA 4TN5A 4XB1A 5EE9A 3UN1A 4G84A 4DMCA 5AKYA 1R9NA 1ENOA 3O75A 4X84A 4A0HA 4GPBA 3PENA 4RKRA 3ISJA 5DM0A 3JVDA 2YWCA 3CX7A 4L85A 4RZUA 4K9OA 1UWLA 1P31A 2XIJA 5TVGA 1TUIA 1HFKA 2FPIB 2OBLA 3O8NA 2PR2A 1LF5A 4EECA 5ITVA 4OLJA 4CUJA 4DMLA 1SHKA 4LN1A 4NP6A 4BO7A 1BX3A 4ZJYA 4IQ0A 1A62A 4DJFC 4E7PA 2I4TA 3WSTA 5CEEA 1Q0RA 1A9ZA 3MW8A 3BD7A 1RXCA 1G2QA 5AXDA 2DH5A 3P9ZA 4G4JA 3IXLA 3EAFA 3N5KA 4ZQBA 3RVQA 3TLZA 1AX9A 2CLHB 4U6QA 4P08A 5IUKC 5THQA 5CAEA 4L6AA 2QD4A 3VZBA 1T2DA 4Z86A 1B6SA 1K63A 1XEWX 4PYNA 5CHEA 4R9VA 1NMSA 4OLBA 3QX9A 5GZ6A 1S3IA 1RBQA 5E6SA 2I1VB 2WJAA 1ZGHA 3HK2A 4MV3A 1TMKA 9LDTA 4PS0A 2C1XA 2OBYA 3FVTA 4DV6B 3OLZA 1IHUA 4KPUA 3AYZB 5G1NA 5IASA 2BTEA 1DUSA 4ZK2A 1AMNA 1JG7A 3A3YA 4XUDA 2HSJA 1TD9A 4X8OA 2YMPA 3ADOA 1KMHA 1B0ZA 2EX4A 4DF3A 3LCJA 5F1KA 4U2KA 4Y2XA 1TW2A 2CVPA 3GA5A 4D1YA 4JJGA 5DWQA 3R09A 5EY5B 1SZDA 2Y1OA 1FQJA 3G0IA 2BJWA 4H77A 2I7XA 4I1UA 1YJ8A 3VNRA 5DSXA 4BLRA 1M5TA 3IPAA 2WSMA 2QROA 1KFEB 4MWSA 1PVDA 4QDKA 1USWA 1H1LB 2FN4A 3LBYA 5IT4A 2PQMA 4NDNE 4IXTA 1EP3B 3FIJA 4QQKA 3D5EA 1LVUA 4CF3A 3V1KA 4EZBA 3WV5A 3EDCA 2IODA 2W0SA 2BM1A 2CCJA 3P27A 2Q2OA 2WILA 2FMHA 2X4LA 1FE8A 3NC0C 4KQ2A 2HQ1A 4NZYA 2PKCA 3KYCB 4KJZA 4RLFA 4IMJB 5H83A 4A92A 2ZSEA 2GLUA 3PUIA 1JDJA 3MTJA 2BD0A 2SKCA 1IPFA 2B8TA 5CK5A 1AVTA 1D4FA 3DSRA 3NIBA 2OY0A 1JKIA 2W2QA 2Z8ZA 4CWAA 2QNIA 3DDZX 4JJ8A 2IUTA 2ECFA 2C99A 4ID3A 2ACKA 4IMRA 1QC5B 4DXAA 4JJEA 1I0IA 1JT2A 4FHEA 5K4HA 1H6AA 2IU0A 4RMNA 5LMUB 2GH1A 3AR7A 1LA2A 2JCVA 1T0UA 2ZAGA 4EG1A 2AFHE 3TK1A 2JGMA 3K9CA 4PYOA 2XUHA 3TD9A 3DDSA 3F71A 3FPFA 4UBJA 3U80A 4R9SA 1JE1A 2ZDGA 2WABA 4TTQA 3TI7A 1E9BA 2AQHA 3C3AA 5I7VA 3KQHA 4HX5A 2JIPA 4YJ2F 2OHFA 2YMMA 3ELYA 2I55A 1ABBA 1T4BA 1WCIA 1F9EA 4CU2A 1HKHA 2QG6A 2OA0A 4M0FA 4MR9A 1EQUA 4IIVA 1WTAA 3V33A 1C1HA 4EJ6A 3PICA 1GTJ1 1E0KA 1TA0A 1UKAA 4II7A 1XKLA 4GGPA 4W5OA 3OSUA 3LWBA 2PH7A 2ZJZA 5DTRA 4D6XA 2A4KA 3UK2A 1CJTC 4XWGA 2A57A 1MGPA 2NU7A 1T1IA 1KAQA 1ZG3A 1CZKA 3G7SA 3KZVA 2SICE 4IQ8A 1QONA 3LHSA 4NJEA 1HSZA 1KETA 4QUDA 3WYFA 3I05A 3I76A 4I1SA 2R44A 4DMHA 4RDIA 3EFHA 4HEHA 2RK6A 2NUAA 3O8CA 1XG5A 1TB4A 3HLTA 5AW5A 1G64A 3TCXB 5J5VA 3VR5D 1XMSA 3GFQA 4DBLE 3BTOA 4PW0A 2VP0A 4F2PA 1U0SY 4YRMA 6NULA 2I9PA 3AILA 4DT1B 4QDUA 5HF9A 4G8DA 1T10A 1MDFA 1JDBC 3GYBA 3EEIA 3UJNA 5AW0A 1B8NA 1L7MA 4PHFA 2N1MA 1EK0A 5K3AA 2HY7A 4JBNA 4MR8B 2ZS8A 4L8FA 2H7VA 1MABA 2QU7A 4C0AC 2IWHA 3NVMB 1CHDA 1CY2A 3PEUA 2ENUA 2EV9A 1U1FA 1WAMA 3E0XA 3RREA 2ZP1A 3K70B 4HEJA 3K9FC 3SHWA 2QMHA 3OU7A 4TSKA 3BHNA 4G5XA 3GELA 3BRCA 2IZ0A 4L76A 2O6LA 3HP4A 3ZHTA 5HJ5A 3B89A 2NMVA 1TAGA 4E11A 3VR5A 4BX3A 4XFKA 3P5BA 4GBJA 1CNMA 1AKVA 1T4MA 3ZHYA 1Q1GA 3RIHA 2FEPA 5B2ZA 3LUBA 1SKYE 2ERYA 1T8PA 3IP6A 1RM5A 1JJRA 3R5JA 1OT3A 4KXFB 4RENA 4DLSA 1JFTA 2A9FA 3MINB 5B6IA 4M9ZA 2C9ZA 4EB3A 2JGIA 3X3HA 2QTHA 3F7TA 4TWZA 5TSDA 2P69A 4BNUA 3ROPA 2A9JA 3GIWA 1OY1A 3ADKA 5C0OE 1V3UA 3PQ8A 4H7FA 2B61A 2QPLA 3IP5A 3MN1A 4RH1A 2FR8A 1AKQA 2I6SA 2O2GA 5JQGA 1L8QA 3H5IA 4HH0A 3UWSA 4C0KA 1H4SA 4S2EA 1HE8B 2IS4A 2XVMA 4WOKA 5FUQA 3IKJA 4AC9A 1BE6A 5I7EA 3EGWA 2WK1A 3T3NA 1DG3A 4BFSA 5D3MB 5FF9A 1C1XB 2W8BB 2ZTHA 3A28A 3GOQA 3OBIA 4Q0MA 1JSCA 1EUQA 4W9RA 1S3GA 2AFIB 3Q5DA 1DBPA 3CUWA 4XWTA 5AVZA 3R3YA 3CS3A 3WMWA 1XKTA 2PHZA 5FUBA 3HYSA 1A50B 1DAPA 1W34A 3HCWA 2F1RA 5F9MA 3ZZMA 4XIYA 4AKTA 3D6UA 3ASZA 4EJFA 1KC3A 1CJSA 3FCEA 3IQEA 3HP7A 4C0XA 5LOVA 1ID1A 4EQ6B 2FMKA 1FQOA 5EP2A 1SXJD 1IZYA 5B57C 5CXXA 3IR7A 1Y1KE 4MCJA 1ZMOA 3GJ3A 4K6GA 4UNNA 1Z4MA 5LLSA 4KR7A 1GY8A 1ZCFA 1R88A 2V9CA 4ZQHA 1EX1A 4BJHB 4KREA 5E6UA 2QZ9A 2PUWA 3JATB 1ZH0A 2XUZA 1NYQA 1BH6A 5DN6A 3A1CA 5JIBA 3KOYA 4MYCA 2XT9A 1BMDA 1OXSC 1U31A 3W2TA 5K01A 3MOIA 1X7WB 1W4CA 1J2JA 2ZSIA 1CR1A 2FLKA 3L6CA 4OFZA 4ZAZA 2A7XA 4FFBB 3STYA 1FRZA 1C2TA 4B4VA 2GUWA 4Z4HA 2HA5A 1L5MA 2DUMA 3EZGA 3Q7RA 4Y9UA 3OZAA 5EJGA 5F2EA 3S2ZA 1NLZA 3ZGYA 4ARIA 2BEUA 4PYQA 4LQCA 5ALDA 5LXTF 5K5EA 3ZJVA 3IPXA 1ESMA 2CL6X 1SXJA 5TPWA 2WJ3A 4QGHA 4IMIB 3WGHA 4P8RA 4BC1A 3DV9A 1NE2A 3IBYA 1H0HA 4MKGA 5CTJA 2CXUA 3JAMA 4EYEA 2J46A 4HLNA 3TZHA 4C7XA 4KLNA 3I2IA 3AH8A 1R66A 5DVZA 4BQRA 4H08A 4JAVC 3NYIA 4GOND 4YRIA 1AMUA 4PVDA 4YJ3F 2QTZA 3RW9A 4WCDA 2XOEA 3I83A 2O2IA 5AM3A 3BWYA 5K51A 1TUBA 1VLVA 1PWEA 1IZ0A 2PA0A 2OFPA 2PUJA 3RANA 3RIMA 5FOUA 5FQNA 4LV8B 3WDSA 1ZJ5A 1VMKA 3I9V6 1GG5A 1BDJA 4GLLA 4MS1A 1AJEA 4IP0A 2J08A 3RHFA 2ZI6A 2VHUA 3LLUA 4O3MA 1KU0A 3TN7A 3V32A 3EPKA 3GUUA 4M87A 4A8JC 3ZVRA 4RNCA 2GZ1A 1EXNA 3PQ3A 4GWKA 3W4KA 4IHQA 4JOCA 1S7GA 3TLXA 3UUWA 4LYDA 2RKBA 3D4LA 5HM8A 3EZYA 1BDIA 1EI9A 1M2FA 1VFPA 4ZTBA 2VDWA 5A62A 1F8YA 2VTKA 3KPVA 3QOXA 4MTCA 4OAPA 1Z7BA 5EFZA 1PJQA 1UZAA 5A9SA 4ZT6A 4XDZA 2M6RA 1ZBDA 3UMGA 1UPBA 2VYVD 4EUKA 1SC3A 4CG2A 2VCEA 1SG0A 4D45A 1PO7A 3F7OA 1GKKA 4N54A 5CIUA 5EZQA 3CZAA 4O4JB 4BPBA 4MGYR 2W70A 1PL8A 1MPXA 3PJRA 4JDUA 3OWHA 2AUNA 1EIWA 3D6NB 1EFUA 3JQEA 2Z1MA 5AO9A 1I7SB 2PUAA 1OR8A 3N7TA 1WDWB 2V6GA 3NBXX 1XNQB 4MWGA 3QYAA 1GXSB 4RY0A 4H1WA 1F7VA 2AN4A 2QG4A 5LQJA 3R9KA 3F8SA 5MHTA 3I1JA 4Y1GA 4B6QA 1YK1A 4ESOA 4OM8A 1GQRA 1HXHA 3EXAA 3GJ8A 3HB0A 4OUKX 4Q18A 5B1SA 3QKJA 4UVEA 3T7CA 1NN1A 1N78A 1C3JA 2ZAOA 3GP3A 4M37A 4RX1A 1FNSA 4YJDA 4K88A 4E5VA 2B0JA 4GOOD 4NENB 2FZCA 2FSFA 2QT0A 3HYRA 3K32A 1J22A 1K75A 2FEOA 2WNIA 5IAEA 1VL8A 1JH9A 1SCUB 5I9NA 2CLEB 1BQ4A 1JHMA 1UKEA 3B60A 3QV2A 3UHOA 2RGRA 5C37A 2J0UA 3KFVA 2JIZD 3QJYA 4TKVB 1H66A 2Y6UA 3PXDA 1AKUA 3C8DA 4L8VA 4TSFA 1GRCA 5LYJB 4FCWA 2OV4A 1WHSB 4P93A 2PUVA 5IMBA 1YD7A 3A3OA 1M7BA 3NEYA 4K9DA 4LRTB 1MX5A 3VU3A 4WTOA 1GO2A 1A1SA 3IVAA 4L9RA 4DWWA 2PUDA 5F76A 1PWZA 1R7RA 2B83A 3WWPA 1Z4KA 2Q4RA 1N0HA 4ISBA 3K53A 4YRFA 3J80A 2WT4A 2ZPTX 1H1JS 4YRTA 4Q6WA 1Y9JA 5IFKA 1VI5A 3FIUA 1RS0A 3J81A 1YR7A 2BF4A 3GLKA 1VJRA 5FO1A 1Z74A 2YR0A 1I10A 3GG9A 1XVAA 2HSEA 2J7KA 4RZXA 3GB9A 4QGBA 4EJSC 3A2LA 1ZIXA 3LVQE 4E6EA 2R96A 3NYWA 2IP1A 4NI5A 4MYUA 1PAUA 1I6WA 4YP7A 4AJOA 1MT0A 2OQ2A 1XZDA 3KSBC 4G0UA 2HA7A 3IPYA 1Y1QA 3GVCA 1N6KA 5TDHA 5C4IA 1QRSA 3ROKA 4ESVA 1UF9A 2VDNB 3RTBA 2KBEA 2CK3D 4NAVA 3ZEAA 5GVSA 5AJVB 2NV6A 3AJ8A 2YW9A 4FDVA 5F2KA 1FXWA 2H1SA 2IOYA 4BJ6A 4LK2A 1EJBA 2AG1A 4IAOA 4BP1A 1I4WA 1Z5GA 1G38A 1UADA 4JI6B 3FLBA 1PI3A 4RTJA 1DRUA 3QWFA 4JNKA 4KXUA 1BGVA 5E6SB 5HNKA 1BSVA 2VF7A 3KEOA 4CI0B 1FMCA 2OAQ1 1O94C 3E03A 4QDJA 2D74A 1ECFA 5IC4A 2Y1WA 3TZCA 3WYBA 4DMFA 4EB8A 2BVNA 2VDPB 4I1PA 1ESDA 1ZVMA 3KEMA 4KPUB 3KJGA 4Y30A 4KK3A 2HO4A 4JC8A 2D5IA 4DNOA 4QX6A 5I7SA 1OZGA 2BUAA 5IVDA 1XLTA 1KMHB 4B6GA 2ONCA 2XQGA 3V9PA 3ZNQA 4BCCA 2CZGA 3O9MA 5DBGA 1UP6A 3P20A 2AR9A 1G8YA 5D87A 3FUVA 3VDNB 2WE8A 1RWPA 3G9TA 1ZYUA 4OGLA 3STWA 1X7GA 4R2KA 2XCIA 1A5TA 2Y8EA 4ZT2A 1T2EA 3H0CA 3R3UA 4ISCA 3GA7A 3KZ1E 4YPFA 3SM3A 4TMVA 4KLCA 2VP2A 2V9ZA 5HF5A 3PE3A 3EQ7A 4GSYA 1Y89A 1V5IA 3OE1A 2X41A 1QHFA 4KE7A 5ICFA 3C3BA 5JD4A 3SVTA 2GM4A 3AF3A 4RHEA 3R3JA 5L3ZA 3SS7X 2CNWA 4QHYA 5EAIA 3U7IA 1F2VA 4TVBA 1M6YA 5CT6A 4C30A 2JRCA 4RF3A 3TVDA 1R4MA 2FA9A 2Q3LA 4HB0A 4JVMA 4JT9A 2D0IA 3IJRA 2PSJA 3E5NA 4E13A 4AF7A 5LBIA 4DR2B 3TW4A 2Z3WA 2E82A 4KBGA 1K6JA 2FPXA 5B7GA 2QRLA 1MC4A 4E4YA 4ENVA 1RU3A 3DLTA 1DHRA 4MUFA 1O95C 2VP3A 2XUQA 1GT91 4FFNA 4QIHA 2J87A 3R0XA 4UDYX 5C80A 4QATA 4X45A 4BO6A 1U7ZA 4L73A 1L9XA 3KQYA 1TQ4A 1UIMA 2J9FA 5E8RA 3CKLA 1EJ6A 1FDTA 3U81A 3A9UA 3MAJA 5AW3A 2AMLA 3AZPA 2GDJA 3LKDA 3D64A 3KP1A 1I2AA 1RPTA 4IR7A 3HJNA 4AMYA 4OATA 4MR9B 3IAAA 4DKXA 3TJMA 1R5JA 1ZN8A 3WRYA 3LYAA 4CM5A 1KC1A 5HX7A 4KQHA 5CDGA 2NIPA 3OKAA 2AKAB 4O1HA 1NJSA 1UP7A 3N8GA 2GTIA 3L8EA 3S44A 4QUBA 3VZSA 3D4NA 4TLBA 1YR2A 5DWDA 3HN7A 4MAFA 4XM2A 5G3YA 4B83A 2HMAA 3RSGA 2FRXA 4OB6A 1JZSA 3ACDA 2NU7B 4OYRA 3DMTC 2B5VA 1U4SA 4NJEB 2H1OA 2XRFA 4UXHA 1SO8A 1DBIA 1TJYA 3O83A 4UVHA 1K7XB 4C14A 4MGKR 3OQHA 1TEVA 3OVMA 5T3UA 2NO1A 5GZ3A 3NX4A 1IHOA 5BN5A 3ENZA 4CN8A 1PJ3A 1NBAA 5KC8A 3LPCA 4KFSA 4HAUA 4QUJA 3UG7A 1CZOA 2RH5A 1EXDA 3RLIA 4L9WA 3SAJA 4BGIA 1TM5E 1XQWA 4NYIR 4AP6A 5E7IA 1P91A 1M2NA 1PZHA 2FXVA 4EKGA 1VA4A 4YB8A 3KQSA 3PNMA 1PFWA 2O2JA 2O50A 5EIBC 3SC4A 2QN3A 3BREA 1HYGA 1MABB 3LUJA 3BJIC 5ALGA 4YT2A 1XV5A 1NSYA 5DX0A 4B47A 1T9GS 5FWDA 1ZIOA 4ZCQA 3SJBA 1U2GC 4FOPA 3LZCA 5EJ2A 3OFSA 1J5PA 4ZZIA 3G49A 4JJ6A 4EGQA 4PR0A 4KHPB 3LBNA 1DRWA 4GQAA 2BJVA 2GJ4A 2R8OA 5IDQA 4QZVA 4BNHA 1KHTA 1QBKC 5E1BA 4DR7B 1DFIA 2B6HA 3IMFA 4CIXA 3E3MA 1AQIA 2B37A 4YGYA 2EKDA 1BJKA 2PKEA 2PL5A 2VT2A 3IDQA 1IEWA 3PTZA 2H52A 1JWBB 1XTKA 2ZT8A 3K1TA 4JU9A 2HC9A 2A78A 3DXYA 4DA9A 4YPOA 1E2GA 1QO0D 3TDMA 1NSTA 2WHEA 5JYEA 1NXPA 2ILTA 2QMQA 3P9IA 3Q3GE 3E8SA 3X0DA 4P82A 2JPDA 5E3HA 2AJLI 3F9IA 2P9GA 2XYGA 2WKPA 2AS0A 4CDGA 3LKVA 4KK4A 1IG0A 3E5MA 3SKYA 4EHJA 3ONDA 4ENUA 5K0TA 5EC8A 2BOVA 5E6RA 3AOGA 4D6PA 2O14A 3BFXA 2CLLB 3EQ6A 2UZ3A 3KV3O 3QEKA 1PFGA 2GEUA 3QPWA 3CEAA 2YCBA 4I1IA 4J1TA 2KMLA 5JQGB 2A7QA 1RI1A 2W6JD 3NAMA 4BMDA 1P9OA 1HQKA 3A4NA 2W93A 2W11A 5BMVF 2C2GA 3EGEA 2AXEA 3U26A 1ZVKA 2IY7A 1U5CA 4C22A 2QX7A 4TMZA 1V45E 2G09A 3AHIA 4R2JA 4MVCA 4BVGA 3LL4A 3PPIA 1XFAA 1GPNA 3F6PA 4I50B 4R5MA 3F8WA 2F8LA 5HCIA 5CEJA 2K87A 3KQLA 1S4QA 3JV7A 1EFAA 4CL3A 2ZJAA 2XWQA 4D3FA 4DY6A 3ZD9A 4O5AA 2BFAA 5BUCA 5LOVB 3ICEA 5M04A 5B58C 1L5FA 4JXZA 3WXMA 2C5GA 4GP6A 4NATA 4ZVLA 2FW9A 1MORA 5KQLA 4NL4H 4OJMX 3IBGA 1LPSA 2EKBA 4WLEA 1A97A 1E2MA 1PZGA 2D13A 1R5OA 2HXGA 2FEXA 3C41J 3PGA1 3PIDA 4DUGD 1EGQA 3TO5A 4CLRB 1FUEA 1GTVA 1K5GA 1GPDG 2VDOB 1BKSB 2X6RA 2ZGVA 3RAJA 4XPIB 2DFVA 4BLOA 2FGJA 4F2DA 3WV4A 3ZJ5A 1DAHA 2VUHB 3UOGA 1JR3E 2Z04A 1IBLB 2Y67A 2VJAA 3OJOA 3WK4A 3I5MA 4EYKA 4NU5A 5BNTA 1R74A 2PWBA 1E79A 4OXNA 4LFBB 3X1MA 1SXJB 1NZJA 3NPAA 1B93A 4A26A 5BORA 1FS6A 1LBEA 1UT5A 2EIXA 5AUQA 2ZJFA 3TYXA 4W5HA 2LKCA 4O4HF 3VHQA 4B3IA 3ENVA 3PQFA 1EUZA 1NASA 1U7OA 4HTFA 1MB0A 1OXTA 3B1FA 3TKLA 5C7IO 2R8YA 3I52A 2OCDA 3UUFA 2GRUA 4ID9A 2VLBA 1AY0A 1IN7A 2I80A 3LUCA 4LY0A 4DSTA 5CYFA 2FDCA 1G9XA 1YAHA 4BAGA 4C1NA 3CH5A 5BQFA 5J2UA 1TUBB 3F2IA 5DHSA 3QKWA 3FHTA 5H68A 1E3DA 4F21A 1CCWA 3FB1A 1R0WA 2FGKA 4U7WA 4QO7A 1LK5A 4DWVA 5J58A 1H4TA 4MS1B 2OAGA 4PG5A 1PEAA 4AMGA 2IGBA 1IMJA 3FHOA 1U4NA 1KSHA 2MWMA 2FWPA 1Z25A 2ZIVB 2Y1EA 4YVFA 4CLXA 2NGRA 3KKKA 2EGHA 2WSYB 2FPRA 4K6OA 4X60A 4MVJP 1E3LA 1X1SA 1K5HA 1P80A 3BMQA 4F72A 2GHQA 5I6DA 4ZYUA 2VDWB 3TQTA 3ZTTA 4P3KA 3ND7A 3EW7A 4KLRA 1IBKB 3ZCUA 1C30A 1W0JD 2X8JB 3O1IC 5CNKA 5BRNA 5A9SB 5JRZA 3KPJA 4N7JA 3FOFC 4OYHA 3G85A 2XI4A 5AJZA 1KH1A 5IPFA 1XU9A 1Z9BA 1Q0TA 1B1CA 2EEZA 2KM1A 4LIPD 1BKDR 1JAYA 1L1FA 4FSDA 1J06A 5ELMA 5AVTA 2GVNA 1F9AA 2P2SA 4YAUA 2R79A 4H31A 1RYBA 4PWZA 5IUJC 3TB4A 5CFPA 1JWLA 3CURA 1SKBA 4LVCA 5B1IA 1PVVA 3F6CA 4FYIA 1WULS 4JQSA 1ZCJA 1LWNA 1P8JA 2O1XA 2VZ0A 3BGWA 3EEBA 3GAZA 1V43A 2IZ1A 3REGA 1ATZA 4OXRA 2AT1A 2EEPA 2X0JA 2FMFA 1TJNA 1UXHA 4E22A 1OFTA 3M1IA 3R6WA 4CLOA 4KTTE 4PHHA 3ROXA 1WMAA 3JY6A 1HLDA 3DNFA 2HZBA 3MJCA 1RFGE 4N4AA 3HCRA 4YV2A 3P26A 4F4FA 3ZD8A 3FZNA 3I2YX 5TMDA 1E62A 1DU4A 1ESNA 4FCCA 2EGUA 5EHGA 4UNRA 5C8YB 2VQSA 4P1ZA 4CKBA 2FX5A 3IS3A 1D4ZA 2V54A 4DV7B 1L7AA 4RZ2A 3KL2A 2FJUA 5TC4A 5FAKA 2QEQA 5I4IA 3NPMA 1SIWA 2AKYA 1AU9A 3LI2A 1X42A 3ZWMA 2OQIA 1Q2XA 4J0HA 3VVMA 5K99A 2IS6A 2X1LA 1THZA 3PC4A 5BN5B 4E15A 3AF4A 3L40A 3DXXA 2N47A 4JODA 1XMXA 2ZREA 1SOVA 2IIVA 3UCFA 1R27A 4C0WA 1PZMA 2RJNA 5FI0B 3C14C 2D5BA 4KQKA 1PGJA 1QX4A 1YS4A 4GNRA 3ESBA 4LXIA 3LXRA 4A5OA 2BZSA 3RBZA 1F4LA 1OLUB 4BDSA 1KXJA 5GZ1A 1L5NA 1QYCA 4FW9A 2PY6A 3A1TA 1RVDA 3LRXA 4RGQA 4F4DA 2J6BA 4MICA 1ZC4A 4Y0NA 4WDRA 3IUEA 1TEHA 4WNYA 3JYQA 5IT9A 4X97A 1DDOA 1V7CA 4JBYA 3RU2A 2C4KA 4IJVA 5KSPA 1FTQA 4XLZA 1MV5A 1NXW