3QKJA

The pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta in complex with a bis-tris molecule
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
137
structure length
130
Chain Sequence
SEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPEDQLKPMLEWAHGGFKPTGIEGLKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA cytosine-5 methyltransferase 3 beta isoform 6 variant
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 130
sequence length 137
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 3qkjA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qkjA01
5KE3A 3NTIA 3OMCA 2VYTA 4IURA 2P0KA 2MWOA 3C4SA 1OYXA 3SD4A 4NS5A 5IAYA 2F5KA 2BUDA 2YRVA 4IUUA 2LDMA 3OYMA 3OYJA 4FL6A 3MP6A 4C5IA 3S3NA 5FRMA 3MEAA 3PNWC 1WJQA 2GFUA 3E9GA 5KCHA 2X4XA 2RI2A 5IN1A 4QQDA 2MWPA 4E7HA 1N27A 3FEOA 2BKDN 4IUPA 3ASKA 3ZEHA 2RHXA 3OYLA 2R5AA 2WACA 2LRQA 4QVZA 2CKKA 2R5MA 5D6WA 3MEWA 1WJRA 3LGLA 5FRNA 4II1A 2B8AA 1G5VA 3QIIA 2LCCA 3OYKA 4C5HA 4QW2A 3UWNA 2RJDA 3OYHA 3MO8A 4A4GA 3OY9A 4OVAA 4BE2A 4A4EA 3FLGA 4PLLA 3OYCA 4FU6A 3MEUA 4Z02A 4A4FA 3OYGA 4E7IA 4RG2A 3S3OA 1H3ZA 3L2WA 1OZ2A 2RJCA 2DAQA 2D9TA 2EFIA 3F70A 4IUVA 2E6NA 2QQSA 1RI0A 3S3MA 1OI1A 4IKFA 2RHYA 3LX7A 3E9FA 2EQKA 2R57A 1KHCA 3LLRA 3MP1A 3QJ6A 2JZ2A 3LH0A 4N4GA 5C0MA 3OS0A 2K3YA 4ZTFA 2EQMA 3OYNA 5KCOA 4CRIA 2X35A 2EKOA 2L3RA 4BDYA 2X4WA 5D6YA 5KE2A 2DIGA 2O4XA 3OMGA 3QBYA 4E7JA 4E7LA 4L59A 3O8VA 2E5QA 4A4HA 3NTHA 5M9OA 2RJEA 3PMIA 2NLUA 3P8DA 4BE0A 4ZTJA 3L2QA 2RHIA 4Q5WA 5FROA 2EQUA 2GFAA 4N4IA 4E7KA 2M1HA 2X4YA 3S6WA 2RI3A 2GF7A 1WJSA 3L42A 4PL6A 3FC3A 3LYIA 4GY5A 3OYDA 1WGSA 2K3XA 5C6SA 5J26A 3OB9A 2L89A 3DB4A 5CIUA 4EDUA 2M0OA 4PLIA 4N4HA 1OZ3A 4B9XA 4QQGA 1XNIA 4LD6A 3PFSA 3GOXA 4UC4A 3OYBA 3EAEA 3H8ZA 3BDLA 3OS2A 3MEVA 4B9WA 3CEYA 5D6XA 3OS1A 4X34A 2PQWA 2R58A 3L2RA 2L8DA 3QKJA 2JTFA 3LGFA 4IUQA 3L2VA 4BACA 2HQXA 2LTOA 3DLMA 3Q1JA 3OYAA 3FDRA 2O4XB 3META 4HCZA 4C5GA 2XDPA 3OYFA 4IUTA 4BD3A 4C5EA 2RJFA 3P8HA 2HQEA 1SSFA 3PMTA 3OQ5A 1MHNA 3OYIA 3ME9A 2RHZA 3DB3A 3OYEA 2M16A 2IG0A 3UT1A 3MP8A 2QQRA 5J39A 2RI5A 2EQJA 2DIQA 3NTKA 2BIVA 2LVMA 4BDZA 2FHDA 2G3RA 3OA6A 4BE1A 5KH6A 2RO0A 2XK0A 3H6ZA 3M9QA 2RHUA 3L2UA 4QQ6A 3KUFA
chains in the Genus database with same CATH superfamily
1WXBA 4ZGDB 2D0QB 3OSSC 3SD4A 4M77D 2ATCB 2HBWA 1YCYA 1N8RC 2DL3A 4PJOG 2JTEA 4E7HA 1KD1R 2RHXA 2LJ1A 4J8OA 2BE9B 2DTHA 3TQ7P 5GAMh 2SEMA 2KBTA 4C8QA 1VQ5T 1KG1A 1TU0B 4Z02A 3A5ZB 1IZ6A 1H3ZA 2C06A 5J3BA 3H41A 2DD4A 2BZYA 4PJNA 2QQSA 3SDZA 1D0YA 3LX7A 3MP1A 2JZ2A 3A8LB 3LH0A 4RMOA 4C8QD 2P0QA 4M78G 3AHUA 1HK9A 2V8IA 1VQOQ 2F2VA 1YIJA 2RJEA 1Z9QA 1P92A 3PTAA 3MJXA 5LJ5e 3CD6T 1Q7YU 1VQ7T 3NFCA 4BI4A 1X69A 5GJVB 5A0LA 2ED0A 4OB1B 2W51A 5CQYA 1SG5A 2XIDA 4JRIA 1M30A 1BI3A 3OS2A 5GAOp 1YI2T 3H0FA 4M7DE 3CCMT 4J7IA 4OB0B 1NM7A 1H641 5KYXA 4IUQA 3CCLT 3G6EA 1VYUA 2BE7D 4V2SA 3OYAA 2O4XB 5IH2A 1S72A 1YNZA 4OMMA 1AWOA 1I8FA 2XI9A 4FSXA 1JXOA 3UT1A 2JVVA 1ZA1B 3CC4Q 3OA6A 2FZKB 1LNXA 2HKNA 4A4HA 2K79A 2GQIA 3E2UA 4DBHA 4M77C 1KC8R 2YUPA 2HDAA 1VQLQ 2XKOC 2BUDA 2NUPA 4FT2A 1QVFS 4M7AC 2H3EB 3S3NA 4HCCA 4M77F 2KSSA 4BB7A 1ZBXA 2QQBA 1U3OA 3EG2A 5GAN5 2ODGC 3G71Q 1QQJA 1I5LA 3MEWA 2JJ9A 1YBYA 1UDLA 2KR3A 3N5BB 1TUCA 3KFVA 2RK1A 2H3JA 3MEUA 3VS4A 3CCQQ 4JUVA 2LQNA 4QKUA 2M51A 1IGUA 1OU9A 2DTIA 2E12A 3VYHB 1OPKA 1M2VA 2KYMA 3NGPA 2EGEA 3BW1A 3UA6A 1WIEA 3OS0A 3VS2A 1XTDA 2K5FA 4CRIA 4C8QF 1PG5B 1FX7A 3BFMA 2NLUA 1AD5A 3QG1A 4BE0A 5GMKj 3L2QA 2OTJQ 1QP2A 1Q7YC 1T0JA 4E7KA 3OS5A 2CREA 2X4YA 3S6WA 1AZGB 3G4SA 1B7TA 2YDLA 3JCMV 1MNEA 1Y71A 3OW2P 4DEYA 2CGHA 1D09B 2KT1A 3X26B 1ZUUA 4BY6B 1YNSA 3FRNA 4LE9A 3RMSA 1E7DA 1WHLA 1LJOA 3FDRA 1GFDA 2KXDA 1NJIR 1WHJA 3ME9A 3DB3A 2KVDA 4E7ZA 3MP8A 5LL6S 2RI5A 3JCMb 1KC8U 4KGXB 1H92A 1HD3A 3H6ZA 1VQPT 3HP9A 4J7FA 4JRQA 1UGSB 4RCBA 2JXBA 3FJ5A 4XTVA 2F5KA 1NLPC 1K0XA 1IXDA 2KVQG 3V8JA 3EFRA 4F7UA 1B07A 5IN1A 5LJ3h 3CCRQ 3FEOA 8ATCB 3VUZA 3BE3A 1RAFB 2EKHA 1VQ6A 1VQMA 1YHQA 1GRIA 1N6AA 1EFNA 2HL5C 3EG3A 1ZS9A 1WI7A 1PM3A 3HFOA 4E7IA 7AT1B 3OYGA 4IIOA 2QQAA 2KAFA 2WSEE 4JJBA 2MPXC 2LNVA 2EFIA 1I0CA 3CCEQ 2F5TX 3CMAA 2GQVA 2CP7A 4MMKA 5GAOr 2R57A 4MZPA 1YJ9T 2F2WA 3QO3A 2KQWA 4AFSC 2QEXA 2AZVA 2RK2A 4RTWA 4E7JA 4L59A 2E5QA 3I55Q 1NG2A 5HK3A 4PKCC 4RTUA 2QK0A 3CC7T 1Y07A 2JOYA 4L6V5 5GAMg 3CCSQ 3CMEQ 3JCMc 5GANj 3SFMA 2A37A 2QA4T 1VIFA 4XAXB 2PZ1A 3H8ZA 3A8HB 1WHMA 3UDCA 1ZX6A 2LC4A 2Z0WA 2E10A 1UHFA 3X25B 2GTOA 3MPUB 4FSSA 1NYFA 2X3WD 1X6OA 3ZBDA 1UUEA 1FYNA 1BYMA 3VU3C 1VQ4Q 2NYSA 2VB6A 3R6NA 2ZCFB 2YLCA 2CP0A 2VV5A 1VQ8A 3JCMX 1YJNQ 2JNGA 4DOVA 4GLKA 2QGFB 3L1AA 1ZUKA 4IURA 1IGQA 1PSEA 2D0NA 4DQ2A 2ZPBB 3QWXX 2MI6A 1JQQA 3JCMP 4RUGA 3OW2A 2M0YA 2IPOB 2X4JA 2X4XA 2VWFA 4PJOD 5DLQE 3C12A 3ZEHA 2PU9B 1KHIA 2FPFA 1MV3A 4J6WA 2OTLQ 4II1A 2DZ9A 4VUBA 4QW2A 1WXTA 3UWNA 4Z88A 3VJPA 1BBZA 4M78A 2L3SA 3DLLA 4ZGEB 2DAQA 4M7DB 2MYSA 1YJWT 2HL3A 4HCKA 2FRYA 2ZGWA 3LLRA 4WF2A 4ZTFA 2DPPB 3OYNA 2DNUA 5KYUA 2YHTA 1VQ9T 1XQHA 2EKOA 5GAMf 2DIGA 4M78D 1D0ZA 2EYYA 2GBQA 2LMJA 1BK2A 3FIFA 4J9EA 1WHGA 4JJCA 2DEUA 1TUGB 3L0OA 4F04B 1M90U 2BZ8A 3OBWA 1RAEB 2EYZA 3EGDB 1C6VX 2K7AA 2K3XA 4OB2B 4PLIA 1XNIA 2E64A 4AG2C 1FXXA 3OYBA 2CZ7B 4C92E 4DBFA 3CXCS 3EAEA 3JB9I 3CQTA 4X34A 2RH2A 4PFPA 3LGFA 2COWA 3VUBA 1U06A 2CH4A 3Q1JA 4BI8B 2QYZA 5GMKh 2ZPHB 5L8RE 3P8HA 1X6GA 4GBQA 1RLQC 4M7DG 1JJ2S 2RNOA 2JMCA 2P0PA 1YCSB 3VYGA 4ELYC 4QVCA 1WQ7A 1ZSZA 1N5ZA 2RHUA 1F1BB 2HJQA 3SB2A 5FLXE 1M3AA 2RMOA 3NTIA 4HT9A 3A1PA 2XDDA 4ME7A 1OX9A 2CUBA 1BKBA 4IUUA 4O6JA 4M4ZA 4TVRA 1QKWA 4PJOC 4EMKB 5GANd 2GFUA 1SSHA 3I55A 1TSFA 1KJWA 1N27A 1ABOA 1QVGP 3CC2T 2K3BA 3GLXA 4PJOF 1YIJQ 1Q86R 1FWZA 1KQSS 3CCSA 3LGLA 3CMEA 1GBQA 3LH5A 3OYKA 3M0RA 1RACB 4A4EA 3OYCA 4FYXB 3L2WA 2EWNA 1G3TA 1N8RU 2YLBA 5I2MA 1UJ0A 3QJ6A 2DBKA 1NLOC 3G6EQ 4M78C 2KNBB 2HKQB 4BDYA 1SHGA 1T3LA 1O9SA 2ROLA 4HKEA 5CKDA 1S72Q 1WPYA 1VQ4A 3NHNA 2YSQA 5I2SA 4M78F 1KSWA 5LJ3g 5DM7R 2EYXA 2M1HA 3X24B 2LQ8A 1VQKA 2XDBA 2KFVA 2GF7A 5GAOl 1QLYA 1M4ZA 2ECZA 4GY5A 3OYDA 1VQNQ 2MCNA 5C6SA 2EW3A 1YITT 3WVEB 2LCLA 1WQWA 2XG8D 3V7SA 3NMZC 1JU5C 2VC8A 1GL5A 2ZPFB 1NEGA 4ZGJB 3JRZA 2NUTB 4HCZA 5DLOA 3OYFA 4IUTA 4XQ3A 3JB9D 5D7UA 1BIBA 5GANh 3A8MB 4F17A 2C0OA 4C8QE 1Q7YR 3KBGA 2JS0A 2KI7A 4M75E 2YRDA 2LJ0A 1YWOA 4DA4A 1JJRA 2JTMA 2BKDN 2MF2A 3VKIA 3AT1B 2WSCE 4DOWA 5D6WA 2X51A 3DKMA 4M7AA 1BI0A 2B86A 2QAZA 5IHKA 4J9BA 3G4SQ 3OY9A 3GF5A 2X9HA 4N0AC 4ESRA 2E70A 2DX1A 1OI1A 4M7AD 2RHYA 5GMKm 4A63B 1RABB 2KRSA 3PVLA 3H9NA 1W2BS 2DFUA 2A28A 4Y92A 4LDYA 2LQWA 5M9OA 4ORZA 2FPEA 4PNOA 3LWIA 3CCVA 1QVFP 1QVGA 3QWYA 5CCAA 1G2BA 3QJYA 1SRMA 2HSPA 2DM1A 1TH7A 5J26A 1X2KA 1BIAA 4MZTA 2CYZB 2OJ2A 1UHCA 2DERA 5GAOn 1R8OB 1UE9A 2R58A 3EG9A 4XU0A 1GL9B 2JM9A 2I2LA 1VQOT 1M1KC 3ZFJA 1VQ6Q 1VQMQ 1V29B 1YHQQ 2P84A 2DYBA 3JB9F 4Z89A 2BZXA 3H0IA 2G3RA 4A4KA 2CZ1B 2QTVA 4JS4A 2PVGB 1I1JA 2VGNA 3CMAQ 1OEBA 4MDWA 1W2BA 3SWNB 2YT6A 4C5IA 2VASA 4E47A 3EG0A 3QYHB 2QEXQ 1PD0A 2C0IA 3MHXA 4C0ZA 4JJNK 1CKBA 2O2OA 3CC4T 1VQNA 4HCBA 2JVWA 1Y57A 4LDUA 1G83A 2QTXA 4BE2A 2LJ3A 1V76A 4HVVA 5AYFA 4C92B 2KRMA 3VS0A 2DMOA 3G7ZA 2RJCA 2D9TA 4HT8A 2WSFE 4IUVA 1VQLT 1NBEB 3PVQA 4K11A 1MNDA 2DXTA 3LWHA 4M7AF 2MAMA 1C0MA 4HA8A 4MDXA 4XTYA 2L3RA 1B3QA 3G71T 3SHWA 1GCQC 2MMPA 1A8VA 3U23A 1E7OA 3PMIA 4F14A 1IHVA 4N4IA 1D0XA 1VQ8Q 4PL6A 5LJ3d 4DEXA 3CCQT 1GKUB 1KQ2A 3J81E 1H1JS 1K8AU 4QQGA 1B34A 1MMDA 1KQ1A 1G3YA 4AFQC 3I56A 4C0GA 2ROTA 3OSVA 2JTFA 4J9GA 2DL8A 3JAME 4FIBA 2LTOA 2OX7A 4F7UE 2LT1A 1MMNA 4B6MA 2A7YA 3EFOB 3CCJA 2E4HA 1WX6A 2OTJT 2CSQA 4C92G 1D1BA 3UA7A 1PRMC 4AG1C 1K9MU 2DJZA 2EQJA 2G6FX 3M4YA 4D8KA 1QVFA 1HYOA 2RO0A 1TXQA 1GFCA 2NWMA 4QQ6A 4JZ4A 5KE3A 3HRTA 1M9SA 2MWOA 1WZOA 3EGDA 3MKDA 2CZ0B 4KT0E 2KE9A 2D8JA 1MMGA 5L23A 4RTXA 4IUPA 2ZAEA 4PFZA 3EGXA 2E3IA 5IHNA 3GNGA 4Z8AA 5CKFA 5DY9A 2YXYA 5HK0A 3FLGA 5GANg 1VQ5A 3WXMB 1WHHA 4ZNXA 2J6OA 1UJYA 3EHRA 3BY7A 2D8HA 4IKFA 3JCMd 1VQPQ 1T3SA 3JB9J 3RBBB 3CCRT 2K3YA 1SF9A 1KD1C 1WA7A 2X4WA 4F16A 5KE2A 5GJWB 3QBYA 2QNFA 4EMKA 4KULA 2KYBA 3P8DA 4JLGA 4ZTJA 2EQUA 2GFAA 4C8QB 3TEEA 2EJ9A 4MMLA 4M75B 3LYIA 4X1VA 1K8AC 3CD6A 1VQ7A 2F69A 3TVTA 1NZ9A 1OZ3A 3CCET 1RI9A 4LD6A 1M8VA 1QW1A 2FZCB 1VYVA 4Y91A 4RG8A 4XTUA 1PC0A 1Y96B 1YI2A 2RQWA 3CCMA 3J7AF 3T9NA 2LX9A 1QCFA 4JPBW 3CCLA 3META 2Y4XA 1K9MC 1AWXA 1SSFA 4E2FB 1HSQA 3OYEA 4WTOB 5FU7B 4FYYB 4M7DC 1JEGA 1NE8A 2VGMA 2K9GA 5KH6A 1M90R 4E7SA 4PK4A 3VRZA 4M7DF 2EJFA 4ATOA 3CCUT 5IT9E 3RERA 2IVWA 2P0KA 2ED1A 1H3HA 3I9QA 3RKWA 1WXUA 2LDMA 5KYXB 1AOJA 3MP6A 3A8GB 1X27A 3MEAA 5IXBA 3VS5A 1NPPA 3VS6A 2RI2A 3JCMQ 2QA4Q 1MV0B 1AHJB 4LXCA 5KYYB 2CT4A 3UPUA 2MK5A 3HHTB 4QVDA 2WACA 4M75G 3JCMh 5GANf 3CXCP 1MMAA 1WLPB 4PJOA 1ZHIA 1G3SA 1OX8A 3CBOA 1VQKQ 2DK3A 1YJNT 4KH0B 4FYVB 4ELZC 1AEYA 4KUIA 2PNIA 1OZ2A 2NUPB 2EQKA 1JJ2P 2FG0A 2FPDA 3HSBA 1ABQA 2QNCA 1X01A 4QT7A 4J9DA 3P8BB 2JT4A 3CPFA 4LUDA 2OTLT 1M3CA 2FEIA 5A0DA 1QCNA 2DTOA 1AZEA 1OU8A 3HKSA 3L42A 5CKEA 3CPWS 4EMKC 1KQSP 3FJPA 1BB9A 3PFSA 3GOXA 1M2VB 4CC7A 2COZA 1TUDA 1JRIA 2L8DA 1SPKA 5CR2A 1N8RR 1YJWQ 2ESWA 1VA7A 1M1FA 3OBYA 2LQKA 2MPHA 1PCXA 2HZYA 2KDSA 1W6XA 5GAN4 2O01E 2ZPGB 2HBPA 4Y28E 1VQPA 2DKGA 2P4TA 1U1TA 1OYXA 2XICA 2YRVA 3OYJA 1A0NB 5FRMA 1YN8A 3EG1A 3PE0A 3QYGB 2KW9A 4XTWA 3QXEB 3EH1A 3JSCA 3EGUA 4AFZC 3CCVQ 1BI2A 2KY9A 1RL2A 1Q82C 5GANe 1WNLA 4OGCA 1M1KR 1UTIA 2A0FB 2M9UA 1TS9A 2K5LA 4A4GA 1UG1A 4LD9K 1EX4A 2CUDA 4R56A 4RG2A 2DF6A 3FB9A 4CI0C 2QG9B 1V1CA 2E6NA 3PIOA 2VXFA 1S1NA 3C95A 4F7UB 1XJWB 1A63A 2QDLA 2JW4A 4N0AA 2RA2A 2OAWA 1YJ9A 1VOMA 1PNJA 2XD0A 2EYQA 1YIJT 2EAYA 4AMCA 2O4XA 1RADB 2V1RA 2EGCA 4JLIA 1JXMA 3QUIA 3CXCA 1YFNA 1Z9ZA 5CIUA 1R0BG 2K57A 3A8OB 3VRYA 2QA4A 3M4GA 3CEYA 4C92A 3OS1A 3G6ET 2PQWA 1D1CA 3L2RA 2V1QA 1M2OA 5GAMe 1K73C 1NPRA 5A2QE 3NPFA 2HNIA 1JJ2A 2W10A 1S72T 2K2VA 1QMCA 4OB3B 2RJFA 2CP5A 4M77E 1MHNA 2RHZA 3BDUA 4FW2A 4FT4A 4C92D 1W2BP 4M7AE 3UF4A 4ZN1A 2O88A 2KVUA 2FZGB 5LJ5j 2HAXA 4J6YA 4PJJA 4F7UG 3M57A 1I81A 2AIRB 4JDSA 1U5SA 3HTRA 4XTXA 1KQSA 4J83A 3OYMA 3PIPA 3GP8A 2HQHA 1X75C 3M0PA 4KRTA 1M1KU 4PJLA 1RAAB 2BTTA 4C0DB 1J3TA 2CDTA 3CBMA 4CC3A 2O9SA 2JN0A 2B8AA 3QIIA 1YP5A 5HY6A 2RJDA 2DD5A 4PLLA 2KGTA 1X43A 2DILA 1ZLMA 4JJDA 1YJWA 3I56Q 4HXJA 1KIKA 2EQMA 4OMQA 3PGGA 1RUWA 2HSEB 2DYIA 5EC7A 1VQ9A 3CCJQ 2DXCA 3NTHA 4JRPA 3ZL7C 1BU1A 1QWEA 4ANJA 5IXFA 3G4ST 3SWNC 2E3HA 3JCMg 5CAIA 1GXIE 2O31A 1OOTA 1WGSA 1X6BA 3OB9A 3DB4A 1GCQA 2EJGA 2YUOA 5FWBA 5LJ3f 2MIOA 1V66A 2PTKA 3PT9A 4R0KA 3MEVA 2DLPA 3JV3A 2J6KA 4XTZA 5KYUB 2A8VA 4RTZA 4BACA 4CC2A 2DVJA 2EIFA 4J9IA 1MUZA 3UATA 2KXCA 3OYIA 4C92C 2A3LA 2YUQA 3D7SB 2IG0A 3QPHA 4D6WA 1G8XA 5GAN6 5KYWB 1WYXA 3KXTA 3NTKA 2ZZDA 4BE1A 4C92F 3LW5E 4J5YA 2K6DA 5ECAA 1VQ5Q 1H9EA 3M0UA 3OMCA 3RKYA 2LNHB 1RLPC 2EGAA 1K8AR 4M75A 2RF0A 2ZPEB 1WHKA 3URGA 1RAIB 5FU6B 2DBMA 3M0SA 2L0AA 3E9GA 5KCHA 2FVUA 2L5QA 1VQ6T 1VQMT 1YHQT 1TOVA 2R5AA 2J05A 1Y96A 2L2PA 4GLMA 1KK7A 3CC2A 2R5MA 4M75D 2F2XA 3J80E 5I21A 1G5VA 2C0TA 1K9MR 2O9VA 1M3BA 1ZSZB 3HRSA 4OVAA 3CD6Q 1VQ7Q 4FU6A 1O75A 2E65A 3CMAT 2JS2A 1Q81C 1RI0A 2JMAA 2J06A 2V8JA 1U1SA 1YI2Q 3CCMQ 5LJ5d 2QEXT 3CCLQ 3JCMf 1EN7A 2SRCA 1SEMA 2RQVA 1C1AA 2Y90A 3QHSA 3SEMA 1Q86C 3O8VA 1VUBA 1IO6A 3X28B 2GNCA 5EG2A 1T0HA 5FROA 4BY6C 4OF1A 5KYYA 6AT1B 2L3PA 3I5SA 3HPWA 1UEBA 1W4SA 1JEQA 2RPNA 2M02A 3IQLA 4YTLA 1YITA 5FW9A 4UC4A 2KMTA 3M53A 3RMQA 3O5ZA 5LJ3e 3BDLA 2DEQA 4XK8E 1I5OB 2DA9A 1K1ZA 4NL2A 4OMPA 4RTVA 1KD1U 3RESA 5CKHA 1TG0A 1K4US 4OMLA 1BI1A 2K2MA 3QZ9B 3RDVA 3M55A 3QZ5B 2PUOB 3M0TA 1GCPA 2RM4A 1M1GA 5HKCA 5J39A 1VQ8T 3EH2A 2FHDA 2D1XA 2XK0A 4CC4B 2RNNA 2LCSA 1UFFA 2AZSA 1H9FA 2EQIA 4M7DA 2RQTA 5IAYA 1NEBA 1TTHB 1NYGA 3REAB 5KYNA 3PNWC 2LZ6B 5CO7A 4C8QC 3QDRB 2E41A 3ASKA 4M75C 4LUEA 4DBRA 1Y0MA 2HCKA 2LRQA 3GPLA 2CKKA 4M7DD 5LJ5h 2LCCA 4C5HA 2DL7A 1KFZA 4M75F 2LP5A 3OYHA 1I4K1 4OMFB 2CH4W 4XU1A 1D3BB 1M5Q1 3EFSA 3HFNA 1GBRA 1SKUB 1K0SA 2V8KA 2CS7A 4R55A 4EMHA 1EZZB 1WDXA 3INZA 1WFWA 5C0MA 4N4GA 2CT3A 2ABLA 4IIMA 5FU7C 3HRUA 4M77B 5GAOq 2X35A 3L2ZA 3JCMJ 4PJMA 4E7LA 3OMGA 3JCMe 5GMKl 4M7AB 3JB9G 2E6ZA 4RCCA 5CQXA 4FCYA 2FRWA 1WJSA 1Q82R 4RKUE 2RQUA 3VS1A 3M5AA 1PD1A 2M0OA 3VS7A 1GJJA 5A0GA 4B9XA 2IIMA 1FMKA 1CKAA 2KT8A 4B9WA 2DK4A 5D6XA 3QKJA 4OP0A 2CP3A 1CSKA 1Q95G 2PUKB 2H8HA 2ENMA 2XDPA 2MOXA 2CP6A 2HQEA 1VQOA 3CBPA 2LD7A 2GGRA 3V8KA 1UGQB 3ULRB 4PJOE 3M54A 3JCMW 4KBMB 2LX7A 2DZCA 1AT1B 3M9QA 5CVIA 5GAN7 2VYTA 2KEAA 4M77G 2VVKA 1MGQA 2YWWA 4P5NA 1N9SA 3EG9B 2RB6A 4X9DA 2D6FA 4OGEA 4M7AG 3I55T 3RIRA 1UGVA 2DO3A 1YJ9Q 5GMKi 4QQDA 3CPWP 2J7IA 2MWPA 2J6FA 3C0CA 1M8MA 1K73R 3CCST 1EIFA 3CMET 1IREB 3OW2S 1OULA 2YRCA 3CC4A 3CC7Q 4M78E 1AWJA 4A4FA 2VXEA 2EBPA 1RAGB 3S3OA 4LDXA 3GBQA 4HVWA 2VKNA 1JB0E 4JS5A 2RNAA 2RQRA 1OV3A 2FO0A 2HD0A 2PVDB 1JO8A 5GMKe 3E9FA 1VQLA 1VIEA 4C8QG 4KGVB 8AT1B 3TSWA 3CCUQ 3OYYA 4J9CA 1TWBA 3GNFB 4J9HA 1H8KA 1X2QA 3VV0A 2V26A 1QVPA 2QASA 2QQ9A 1NJIU 5GAOm 1VQ4T 2NUTA 1Q82U 1M27C 3G71A 4HVUA 4WCIA 3EHQA 2HMAA 4Q5WA 1VQKT 1W1FA 4OMOA 5I22A 2AHJB 1KC8C 2DL5A 2L89A 3CCQA 4EDUA 2LC3A 4EMGA 4X9CA 4AT1B 1QWFA 1PWTA 4O5VA 1FMVA 4XU2A 3E1SA 2KVEA 5GAN3 1IRXA 4NOYA 5GAN8 2E1HA 4C5EA 1OQKA 3PMTA 4LN2A 1Y7XA 2OTJA 2QQRA 2I0NA 4C0FA 1E6HA 2BIVA 5GAMj 1LPLA 2QDYB 3WVDB 2JM8A 2VUBA 2W0ZA 2X3XD 1ZBJA 1B34B 1UECA 3E19A 1HXDA 4NS5A 2FB7A 2Y4YA 4F7UF 3JB9H 3M0QA 1K73U 2A08A 3I5RA 1WJQA 1PHTA 4EIKA 3TCJA 3TREA 3ER0A 1VQ9Q 2A36A 2DE0X 1Y02A 3I35A 1ARKA 1WJRA 5FRNA 1E6GA 2YUNA 3MO8A 4FYWB 3RKXA 2AK5A 2GTJA 2DJQA 5KYWA 5CKBA 2NUZA 4NL3A 3F70A 3GIBA 4UZWA 1XOVA 4A54A 1QKXA 4LDVA 1RAHB 1NJIC 4BITA 1ACMB 5KCOA 3H0HA 4XU3A 3HL8A 3CCRA 5HCKA 4A53A 1JEIA 3CCVT 1OPLA 3EGXB 4KH1B 3CPWA 2WQGA 1ZQ1A 2OAUA 3A98A 1LOJA 1R77A 2RI3A 4D8DA 3FC3A 1ZUYA 4DBQA 2GCXA 5LJ5g 1BCMA 4N4HA 4OMNA 1AWWA 2DETA 2ODCI 2AKLA 3CCEA 4C0DC 4J9FA 2P4RA 2L3QA 2K4YA 3SWNA 4JRKA 4RTYA 1PKTA 1Q81R 3M59A 3R6OA 2G80A 5GAN2 2RN8A 3L2VA 2KK4A 4C5GA 4BD3A 1K76A 2EYWA 3THKA 1AVZC 3CC2Q 1FMWA 3QSUA 1UGPB 3CC7A 2CZ6B 1W70A 2RD1A 2XU8A 2LVMA 2FL7A 4AFUC 1I07A 1G3WA 1QCOA 1SHFA 3CCUA 3C4SA 4J6XA 2LT4A 4FL6A 1PKSA 4EPCA 4ZN3A 2DL4A 2KRNA 3RNJA 2QI2A 2ZPIB 1YWPA 3OYLA 1N9RA 1PSFA 4RTTA 5IHIA 2EPDA 4QVZA 3X20B 1R0CB 1VQNT 4JZ3A 1QP3A 1D1AA 2CSIA 2CP2A 2PVOB 3REBB 2K5IA 1ZA2B 2AT1B 1M90C 1YJNA 1ZSGA 1IB8A 1K9AA 2HEQA 1YITQ 2COYA 4MZMA 2F1LA 1ZBHA 1A62A 3V7CA 3S3MA 1SRLA 3M56A 4E6RA 3M58A 5GAMd 2DXUA 1KHCA 2E5KA 3MCAB 3QDFA 4L5GA 2QGGA 5D6YA 1DJ7B 2QXFA 2DXBA 5LJ5f 1JBMA 3EFOA 2JUFA 4PJOB 4BI3A 1UGRB 2RHIA 2OTLA 3G1JA 4FW1A 4FM4B 1VYTA 4PFOA 2KROA 1LVKA 5FU6C 1Q81U 5I11A 5AT1B 1QVGS 3I56T 1D3BA 2XHCA 2EVRA 3TU4K 9ATCB 5CK9A 2FYKA 1LCKA 1HJDA 2HQXA 1PRLC 3DLMA 2OI3A 1E7LA 4KGZB 3V8LA 3CCJT 1Q86U 1ZSZC 2DRKA 3C94A 3TSZA 3OQ5A 4LDWA 1BCOA 2M16A 3V7RA 5LJ3j 1U8RA 4M77A 4M78B 5FWCA 4KUDK 3RUXA 2DIQA 2DRMA 4BDZA 1IHWA 4LNPA 2XMFA 2AKKA 4BUGA 3VS3A 2DVEA 1UB4A 3RR6A 3L2UA 3KUFA
chains in the Genus database with same CATH topology
3SB2A 5FLXE 3CCUT 5IT9E 3NTIA 3RERA 4HT9A 2IVWA 4ZGDB 2P0KA 2D0QB 3OSSC 2XDDA 3SD4A 4ME7A 4M7DA 5IAYA 4M77D 1BKBA 4IUUA 2LDMA 4O6JA 3RKWA 1YCYA 4TVRA 3MP6A 1N8RC 3A8GB 4PJOC 3MEAA 3PNWC 4EMKB 4PJOG 1NPPA 5GANd 5CO7A 2GFUA 2XDBA 2RI2A 3JCMQ 3I55A 4C8QC 1AHJB 4E7HA 1N27A 3QDRB 2E41A 3ASKA 2RHXA 4M75C 3UPUA 3HHTB 4QVDA 3CC2T 2WACA 3GLXA 4J8OA 4M75G 2DTHA 4PJOF 3JCMh 1FWZA 2LRQA 5GAMh 5GANf 3GPLA 1KQSS 2CKKA 4M7DD 3CCSA 3LGLA 3CMEA 5LJ5h 4PJOA 1ZHIA 1G3SA 3OYKA 2LCCA 4C5HA 3CBOA 2DK3A 4M75F 3OYHA 1I4K1 4C8QA 1YJNT 4OMFB 4XU1A 1VQ5T 1KG1A 4A4EA 1D3BB 3OYCA 4Z02A 1M5Q1 3EFSA 3A5ZB 4ELZC 1IZ6A 1H3ZA 3HFNA 3L2WA 2C06A 5J3BA 4KUIA 1OZ2A 2EWNA 2DD4A 2V8KA 2CS7A 4R55A 4EMHA 2QQSA 1G3TA 3SDZA 1N8RU 3LX7A 2YLBA 2EQKA 3INZA 5I2MA 3MP1A 3QJ6A 5C0MA 2JZ2A 3A8LB 3LH0A 4N4GA 4RMOA 4C8QD 4M78C 5FU7C 2P0QA 3HRUA 4M78G 4M77B 5GAOq 2X35A 3HSBA 4BDYA 3L2ZA 1O9SA 3JCMJ 4HKEA 5CKDA 3AHUA 1HK9A 2V8IA 1X01A 4E7LA 3OMGA 1WPYA 3JCMe 1VQ4A 3P8BB 3CPFA 5GMKl 2RJEA 4M7AB 5I2SA 4M78F 1P92A 1YIJA 2OTLT 3PTAA 5A0DA 3JB9G 5LJ5e 5LJ3g 2DTOA 2E6ZA 5DM7R 2M1HA 4RCCA 3HKSA 5CQXA 2LQ8A 3X24B 1Q7YU 1VQ7T 3NFCA 1VQKA 2GF7A 1WJSA 3L42A 4BI4A 5GAOl 4RKUE 1M4ZA 4GY5A 3OYDA 5A0LA 5C6SA 4OB1B 3M5AA 5CKEA 3CPWS 2M0OA 4EMKC 1YITT 3WVEB 5A0GA 4B9XA 2LCLA 5CQYA 3FJPA 1WQWA 3PFSA 3GOXA 2XG8D 2XIDA 4JRIA 3V7SA 1JRIA 1BI3A 2VC8A 3OS2A 5GAOp 1YI2T 2ZPFB 4B9WA 4M7DE 5D6XA 4J7IA 3CCMT 4OB0B 2L8DA 3QKJA 4OP0A 4ZGJB 1H641 5CR2A 4IUQA 3CCLT 3G6EA 2PUKB 4V2SA 3JRZA 3OYAA 1M1FA 2O4XB 4HCZA 5DLOA 2XDPA 3OBYA 3OYFA 2LQKA 1S72A 4IUTA 4XQ3A 3JB9D 2HQEA 1VQOA 1I8FA 2XI9A 3CBPA 4FSXA 1BIBA 3UT1A 2JVVA 3V8KA 5GANh 2KDSA 1UGQB 3A8MB 5GAN4 2O01E 2ZPGB 4PJOE 3OA6A 3M54A 3JCMW 2HBPA 4KBMB 2DZCA 4C8QE 1LNXA 3M9QA 3KUFA 4Y28E 4A4HA 3KBGA 1VQPA 4M75E 5CVIA 5GAN7 2DKGA 2P4TA 2VYTA 1U1TA 4M77C 4M77G 1MGQA 1OYXA 4P5NA 1N9SA 2XKOC 2BUDA 2XICA 2YRVA 2RB6A 4DA4A 4FT2A 3OYJA 4X9DA 1QVFS 2D6FA 3S3NA 4OGEA 4HCCA 3I55T 5FRMA 3RIRA 4M7AG 4M77F 2KSSA 3QYGB 4BB7A 2DO3A 1ZBXA 2QQBA 5GMKi 2JTMA 4QQDA 4XTWA 2MWPA 3QXEB 2BKDN 2MF2A 3JSCA 3VKIA 5GAN5 2WSCE 4DOWA 1EIFA 3CMET 3CCST 1BI2A 1I5LA 2KY9A 1RL2A 5D6WA 1Q82C 3MEWA 5GANe 3DKMA 4M7AA 1WNLA 1IREB 4OGCA 3OW2S 1BI0A 2M9UA 3CC4A 1YBYA 3N5BB 2K5LA 4A4GA 3OY9A 4M78E 4LD9K 3GF5A 2RK1A 2H3JA 4A4FA 2VXEA 3MEUA 4R56A 4N0AC 4JUVA 4RG2A 3S3OA 3FB9A 4CI0C 4LDXA 2E70A 1JB0E 4JS5A 2DTIA 2E12A 2E6NA 3VYHB 3PIOA 2HD0A 5GMKe 1OI1A 2PVDB 2RHYA 2VXFA 3E9FA 5GMKm 1VIEA 1VQLA 4M7AD 4C8QG 3BW1A 3C95A 4F7UB 3OS0A 1XTDA 3OYYA 1W2BS 4N0AA 2K5FA 3GNFB 2RA2A 4CRIA 1YJ9A 3VV0A 1NJIU 1QVPA 2QQ9A 5GAOm 1VQ4T 4C8QF 2XD0A 2EYQA 1YIJT 2EAYA 4LDYA 2O4XA 1FX7A 1Q82U 3BFMA 5M9OA 3G71A 3CCVA 4JLIA 4PNOA 3LWIA 2NLUA 3QG1A 4BE0A 5GMKj 3L2QA 1QP2A 1Q7YC 4Q5WA 1QVGA 1VQKT 3QUIA 4E7KA 3CXCA 3OS5A 2X4YA 3S6WA 5CCAA 2AHJB 3QJYA 3G4SA 1KC8C 1TH7A 5J26A 2L89A 3CCQA 5CIUA 4EDUA 1BIAA 4MZTA 2K57A 3JCMV 2CYZB 4EMGA 1Y71A 4X9CA 3A8OB 2CGHA 3X26B 5GAOn 2QA4A 1R8OB 3CEYA 3M4GA 4C92A 3OS1A 3G6ET 2PQWA 2R58A 4XU0A 4BY6B 3L2RA 4O5VA 3FRNA 3RMSA 5GAMe 1K73C 1NPRA 5A2QE 2HNIA 2I2LA 4XU2A 1JJ2A 1LJOA 1S72T 3E1SA 3FDRA 2K2VA 5GAN3 4NOYA 1VQOT 1M1KC 5GAN8 2E1HA 3ZFJA 4OB3B 4C5EA 2RJFA 3PMTA 1V29B 4M77E 1MHNA 3ME9A 2RHZA 3DB3A 1Y7XA 3JB9F 3MP8A 5LL6S 2OTJA 2QQRA 3BDUA 2RI5A 4C0FA 4FT4A 4C92D 3JCMb 1KC8U 4M7AE 2BIVA 4ZN1A 5GAMj 2G3RA 4A4KA 2QDYB 3H6ZA 2CZ1B 3WVDB 4JS4A 1VQPT 5LJ5j 3HP9A 2VUBA 4J6YA 4J7FA 4F7UG 4JRQA 2HAXA 2PVGB 1UGSB 1B34B 3M57A 4RCBA 1I81A 2VGNA 3E19A 1HXDA 4MDWA 4JDSA 1W2BA 3SWNB 4NS5A 4XTVA 2FB7A 2Y4YA 4F7UF 2F5KA 4XTXA 1KQSA 3JB9H 4J83A 1K73U 3OYMA 3PIPA 2KVQG 4C5IA 3GP8A 3V8JA 3EFRA 1WJQA 4E47A 1X75C 4F7UA 3TCJA 3TREA 1M1KU 5IN1A 3QYHB 5LJ3h 3FEOA 3ER0A 3VUZA 3MHXA 4C0DB 4C0ZA 1VQ6A 4JJNK 1VQMA 3CBMA 1YHQA 1N6AA 1WJRA 5FRNA 3CC4T 2JN0A 2B8AA 1VQNA 4HCBA 3QIIA 5HY6A 2RJDA 4LDUA 2DD5A 3MO8A 2QTXA 3RKXA 4BE2A 3HFOA 4PLLA 4E7IA 3OYGA 5AYFA 4C92B 2QQAA 2KAFA 2WSEE 3G7ZA 2RJCA 5CKBA 2D9TA 2LNVA 4NL3A 2EFIA 2WSFE 3F70A 4IUVA 1VQLT 4HT8A 2F5TX 3CMAA 3GIBA 1XOVA 2GQVA 1YJWA 4A54A 4MMKA 2DXTA 2R57A 5GAOr 4MZPA 3LWHA 4LDVA 1YJ9T 1NJIC 4M7AF 2MAMA 4MDXA 3QO3A 2EQMA 4HA8A 5KCOA 3PGGA 4XTYA 3HL8A 4XU3A 3CCRA 2KQWA 2L3RA 2QEXA 4A53A 3G71T 3CCVT 2RK2A 1VQ9A 2DXCA 4E7JA 4L59A 2MMPA 3CPWA 1ZQ1A 2E5QA 3NTHA 3PMIA 4JRPA 5HK3A 2OAUA 4PKCC 4N4IA 3G4ST 3CC7T 1Y07A 1LOJA 2JOYA 3SWNC 2RI3A 4L6V5 3JCMg 5GAMg 4PL6A 5LJ3d 5CAIA 1GXIE 3CCQT 3FC3A 3JCMc 1KQ2A 1WGSA 3J81E 3OB9A 2GCXA 3DB4A 5LJ5g 5GANj 2EJGA 1K8AU 4N4HA 4QQGA 3SFMA 5LJ3f 2QA4T 1B34A 3CCEA 1VIFA 4C0DC 1KQ1A 3PT9A 1G3YA 3H8ZA 4XAXB 3A8HB 3MEVA 3I56A 3SWNA 2K4YA 3UDCA 4JRKA 4C0GA 2LC4A 2E10A 3OSVA 2JTFA 4XTZA 3M59A 3R6OA 3L2VA 5GAN2 4BACA 3X25B 3JAME 4FIBA 2LTOA 4F7UE 2LT1A 2EIFA 2KK4A 4C5GA 4BD3A 2A7YA 3CCJA 1X6OA 3ZBDA 3OYIA 2OTJT 4C92C 2A3LA 3QSUA 2IG0A 1UGPB 3QPHA 4C92G 3CC7A 1K9MU 1BYMA 4D6WA 2CZ6B 2DJZA 5GAN6 3VU3C 2EQJA 2RD1A 2ZCFB 2XU8A 2LVMA 3NTKA 3KXTA 2YLCA 2ZZDA 3M4YA 1VQ8A 2VV5A 4BE1A 1QVFA 3JCMX 4C92F 2RO0A 3LW5E 4J5YA 2FL7A 1G3WA 3CD6T 2JNGA 4QQ6A 4DOVA 4GLKA 5KE3A 3L1AA 3OMCA 3HRTA 3RKYA 4IURA 1PSEA 1M9SA 2MWOA 4DQ2A 3CCUA 3C4SA 4J6XA 2ZPBB 2LT4A 4M75A 2ZPEB 3URGA 2MI6A 2CZ0B 5FU6B 3JCMP 4FL6A 3OW2A 4KT0E 4EPCA 4ZN3A 2X4JA 3E9GA 5KCHA 2FVUA 2X4XA 4PJOD 2L5QA 2QI2A 2ZPIB 1VQ6T 1VQMT 5DLQE 3C12A 4IUPA 3ZEHA 3OYLA 1YHQT 1N9RA 2R5AA 1PSFA 1Y96A 4QVZA 3X20B 2PU9B 3CC2A 1VQNT 2R5MA 1KHIA 1QP3A 4M75D 4J6WA 3J80E 4II1A 5I21A 1G5VA 3GNGA 2DZ9A 2PVOB 4VUBA 4QW2A 5CKFA 3UWNA 2K5IA 3HRSA 4OVAA 5DY9A 3VJPA 1M90C 5HK0A 3FLGA 4FU6A 1YJNA 1O75A 5GANg 1VQ5A 2E65A 4M78A 3WXMB 3DLLA 3CMAT 4ZGEB 2DAQA 4M7DB 4MZMA 1YJWT 1Q81C 3BY7A 1RI0A 3V7CA 2V8JA 2ZGWA 3S3MA 4IKFA 3M56A 3JCMd 3M58A 1U1SA 2DXUA 1KHCA 5GAMd 3LLRA 4WF2A 3JB9J 3MCAB 3CCRT 5LJ5d 4M7AC 2K3YA 2QEXT 2DPPB 3OYNA 4ZTFA 2YHTA 1VQ9T 1XQHA 2EKOA 4L5GA 3JCMf 2X4WA 1DJ7B 2QXFA 5D6YA 2DIGA 4M78D 5GAMf 5KE2A 3FIFA 2DXBA 3QBYA 2Y90A 3QHSA 1Q86C 5LJ5f 1JBMA 3O8VA 1VUBA 4EMKA 3X28B 2JUFA 4KULA 3P8DA 4JLGA 4ZTJA 4PJOB 4BI3A 1UGRB 2RHIA 5EG2A 2OTLA 5FROA 2EQUA 2GFAA 4BY6C 4FM4B 4C8QB 4OF1A 1M90U 3TEEA 2EJ9A 4MMLA 3OBWA 4M75B 3LYIA 3HPWA 1UEBA 5FU6C 1W4SA 1K8AC 2K3XA 1KD1C 1VQ7A 2F69A 3CD6A 4OB2B 1NZ9A 4PLIA 1Q81U 4YTLA 1OZ3A 1XNIA 2E64A 4LD6A 3CCET 1YITA 1M8VA 1QW1A 4UC4A 1FXXA 2KMTA 3M53A 2CZ7B 3RMQA 4C92E 3OYBA 3I56T 3CXCS 1QVGS 5LJ3e 1D3BA 2XHCA 3BDLA 3EAEA 2DEQA 4RG8A 4XTUA 4Y91A 3JB9I 3TU4K 4ATOA 4XK8E 4X34A 5CK9A 2FYKA 1Y96B 2RH2A 4NL2A 3LGFA 1YI2A 3VUBA 3CCMA 1KD1U 3RESA 3J7AF 3T9NA 2LX9A 2HQXA 5CKHA 3DLMA 3Q1JA 4BI8B 5GMKh 3CCLA 3V8LA 3META 2ZPHB 3CCJT 1BI1A 1Q86U 2Y4XA 5L8RE 3QZ9B 3M55A 3C94A 3QZ5B 1K9MC 3P8HA 1SSFA 3OQ5A 2PUOB 4LDWA 3OYEA 2M16A 3V7RA 2RM4A 5LJ3j 1M1GA 4M77A 4M78B 5FU7B 5J39A 5HKCA 1U8RA 4M7DC 1VQ8T 1NE8A 4KUDK 4M7DG 2VGMA 2DIQA 3RUXA 1JJ2S 4BDZA 2FHDA 2P0PA 3VYGA 4ELYC 2XK0A 5KH6A 4BUGA 4QVCA 1WQ7A 2DVEA 1UB4A 2RHUA 3L2UA 4M7DF 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KE3 A;  3NTI A;  3OMC A;  2VYT A;  4IUR A;  2P0K A;  2MWO A;  3C4S A;  1OYX A;  3SD4 A;  4NS5 A;  5IAY A;  2F5K A;  2BUD A;  2YRV A;  4IUU A;  2LDM A;  3OYM A;  3OYJ A;  4FL6 A;  3MP6 A;  4C5I A;  3S3N A;  5FRM A;  3MEA A;  3PNW C;  1WJQ A;  2GFU A;  3E9G A;  5KCH A;  2X4X A;  2RI2 A;  5IN1 A;  4QQD A;  2MWP A;  4E7H A;  1N27 A;  3FEO A;  2BKD N;  4IUP A;  3ASK A;  3ZEH A;  2RHX A;  3OYL A;  2R5A A;  2WAC A;  2LRQ A;  4QVZ A;  2CKK A;  2R5M A;  5D6W A;  3MEW A;  1WJR A;  3LGL A;  5FRN A;  4II1 A;  2B8A A;  1G5V A;  3QII A;  2LCC A;  3OYK A;  4C5H A;  4QW2 A;  3UWN A;  2RJD A;  3OYH A;  3MO8 A;  4A4G A;  3OY9 A;  4OVA A;  4BE2 A;  4A4E A;  3FLG A;  4PLL A;  3OYC A;  4FU6 A;  3MEU A;  4Z02 A;  4A4F A;  3OYG A;  4E7I A;  4RG2 A;  3S3O A;  1H3Z A;  3L2W A;  1OZ2 A;  2RJC A;  2DAQ A;  2D9T A;  2EFI A;  3F70 A;  4IUV A;  2E6N A;  2QQS A;  1RI0 A;  3S3M A;  1OI1 A;  4IKF A;  2RHY A;  3LX7 A;  3E9F A;  2EQK A;  2R57 A;  1KHC A;  3LLR A;  3MP1 A;  3QJ6 A;  2JZ2 A;  3LH0 A;  4N4G A;  5C0M A;  3OS0 A;  2K3Y A;  4ZTF A;  2EQM A;  3OYN A;  5KCO A;  4CRI A;  2X35 A;  2EKO A;  2L3R A;  4BDY A;  2X4W A;  5D6Y A;  5KE2 A;  2DIG A;  2O4X A;  3OMG A;  3QBY A;  4E7J A;  4E7L A;  4L59 A;  3O8V A;  2E5Q A;  4A4H A;  3NTH A;  5M9O A;  2RJE A;  3PMI A;  2NLU A;  3P8D A;  4BE0 A;  4ZTJ A;  3L2Q A;  2RHI A;  4Q5W A;  5FRO A;  2EQU A;  2GFA A;  4N4I A;  4E7K A;  2M1H A;  2X4Y A;  3S6W A;  2RI3 A;  2GF7 A;  1WJS A;  3L42 A;  4PL6 A;  3FC3 A;  3LYI A;  4GY5 A;  3OYD A;  1WGS A;  2K3X A;  5C6S A;  5J26 A;  3OB9 A;  2L89 A;  3DB4 A;  5CIU A;  4EDU A;  2M0O A;  4PLI A;  4N4H A;  1OZ3 A;  4B9X A;  4QQG A;  1XNI A;  4LD6 A;  3PFS A;  3GOX A;  4UC4 A;  3OYB A;  3EAE A;  3H8Z A;  3BDL A;  3OS2 A;  3MEV A;  4B9W A;  3CEY A;  5D6X A;  3OS1 A;  4X34 A;  2PQW A;  2R58 A;  3L2R A;  2L8D A;  3QKJ A;  2JTF A;  3LGF A;  4IUQ A;  3L2V A;  4BAC A;  2HQX A;  2LTO A;  3DLM A;  3Q1J A;  3OYA A;  3FDR A;  2O4X B;  3MET A;  4HCZ A;  4C5G A;  2XDP A;  3OYF A;  4IUT A;  4BD3 A;  4C5E A;  2RJF A;  3P8H A;  2HQE A;  1SSF A;  3PMT A;  3OQ5 A;  1MHN A;  3OYI A;  3ME9 A;  2RHZ A;  3DB3 A;  3OYE A;  2M16 A;  2IG0 A;  3UT1 A;  3MP8 A;  2QQR A;  5J39 A;  2RI5 A;  2EQJ A;  2DIQ A;  3NTK A;  2BIV A;  2LVM A;  4BDZ A;  2FHD A;  2G3R A;  3OA6 A;  4BE1 A;  5KH6 A;  2RO0 A;  2XK0 A;  3H6Z A;  3M9Q A;  2RHU A;  3L2U A;  4QQ6 A;  3KUF A; 
#chains in the Genus database with same CATH topology
 1WXB A;  4ZGD B;  2D0Q B;  3OSS C;  3SD4 A;  4M77 D;  2ATC B;  2HBW A;  1YCY A;  1N8R C;  2DL3 A;  4PJO G;  2JTE A;  4E7H A;  1KD1 R;  2RHX A;  2LJ1 A;  4J8O A;  2BE9 B;  2DTH A;  3TQ7 P;  5GAM h;  2SEM A;  2KBT A;  4C8Q A;  1VQ5 T;  1KG1 A;  1TU0 B;  4Z02 A;  3A5Z B;  1IZ6 A;  1H3Z A;  2C06 A;  5J3B A;  3H41 A;  2DD4 A;  2BZY A;  4PJN A;  2QQS A;  3SDZ A;  1D0Y A;  3LX7 A;  3MP1 A;  2JZ2 A;  3A8L B;  3LH0 A;  4RMO A;  4C8Q D;  2P0Q A;  4M78 G;  3AHU A;  1HK9 A;  2V8I A;  1VQO Q;  2F2V A;  1YIJ A;  2RJE A;  1Z9Q A;  1P92 A;  3PTA A;  3MJX A;  5LJ5 e;  3CD6 T;  1Q7Y U;  1VQ7 T;  3NFC A;  4BI4 A;  1X69 A;  5GJV B;  5A0L A;  2ED0 A;  4OB1 B;  2W51 A;  5CQY A;  1SG5 A;  2XID A;  4JRI A;  1M30 A;  1BI3 A;  3OS2 A;  5GAO p;  1YI2 T;  3H0F A;  4M7D E;  3CCM T;  4J7I A;  4OB0 B;  1NM7 A;  1H64 1;  5KYX A;  4IUQ A;  3CCL T;  3G6E A;  1VYU A;  2BE7 D;  4V2S A;  3OYA A;  2O4X B;  5IH2 A;  1S72 A;  1YNZ A;  4OMM A;  1AWO A;  1I8F A;  2XI9 A;  4FSX A;  1JXO A;  3UT1 A;  2JVV A;  1ZA1 B;  3CC4 Q;  3OA6 A;  2FZK B;  1LNX A;  2HKN A;  4A4H A;  2K79 A;  2GQI A;  3E2U A;  4DBH A;  4M77 C;  1KC8 R;  2YUP A;  2HDA A;  1VQL Q;  2XKO C;  2BUD A;  2NUP A;  4FT2 A;  1QVF S;  4M7A C;  2H3E B;  3S3N A;  4HCC A;  4M77 F;  2KSS A;  4BB7 A;  1ZBX A;  2QQB A;  1U3O A;  3EG2 A;  5GAN 5;  2ODG C;  3G71 Q;  1QQJ A;  1I5L A;  3MEW A;  2JJ9 A;  1YBY A;  1UDL A;  2KR3 A;  3N5B B;  1TUC A;  3KFV A;  2RK1 A;  2H3J A;  3MEU A;  3VS4 A;  3CCQ Q;  4JUV A;  2LQN A;  4QKU A;  2M51 A;  1IGU A;  1OU9 A;  2DTI A;  2E12 A;  3VYH B;  1OPK A;  1M2V A;  2KYM A;  3NGP A;  2EGE A;  3BW1 A;  3UA6 A;  1WIE A;  3OS0 A;  3VS2 A;  1XTD A;  2K5F A;  4CRI A;  4C8Q F;  1PG5 B;  1FX7 A;  3BFM A;  2NLU A;  1AD5 A;  3QG1 A;  4BE0 A;  5GMK j;  3L2Q A;  2OTJ Q;  1QP2 A;  1Q7Y C;  1T0J A;  4E7K A;  3OS5 A;  2CRE A;  2X4Y A;  3S6W A;  1AZG B;  3G4S A;  1B7T A;  2YDL A;  3JCM V;  1MNE A;  1Y71 A;  3OW2 P;  4DEY A;  2CGH A;  1D09 B;  2KT1 A;  3X26 B;  1ZUU A;  4BY6 B;  1YNS A;  3FRN A;  4LE9 A;  3RMS A;  1E7D A;  1WHL A;  1LJO A;  3FDR A;  1GFD A;  2KXD A;  1NJI R;  1WHJ A;  3ME9 A;  3DB3 A;  2KVD A;  4E7Z A;  3MP8 A;  5LL6 S;  2RI5 A;  3JCM b;  1KC8 U;  4KGX B;  1H92 A;  1HD3 A;  3H6Z A;  1VQP T;  3HP9 A;  4J7F A;  4JRQ A;  1UGS B;  4RCB A;  2JXB A;  3FJ5 A;  4XTV A;  2F5K A;  1NLP C;  1K0X A;  1IXD A;  2KVQ G;  3V8J A;  3EFR A;  4F7U A;  1B07 A;  5IN1 A;  5LJ3 h;  3CCR Q;  3FEO A;  8ATC B;  3VUZ A;  3BE3 A;  1RAF B;  2EKH A;  1VQ6 A;  1VQM A;  1YHQ A;  1GRI A;  1N6A A;  1EFN A;  2HL5 C;  3EG3 A;  1ZS9 A;  1WI7 A;  1PM3 A;  3HFO A;  4E7I A;  7AT1 B;  3OYG A;  4IIO A;  2QQA A;  2KAF A;  2WSE E;  4JJB A;  2MPX C;  2LNV A;  2EFI A;  1I0C A;  3CCE Q;  2F5T X;  3CMA A;  2GQV A;  2CP7 A;  4MMK A;  5GAO r;  2R57 A;  4MZP A;  1YJ9 T;  2F2W A;  3QO3 A;  2KQW A;  4AFS C;  2QEX A;  2AZV A;  2RK2 A;  4RTW A;  4E7J A;  4L59 A;  2E5Q A;  3I55 Q;  1NG2 A;  5HK3 A;  4PKC C;  4RTU A;  2QK0 A;  3CC7 T;  1Y07 A;  2JOY A;  4L6V 5;  5GAM g;  3CCS Q;  3CME Q;  3JCM c;  5GAN j;  3SFM A;  2A37 A;  2QA4 T;  1VIF A;  4XAX B;  2PZ1 A;  3H8Z A;  3A8H B;  1WHM A;  3UDC A;  1ZX6 A;  2LC4 A;  2Z0W A;  2E10 A;  1UHF A;  3X25 B;  2GTO A;  3MPU B;  4FSS A;  1NYF A;  2X3W D;  1X6O A;  3ZBD A;  1UUE A;  1FYN A;  1BYM A;  3VU3 C;  1VQ4 Q;  2NYS A;  2VB6 A;  3R6N A;  2ZCF B;  2YLC A;  2CP0 A;  2VV5 A;  1VQ8 A;  3JCM X;  1YJN Q;  2JNG A;  4DOV A;  4GLK A;  2QGF B;  3L1A A;  1ZUK A;  4IUR A;  1IGQ A;  1PSE A;  2D0N A;  4DQ2 A;  2ZPB B;  3QWX X;  2MI6 A;  1JQQ A;  3JCM P;  4RUG A;  3OW2 A;  2M0Y A;  2IPO B;  2X4J A;  2X4X A;  2VWF A;  4PJO D;  5DLQ E;  3C12 A;  3ZEH A;  2PU9 B;  1KHI A;  2FPF A;  1MV3 A;  4J6W A;  2OTL Q;  4II1 A;  2DZ9 A;  4VUB A;  4QW2 A;  1WXT A;  3UWN A;  4Z88 A;  3VJP A;  1BBZ A;  4M78 A;  2L3S A;  3DLL A;  4ZGE B;  2DAQ A;  4M7D B;  2MYS A;  1YJW T;  2HL3 A;  4HCK A;  2FRY A;  2ZGW A;  3LLR A;  4WF2 A;  4ZTF A;  2DPP B;  3OYN A;  2DNU A;  5KYU A;  2YHT A;  1VQ9 T;  1XQH A;  2EKO A;  5GAM f;  2DIG A;  4M78 D;  1D0Z A;  2EYY A;  2GBQ A;  2LMJ A;  1BK2 A;  3FIF A;  4J9E A;  1WHG A;  4JJC A;  2DEU A;  1TUG B;  3L0O A;  4F04 B;  1M90 U;  2BZ8 A;  3OBW A;  1RAE B;  2EYZ A;  3EGD B;  1C6V X;  2K7A A;  2K3X A;  4OB2 B;  4PLI A;  1XNI A;  2E64 A;  4AG2 C;  1FXX A;  3OYB A;  2CZ7 B;  4C92 E;  4DBF A;  3CXC S;  3EAE A;  3JB9 I;  3CQT A;  4X34 A;  2RH2 A;  4PFP A;  3LGF A;  2COW A;  3VUB A;  1U06 A;  2CH4 A;  3Q1J A;  4BI8 B;  2QYZ A;  5GMK h;  2ZPH B;  5L8R E;  3P8H A;  1X6G A;  4GBQ A;  1RLQ C;  4M7D G;  1JJ2 S;  2RNO A;  2JMC A;  2P0P A;  1YCS B;  3VYG A;  4ELY C;  4QVC A;  1WQ7 A;  1ZSZ A;  1N5Z A;  2RHU A;  1F1B B;  2HJQ A;  3SB2 A;  5FLX E;  1M3A A;  2RMO A;  3NTI A;  4HT9 A;  3A1P A;  2XDD A;  4ME7 A;  1OX9 A;  2CUB A;  1BKB A;  4IUU A;  4O6J A;  4M4Z A;  4TVR A;  1QKW A;  4PJO C;  4EMK B;  5GAN d;  2GFU A;  1SSH A;  3I55 A;  1TSF A;  1KJW A;  1N27 A;  1ABO A;  1QVG P;  3CC2 T;  2K3B A;  3GLX A;  4PJO F;  1YIJ Q;  1Q86 R;  1FWZ A;  1KQS S;  3CCS A;  3LGL A;  3CME A;  1GBQ A;  3LH5 A;  3OYK A;  3M0R A;  1RAC B;  4A4E A;  3OYC A;  4FYX B;  3L2W A;  2EWN A;  1G3T A;  1N8R U;  2YLB A;  5I2M A;  1UJ0 A;  3QJ6 A;  2DBK A;  1NLO C;  3G6E Q;  4M78 C;  2KNB B;  2HKQ B;  4BDY A;  1SHG A;  1T3L A;  1O9S A;  2ROL A;  4HKE A;  5CKD A;  1S72 Q;  1WPY A;  1VQ4 A;  3NHN A;  2YSQ A;  5I2S A;  4M78 F;  1KSW A;  5LJ3 g;  5DM7 R;  2EYX A;  2M1H A;  3X24 B;  2LQ8 A;  1VQK A;  2XDB A;  2KFV A;  2GF7 A;  5GAO l;  1QLY A;  1M4Z A;  2ECZ A;  4GY5 A;  3OYD A;  1VQN Q;  2MCN A;  5C6S A;  2EW3 A;  1YIT T;  3WVE B;  2LCL A;  1WQW A;  2XG8 D;  3V7S A;  3NMZ C;  1JU5 C;  2VC8 A;  1GL5 A;  2ZPF B;  1NEG A;  4ZGJ B;  3JRZ A;  2NUT B;  4HCZ A;  5DLO A;  3OYF A;  4IUT A;  4XQ3 A;  3JB9 D;  5D7U A;  1BIB A;  5GAN h;  3A8M B;  4F17 A;  2C0O A;  4C8Q E;  1Q7Y R;  3KBG A;  2JS0 A;  2KI7 A;  4M75 E;  2YRD A;  2LJ0 A;  1YWO A;  4DA4 A;  1JJR A;  2JTM A;  2BKD N;  2MF2 A;  3VKI A;  3AT1 B;  2WSC E;  4DOW A;  5D6W A;  2X51 A;  3DKM A;  4M7A A;  1BI0 A;  2B86 A;  2QAZ A;  5IHK A;  4J9B A;  3G4S Q;  3OY9 A;  3GF5 A;  2X9H A;  4N0A C;  4ESR A;  2E70 A;  2DX1 A;  1OI1 A;  4M7A D;  2RHY A;  5GMK m;  4A63 B;  1RAB B;  2KRS A;  3PVL A;  3H9N A;  1W2B S;  2DFU A;  2A28 A;  4Y92 A;  4LDY A;  2LQW A;  5M9O A;  4ORZ A;  2FPE A;  4PNO A;  3LWI A;  3CCV A;  1QVF P;  1QVG A;  3QWY A;  5CCA A;  1G2B A;  3QJY A;  1SRM A;  2HSP A;  2DM1 A;  1TH7 A;  5J26 A;  1X2K A;  1BIA A;  4MZT A;  2CYZ B;  2OJ2 A;  1UHC A;  2DER A;  5GAO n;  1R8O B;  1UE9 A;  2R58 A;  3EG9 A;  4XU0 A;  1GL9 B;  2JM9 A;  2I2L A;  1VQO T;  1M1K C;  3ZFJ A;  1VQ6 Q;  1VQM Q;  1V29 B;  1YHQ Q;  2P84 A;  2DYB A;  3JB9 F;  4Z89 A;  2BZX A;  3H0I A;  2G3R A;  4A4K A;  2CZ1 B;  2QTV A;  4JS4 A;  2PVG B;  1I1J A;  2VGN A;  3CMA Q;  1OEB A;  4MDW A;  1W2B A;  3SWN B;  2YT6 A;  4C5I A;  2VAS A;  4E47 A;  3EG0 A;  3QYH B;  2QEX Q;  1PD0 A;  2C0I A;  3MHX A;  4C0Z A;  4JJN K;  1CKB A;  2O2O A;  3CC4 T;  1VQN A;  4HCB A;  2JVW A;  1Y57 A;  4LDU A;  1G83 A;  2QTX A;  4BE2 A;  2LJ3 A;  1V76 A;  4HVV A;  5AYF A;  4C92 B;  2KRM A;  3VS0 A;  2DMO A;  3G7Z A;  2RJC A;  2D9T A;  4HT8 A;  2WSF E;  4IUV A;  1VQL T;  1NBE B;  3PVQ A;  4K11 A;  1MND A;  2DXT A;  3LWH A;  4M7A F;  2MAM A;  1C0M A;  4HA8 A;  4MDX A;  4XTY A;  2L3R A;  1B3Q A;  3G71 T;  3SHW A;  1GCQ C;  2MMP A;  1A8V A;  3U23 A;  1E7O A;  3PMI A;  4F14 A;  1IHV A;  4N4I A;  1D0X A;  1VQ8 Q;  4PL6 A;  5LJ3 d;  4DEX A;  3CCQ T;  1GKU B;  1KQ2 A;  3J81 E;  1H1J S;  1K8A U;  4QQG A;  1B34 A;  1MMD A;  1KQ1 A;  1G3Y A;  4AFQ C;  3I56 A;  4C0G A;  2ROT A;  3OSV A;  2JTF A;  4J9G A;  2DL8 A;  3JAM E;  4FIB A;  2LTO A;  2OX7 A;  4F7U E;  2LT1 A;  1MMN A;  4B6M A;  2A7Y A;  3EFO B;  3CCJ A;  2E4H A;  1WX6 A;  2OTJ T;  2CSQ A;  4C92 G;  1D1B A;  3UA7 A;  1PRM C;  4AG1 C;  1K9M U;  2DJZ A;  2EQJ A;  2G6F X;  3M4Y A;  4D8K A;  1QVF A;  1HYO A;  2RO0 A;  1TXQ A;  1GFC A;  2NWM A;  4QQ6 A;  4JZ4 A;  5KE3 A;  3HRT A;  1M9S A;  2MWO A;  1WZO A;  3EGD A;  3MKD A;  2CZ0 B;  4KT0 E;  2KE9 A;  2D8J A;  1MMG A;  5L23 A;  4RTX A;  4IUP A;  2ZAE A;  4PFZ A;  3EGX A;  2E3I A;  5IHN A;  3GNG A;  4Z8A A;  5CKF A;  5DY9 A;  2YXY A;  5HK0 A;  3FLG A;  5GAN g;  1VQ5 A;  3WXM B;  1WHH A;  4ZNX A;  2J6O A;  1UJY A;  3EHR A;  3BY7 A;  2D8H A;  4IKF A;  3JCM d;  1VQP Q;  1T3S A;  3JB9 J;  3RBB B;  3CCR T;  2K3Y A;  1SF9 A;  1KD1 C;  1WA7 A;  2X4W A;  4F16 A;  5KE2 A;  5GJW B;  3QBY A;  2QNF A;  4EMK A;  4KUL A;  2KYB A;  3P8D A;  4JLG A;  4ZTJ A;  2EQU A;  2GFA A;  4C8Q B;  3TEE A;  2EJ9 A;  4MML A;  4M75 B;  3LYI A;  4X1V A;  1K8A C;  3CD6 A;  1VQ7 A;  2F69 A;  3TVT A;  1NZ9 A;  1OZ3 A;  3CCE T;  1RI9 A;  4LD6 A;  1M8V A;  1QW1 A;  2FZC B;  1VYV A;  4Y91 A;  4RG8 A;  4XTU A;  1PC0 A;  1Y96 B;  1YI2 A;  2RQW A;  3CCM A;  3J7A F;  3T9N A;  2LX9 A;  1QCF A;  4JPB W;  3CCL A;  3MET A;  2Y4X A;  1K9M C;  1AWX A;  1SSF A;  4E2F B;  1HSQ A;  3OYE A;  4WTO B;  5FU7 B;  4FYY B;  4M7D C;  1JEG A;  1NE8 A;  2VGM A;  2K9G A;  5KH6 A;  1M90 R;  4E7S A;  4PK4 A;  3VRZ A;  4M7D F;  2EJF A;  4ATO A;  3CCU T;  5IT9 E;  3RER A;  2IVW A;  2P0K A;  2ED1 A;  1H3H A;  3I9Q A;  3RKW A;  1WXU A;  2LDM A;  5KYX B;  1AOJ A;  3MP6 A;  3A8G B;  1X27 A;  3MEA A;  5IXB A;  3VS5 A;  1NPP A;  3VS6 A;  2RI2 A;  3JCM Q;  2QA4 Q;  1MV0 B;  1AHJ B;  4LXC A;  5KYY B;  2CT4 A;  3UPU A;  2MK5 A;  3HHT B;  4QVD A;  2WAC A;  4M75 G;  3JCM h;  5GAN f;  3CXC P;  1MMA A;  1WLP B;  4PJO A;  1ZHI A;  1G3S A;  1OX8 A;  3CBO A;  1VQK Q;  2DK3 A;  1YJN T;  4KH0 B;  4FYV B;  4ELZ C;  1AEY A;  4KUI A;  2PNI A;  1OZ2 A;  2NUP B;  2EQK A;  1JJ2 P;  2FG0 A;  2FPD A;  3HSB A;  1ABQ A;  2QNC A;  1X01 A;  4QT7 A;  4J9D A;  3P8B B;  2JT4 A;  3CPF A;  4LUD A;  2OTL T;  1M3C A;  2FEI A;  5A0D A;  1QCN A;  2DTO A;  1AZE A;  1OU8 A;  3HKS A;  3L42 A;  5CKE A;  3CPW S;  4EMK C;  1KQS P;  3FJP A;  1BB9 A;  3PFS A;  3GOX A;  1M2V B;  4CC7 A;  2COZ A;  1TUD A;  1JRI A;  2L8D A;  1SPK A;  5CR2 A;  1N8R R;  1YJW Q;  2ESW A;  1VA7 A;  1M1F A;  3OBY A;  2LQK A;  2MPH A;  1PCX A;  2HZY A;  2KDS A;  1W6X A;  5GAN 4;  2O01 E;  2ZPG B;  2HBP A;  4Y28 E;  1VQP A;  2DKG A;  2P4T A;  1U1T A;  1OYX A;  2XIC A;  2YRV A;  3OYJ A;  1A0N B;  5FRM A;  1YN8 A;  3EG1 A;  3PE0 A;  3QYG B;  2KW9 A;  4XTW A;  3QXE B;  3EH1 A;  3JSC A;  3EGU A;  4AFZ C;  3CCV Q;  1BI2 A;  2KY9 A;  1RL2 A;  1Q82 C;  5GAN e;  1WNL A;  4OGC A;  1M1K R;  1UTI A;  2A0F B;  2M9U A;  1TS9 A;  2K5L A;  4A4G A;  1UG1 A;  4LD9 K;  1EX4 A;  2CUD A;  4R56 A;  4RG2 A;  2DF6 A;  3FB9 A;  4CI0 C;  2QG9 B;  1V1C A;  2E6N A;  3PIO A;  2VXF A;  1S1N A;  3C95 A;  4F7U B;  1XJW B;  1A63 A;  2QDL A;  2JW4 A;  4N0A A;  2RA2 A;  2OAW A;  1YJ9 A;  1VOM A;  1PNJ A;  2XD0 A;  2EYQ A;  1YIJ T;  2EAY A;  4AMC A;  2O4X A;  1RAD B;  2V1R A;  2EGC A;  4JLI A;  1JXM A;  3QUI A;  3CXC A;  1YFN A;  1Z9Z A;  5CIU A;  1R0B G;  2K57 A;  3A8O B;  3VRY A;  2QA4 A;  3M4G A;  3CEY A;  4C92 A;  3OS1 A;  3G6E T;  2PQW A;  1D1C A;  3L2R A;  2V1Q A;  1M2O A;  5GAM e;  1K73 C;  1NPR A;  5A2Q E;  3NPF A;  2HNI A;  1JJ2 A;  2W10 A;  1S72 T;  2K2V A;  1QMC A;  4OB3 B;  2RJF A;  2CP5 A;  4M77 E;  1MHN A;  2RHZ A;  3BDU A;  4FW2 A;  4FT4 A;  4C92 D;  1W2B P;  4M7A E;  3UF4 A;  4ZN1 A;  2O88 A;  2KVU A;  2FZG B;  5LJ5 j;  2HAX A;  4J6Y A;  4PJJ A;  4F7U G;  3M57 A;  1I81 A;  2AIR B;  4JDS A;  1U5S A;  3HTR A;  4XTX A;  1KQS A;  4J83 A;  3OYM A;  3PIP A;  3GP8 A;  2HQH A;  1X75 C;  3M0P A;  4KRT A;  1M1K U;  4PJL A;  1RAA B;  2BTT A;  4C0D B;  1J3T A;  2CDT A;  3CBM A;  4CC3 A;  2O9S A;  2JN0 A;  2B8A A;  3QII A;  1YP5 A;  5HY6 A;  2RJD A;  2DD5 A;  4PLL A;  2KGT A;  1X43 A;  2DIL A;  1ZLM A;  4JJD A;  1YJW A;  3I56 Q;  4HXJ A;  1KIK A;  2EQM A;  4OMQ A;  3PGG A;  1RUW A;  2HSE B;  2DYI A;  5EC7 A;  1VQ9 A;  3CCJ Q;  2DXC A;  3NTH A;  4JRP A;  3ZL7 C;  1BU1 A;  1QWE A;  4ANJ A;  5IXF A;  3G4S T;  3SWN C;  2E3H A;  3JCM g;  5CAI A;  1GXI E;  2O31 A;  1OOT A;  1WGS A;  1X6B A;  3OB9 A;  3DB4 A;  1GCQ A;  2EJG A;  2YUO A;  5FWB A;  5LJ3 f;  2MIO A;  1V66 A;  2PTK A;  3PT9 A;  4R0K A;  3MEV A;  2DLP A;  3JV3 A;  2J6K A;  4XTZ A;  5KYU B;  2A8V A;  4RTZ A;  4BAC A;  4CC2 A;  2DVJ A;  2EIF A;  4J9I A;  1MUZ A;  3UAT A;  2KXC A;  3OYI A;  4C92 C;  2A3L A;  2YUQ A;  3D7S B;  2IG0 A;  3QPH A;  4D6W A;  1G8X A;  5GAN 6;  5KYW B;  1WYX A;  3KXT A;  3NTK A;  2ZZD A;  4BE1 A;  4C92 F;  3LW5 E;  4J5Y A;  2K6D A;  5ECA A;  1VQ5 Q;  1H9E A;  3M0U A;  3OMC A;  3RKY A;  2LNH B;  1RLP C;  2EGA A;  1K8A R;  4M75 A;  2RF0 A;  2ZPE B;  1WHK A;  3URG A;  1RAI B;  5FU6 B;  2DBM A;  3M0S A;  2L0A A;  3E9G A;  5KCH A;  2FVU A;  2L5Q A;  1VQ6 T;  1VQM T;  1YHQ T;  1TOV A;  2R5A A;  2J05 A;  1Y96 A;  2L2P A;  4GLM A;  1KK7 A;  3CC2 A;  2R5M A;  4M75 D;  2F2X A;  3J80 E;  5I21 A;  1G5V A;  2C0T A;  1K9M R;  2O9V A;  1M3B A;  1ZSZ B;  3HRS A;  4OVA A;  3CD6 Q;  1VQ7 Q;  4FU6 A;  1O75 A;  2E65 A;  3CMA T;  2JS2 A;  1Q81 C;  1RI0 A;  2JMA A;  2J06 A;  2V8J A;  1U1S A;  1YI2 Q;  3CCM Q;  5LJ5 d;  2QEX T;  3CCL Q;  3JCM f;  1EN7 A;  2SRC A;  1SEM A;  2RQV A;  1C1A A;  2Y90 A;  3QHS A;  3SEM A;  1Q86 C;  3O8V A;  1VUB A;  1IO6 A;  3X28 B;  2GNC A;  5EG2 A;  1T0H A;  5FRO A;  4BY6 C;  4OF1 A;  5KYY A;  6AT1 B;  2L3P A;  3I5S A;  3HPW A;  1UEB A;  1W4S A;  1JEQ A;  2RPN A;  2M02 A;  3IQL A;  4YTL A;  1YIT A;  5FW9 A;  4UC4 A;  2KMT A;  3M53 A;  3RMQ A;  3O5Z A;  5LJ3 e;  3BDL A;  2DEQ A;  4XK8 E;  1I5O B;  2DA9 A;  1K1Z A;  4NL2 A;  4OMP A;  4RTV A;  1KD1 U;  3RES A;  5CKH A;  1TG0 A;  1K4U S;  4OML A;  1BI1 A;  2K2M A;  3QZ9 B;  3RDV A;  3M55 A;  3QZ5 B;  2PUO B;  3M0T A;  1GCP A;  2RM4 A;  1M1G A;  5HKC A;  5J39 A;  1VQ8 T;  3EH2 A;  2FHD A;  2D1X A;  2XK0 A;  4CC4 B;  2RNN A;  2LCS A;  1UFF A;  2AZS A;  1H9F A;  2EQI A;  4M7D A;  2RQT A;  5IAY A;  1NEB A;  1TTH B;  1NYG A;  3REA B;  5KYN A;  3PNW C;  2LZ6 B;  5CO7 A;  4C8Q C;  3QDR B;  2E41 A;  3ASK A;  4M75 C;  4LUE A;  4DBR A;  1Y0M A;  2HCK A;  2LRQ A;  3GPL A;  2CKK A;  4M7D D;  5LJ5 h;  2LCC A;  4C5H A;  2DL7 A;  1KFZ A;  4M75 F;  2LP5 A;  3OYH A;  1I4K 1;  4OMF B;  2CH4 W;  4XU1 A;  1D3B B;  1M5Q 1;  3EFS A;  3HFN A;  1GBR A;  1SKU B;  1K0S A;  2V8K A;  2CS7 A;  4R55 A;  4EMH A;  1EZZ B;  1WDX A;  3INZ A;  1WFW A;  5C0M A;  4N4G A;  2CT3 A;  2ABL A;  4IIM A;  5FU7 C;  3HRU A;  4M77 B;  5GAO q;  2X35 A;  3L2Z A;  3JCM J;  4PJM A;  4E7L A;  3OMG A;  3JCM e;  5GMK l;  4M7A B;  3JB9 G;  2E6Z A;  4RCC A;  5CQX A;  4FCY A;  2FRW A;  1WJS A;  1Q82 R;  4RKU E;  2RQU A;  3VS1 A;  3M5A A;  1PD1 A;  2M0O A;  3VS7 A;  1GJJ A;  5A0G A;  4B9X A;  2IIM A;  1FMK A;  1CKA A;  2KT8 A;  4B9W A;  2DK4 A;  5D6X A;  3QKJ A;  4OP0 A;  2CP3 A;  1CSK A;  1Q95 G;  2PUK B;  2H8H A;  2ENM A;  2XDP A;  2MOX A;  2CP6 A;  2HQE A;  1VQO A;  3CBP A;  2LD7 A;  2GGR A;  3V8K A;  1UGQ B;  3ULR B;  4PJO E;  3M54 A;  3JCM W;  4KBM B;  2LX7 A;  2DZC A;  1AT1 B;  3M9Q A;  5CVI A;  5GAN 7;  2VYT A;  2KEA A;  4M77 G;  2VVK A;  1MGQ A;  2YWW A;  4P5N A;  1N9S A;  3EG9 B;  2RB6 A;  4X9D A;  2D6F A;  4OGE A;  4M7A G;  3I55 T;  3RIR A;  1UGV A;  2DO3 A;  1YJ9 Q;  5GMK i;  4QQD A;  3CPW P;  2J7I A;  2MWP A;  2J6F A;  3C0C A;  1M8M A;  1K73 R;  3CCS T;  1EIF A;  3CME T;  1IRE B;  3OW2 S;  1OUL A;  2YRC A;  3CC4 A;  3CC7 Q;  4M78 E;  1AWJ A;  4A4F A;  2VXE A;  2EBP A;  1RAG B;  3S3O A;  4LDX A;  3GBQ A;  4HVW A;  2VKN A;  1JB0 E;  4JS5 A;  2RNA A;  2RQR A;  1OV3 A;  2FO0 A;  2HD0 A;  2PVD B;  1JO8 A;  5GMK e;  3E9F A;  1VQL A;  1VIE A;  4C8Q G;  4KGV B;  8AT1 B;  3TSW A;  3CCU Q;  3OYY A;  4J9C A;  1TWB A;  3GNF B;  4J9H A;  1H8K A;  1X2Q A;  3VV0 A;  2V26 A;  1QVP A;  2QAS A;  2QQ9 A;  1NJI U;  5GAO m;  1VQ4 T;  2NUT A;  1Q82 U;  1M27 C;  3G71 A;  4HVU A;  4WCI A;  3EHQ A;  2HMA A;  4Q5W A;  1VQK T;  1W1F A;  4OMO A;  5I22 A;  2AHJ B;  1KC8 C;  2DL5 A;  2L89 A;  3CCQ A;  4EDU A;  2LC3 A;  4EMG A;  4X9C A;  4AT1 B;  1QWF A;  1PWT A;  4O5V A;  1FMV A;  4XU2 A;  3E1S A;  2KVE A;  5GAN 3;  1IRX A;  4NOY A;  5GAN 8;  2E1H A;  4C5E A;  1OQK A;  3PMT A;  4LN2 A;  1Y7X A;  2OTJ A;  2QQR A;  2I0N A;  4C0F A;  1E6H A;  2BIV A;  5GAM j;  1LPL A;  2QDY B;  3WVD B;  2JM8 A;  2VUB A;  2W0Z A;  2X3X D;  1ZBJ A;  1B34 B;  1UEC A;  3E19 A;  1HXD A;  4NS5 A;  2FB7 A;  2Y4Y A;  4F7U F;  3JB9 H;  3M0Q A;  1K73 U;  2A08 A;  3I5R A;  1WJQ A;  1PHT A;  4EIK A;  3TCJ A;  3TRE A;  3ER0 A;  1VQ9 Q;  2A36 A;  2DE0 X;  1Y02 A;  3I35 A;  1ARK A;  1WJR A;  5FRN A;  1E6G A;  2YUN A;  3MO8 A;  4FYW B;  3RKX A;  2AK5 A;  2GTJ A;  2DJQ A;  5KYW A;  5CKB A;  2NUZ A;  4NL3 A;  3F70 A;  3GIB A;  4UZW A;  1XOV A;  4A54 A;  1QKX A;  4LDV A;  1RAH B;  1NJI C;  4BIT A;  1ACM B;  5KCO A;  3H0H A;  4XU3 A;  3HL8 A;  3CCR A;  5HCK A;  4A53 A;  1JEI A;  3CCV T;  1OPL A;  3EGX B;  4KH1 B;  3CPW A;  2WQG A;  1ZQ1 A;  2OAU A;  3A98 A;  1LOJ A;  1R77 A;  2RI3 A;  4D8D A;  3FC3 A;  1ZUY A;  4DBQ A;  2GCX A;  5LJ5 g;  1BCM A;  4N4H A;  4OMN A;  1AWW A;  2DET A;  2ODC I;  2AKL A;  3CCE A;  4C0D C;  4J9F A;  2P4R A;  2L3Q A;  2K4Y A;  3SWN A;  4JRK A;  4RTY A;  1PKT A;  1Q81 R;  3M59 A;  3R6O A;  2G80 A;  5GAN 2;  2RN8 A;  3L2V A;  2KK4 A;  4C5G A;  4BD3 A;  1K76 A;  2EYW A;  3THK A;  1AVZ C;  3CC2 Q;  1FMW A;  3QSU A;  1UGP B;  3CC7 A;  2CZ6 B;  1W70 A;  2RD1 A;  2XU8 A;  2LVM A;  2FL7 A;  4AFU C;  1I07 A;  1G3W A;  1QCO A;  1SHF A;  3CCU A;  3C4S A;  4J6X A;  2LT4 A;  4FL6 A;  1PKS A;  4EPC A;  4ZN3 A;  2DL4 A;  2KRN A;  3RNJ A;  2QI2 A;  2ZPI B;  1YWP A;  3OYL A;  1N9R A;  1PSF A;  4RTT A;  5IHI A;  2EPD A;  4QVZ A;  3X20 B;  1R0C B;  1VQN T;  4JZ3 A;  1QP3 A;  1D1A A;  2CSI A;  2CP2 A;  2PVO B;  3REB B;  2K5I A;  1ZA2 B;  2AT1 B;  1M90 C;  1YJN A;  1ZSG A;  1IB8 A;  1K9A A;  2HEQ A;  1YIT Q;  2COY A;  4MZM A;  2F1L A;  1ZBH A;  1A62 A;  3V7C A;  3S3M A;  1SRL A;  3M56 A;  4E6R A;  3M58 A;  5GAM d;  2DXU A;  1KHC A;  2E5K A;  3MCA B;  3QDF A;  4L5G A;  2QGG A;  5D6Y A;  1DJ7 B;  2QXF A;  2DXB A;  5LJ5 f;  1JBM A;  3EFO A;  2JUF A;  4PJO B;  4BI3 A;  1UGR B;  2RHI A;  2OTL A;  3G1J A;  4FW1 A;  4FM4 B;  1VYT A;  4PFO A;  2KRO A;  1LVK A;  5FU6 C;  1Q81 U;  5I11 A;  5AT1 B;  1QVG S;  3I56 T;  1D3B A;  2XHC A;  2EVR A;  3TU4 K;  9ATC B;  5CK9 A;  2FYK A;  1LCK A;  1HJD A;  2HQX A;  1PRL C;  3DLM A;  2OI3 A;  1E7L A;  4KGZ B;  3V8L A;  3CCJ T;  1Q86 U;  1ZSZ C;  2DRK A;  3C94 A;  3TSZ A;  3OQ5 A;  4LDW A;  1BCO A;  2M16 A;  3V7R A;  5LJ3 j;  1U8R A;  4M77 A;  4M78 B;  5FWC A;  4KUD K;  3RUX A;  2DIQ A;  2DRM A;  4BDZ A;  1IHW A;  4LNP A;  2XMF A;  2AKK A;  4BUG A;  3VS3 A;  2DVE A;  1UB4 A;  3RR6 A;  3L2U A;  3KUF A; 
#chains in the Genus database with same CATH homology
 3SB2 A;  5FLX E;  3CCU T;  5IT9 E;  3NTI A;  3RER A;  4HT9 A;  2IVW A;  4ZGD B;  2P0K A;  2D0Q B;  3OSS C;  2XDD A;  3SD4 A;  4ME7 A;  4M7D A;  5IAY A;  4M77 D;  1BKB A;  4IUU A;  2LDM A;  4O6J A;  3RKW A;  1YCY A;  4TVR A;  3MP6 A;  1N8R C;  3A8G B;  4PJO C;  3MEA A;  3PNW C;  4EMK B;  4PJO G;  1NPP A;  5GAN d;  5CO7 A;  2GFU A;  2XDB A;  2RI2 A;  3JCM Q;  3I55 A;  4C8Q C;  1AHJ B;  4E7H A;  1N27 A;  3QDR B;  2E41 A;  3ASK A;  2RHX A;  4M75 C;  3UPU A;  3HHT B;  4QVD A;  3CC2 T;  2WAC A;  3GLX A;  4J8O A;  4M75 G;  2DTH A;  4PJO F;  3JCM h;  1FWZ A;  2LRQ A;  5GAM h;  5GAN f;  3GPL A;  1KQS S;  2CKK A;  4M7D D;  3CCS A;  3LGL A;  3CME A;  5LJ5 h;  4PJO A;  1ZHI A;  1G3S A;  3OYK A;  2LCC A;  4C5H A;  3CBO A;  2DK3 A;  4M75 F;  3OYH A;  1I4K 1;  4C8Q A;  1YJN T;  4OMF B;  4XU1 A;  1VQ5 T;  1KG1 A;  4A4E A;  1D3B B;  3OYC A;  4Z02 A;  1M5Q 1;  3EFS A;  3A5Z B;  4ELZ C;  1IZ6 A;  1H3Z A;  3HFN A;  3L2W A;  2C06 A;  5J3B A;  4KUI A;  1OZ2 A;  2EWN A;  2DD4 A;  2V8K A;  2CS7 A;  4R55 A;  4EMH A;  2QQS A;  1G3T A;  3SDZ A;  1N8R U;  3LX7 A;  2YLB A;  2EQK A;  3INZ A;  5I2M A;  3MP1 A;  3QJ6 A;  5C0M A;  2JZ2 A;  3A8L B;  3LH0 A;  4N4G A;  4RMO A;  4C8Q D;  4M78 C;  5FU7 C;  2P0Q A;  3HRU A;  4M78 G;  4M77 B;  5GAO q;  2X35 A;  3HSB A;  4BDY A;  3L2Z A;  1O9S A;  3JCM J;  4HKE A;  5CKD A;  3AHU A;  1HK9 A;  2V8I A;  1X01 A;  4E7L A;  3OMG A;  1WPY A;  3JCM e;  1VQ4 A;  3P8B B;  3CPF A;  5GMK l;  2RJE A;  4M7A B;  5I2S A;  4M78 F;  1P92 A;  1YIJ A;  2OTL T;  3PTA A;  5A0D A;  3JB9 G;  5LJ5 e;  5LJ3 g;  2DTO A;  2E6Z A;  5DM7 R;  2M1H A;  4RCC A;  3HKS A;  5CQX A;  2LQ8 A;  3X24 B;  1Q7Y U;  1VQ7 T;  3NFC A;  1VQK A;  2GF7 A;  1WJS A;  3L42 A;  4BI4 A;  5GAO l;  4RKU E;  1M4Z A;  4GY5 A;  3OYD A;  5A0L A;  5C6S A;  4OB1 B;  3M5A A;  5CKE A;  3CPW S;  2M0O A;  4EMK C;  1YIT T;  3WVE B;  5A0G A;  4B9X A;  2LCL A;  5CQY A;  3FJP A;  1WQW A;  3PFS A;  3GOX A;  2XG8 D;  2XID A;  4JRI A;  3V7S A;  1JRI A;  1BI3 A;  2VC8 A;  3OS2 A;  5GAO p;  1YI2 T;  2ZPF B;  4B9W A;  4M7D E;  5D6X A;  4J7I A;  3CCM T;  4OB0 B;  2L8D A;  3QKJ A;  4OP0 A;  4ZGJ B;  1H64 1;  5CR2 A;  4IUQ A;  3CCL T;  3G6E A;  2PUK B;  4V2S A;  3JRZ A;  3OYA A;  1M1F A;  2O4X B;  4HCZ A;  5DLO A;  2XDP A;  3OBY A;  3OYF A;  2LQK A;  1S72 A;  4IUT A;  4XQ3 A;  3JB9 D;  2HQE A;  1VQO A;  1I8F A;  2XI9 A;  3CBP A;  4FSX A;  1BIB A;  3UT1 A;  2JVV A;  3V8K A;  5GAN h;  2KDS A;  1UGQ B;  3A8M B;  5GAN 4;  2O01 E;  2ZPG B;  4PJO E;  3OA6 A;  3M54 A;  3JCM W;  2HBP A;  4KBM B;  2DZC A;  4C8Q E;  1LNX A;  3M9Q A;  3KUF A;  4Y28 E;  4A4H A;  3KBG A;  1VQP A;  4M75 E;  5CVI A;  5GAN 7;  2DKG A;  2P4T A;  2VYT A;  1U1T A;  4M77 C;  4M77 G;  1MGQ A;  1OYX A;  4P5N A;  1N9S A;  2XKO C;  2BUD A;  2XIC A;  2YRV A;  2RB6 A;  4DA4 A;  4FT2 A;  3OYJ A;  4X9D A;  1QVF S;  2D6F A;  3S3N A;  4OGE A;  4HCC A;  3I55 T;  5FRM A;  3RIR A;  4M7A G;  4M77 F;  2KSS A;  3QYG B;  4BB7 A;  2DO3 A;  1ZBX A;  2QQB A;  5GMK i;  2JTM A;  4QQD A;  4XTW A;  2MWP A;  3QXE B;  2BKD N;  2MF2 A;  3JSC A;  3VKI A;  5GAN 5;  2WSC E;  4DOW A;  1EIF A;  3CME T;  3CCS T;  1BI2 A;  1I5L A;  2KY9 A;  1RL2 A;  5D6W A;  1Q82 C;  3MEW A;  5GAN e;  3DKM A;  4M7A A;  1WNL A;  1IRE B;  4OGC A;  3OW2 S;  1BI0 A;  2M9U A;  3CC4 A;  1YBY A;  3N5B B;  2K5L A;  4A4G A;  3OY9 A;  4M78 E;  4LD9 K;  3GF5 A;  2RK1 A;  2H3J A;  4A4F A;  2VXE A;  3MEU A;  4R56 A;  4N0A C;  4JUV A;  4RG2 A;  3S3O A;  3FB9 A;  4CI0 C;  4LDX A;  2E70 A;  1JB0 E;  4JS5 A;  2DTI A;  2E12 A;  2E6N A;  3VYH B;  3PIO A;  2HD0 A;  5GMK e;  1OI1 A;  2PVD B;  2RHY A;  2VXF A;  3E9F A;  5GMK m;  1VIE A;  1VQL A;  4M7A D;  4C8Q G;  3BW1 A;  3C95 A;  4F7U B;  3OS0 A;  1XTD A;  3OYY A;  1W2B S;  4N0A A;  2K5F A;  3GNF B;  2RA2 A;  4CRI A;  1YJ9 A;  3VV0 A;  1NJI U;  1QVP A;  2QQ9 A;  5GAO m;  1VQ4 T;  4C8Q F;  2XD0 A;  2EYQ A;  1YIJ T;  2EAY A;  4LDY A;  2O4X A;  1FX7 A;  1Q82 U;  3BFM A;  5M9O A;  3G71 A;  3CCV A;  4JLI A;  4PNO A;  3LWI A;  2NLU A;  3QG1 A;  4BE0 A;  5GMK j;  3L2Q A;  1QP2 A;  1Q7Y C;  4Q5W A;  1QVG A;  1VQK T;  3QUI A;  4E7K A;  3CXC A;  3OS5 A;  2X4Y A;  3S6W A;  5CCA A;  2AHJ B;  3QJY A;  3G4S A;  1KC8 C;  1TH7 A;  5J26 A;  2L89 A;  3CCQ A;  5CIU A;  4EDU A;  1BIA A;  4MZT A;  2K57 A;  3JCM V;  2CYZ B;  4EMG A;  1Y71 A;  4X9C A;  3A8O B;  2CGH A;  3X26 B;  5GAO n;  2QA4 A;  1R8O B;  3CEY A;  3M4G A;  4C92 A;  3OS1 A;  3G6E T;  2PQW A;  2R58 A;  4XU0 A;  4BY6 B;  3L2R A;  4O5V A;  3FRN A;  3RMS A;  5GAM e;  1K73 C;  1NPR A;  5A2Q E;  2HNI A;  2I2L A;  4XU2 A;  1JJ2 A;  1LJO A;  1S72 T;  3E1S A;  3FDR A;  2K2V A;  5GAN 3;  4NOY A;  1VQO T;  1M1K C;  5GAN 8;  2E1H A;  3ZFJ A;  4OB3 B;  4C5E A;  2RJF A;  3PMT A;  1V29 B;  4M77 E;  1MHN A;  3ME9 A;  2RHZ A;  3DB3 A;  1Y7X A;  3JB9 F;  3MP8 A;  5LL6 S;  2OTJ A;  2QQR A;  3BDU A;  2RI5 A;  4C0F A;  4FT4 A;  4C92 D;  3JCM b;  1KC8 U;  4M7A E;  2BIV A;  4ZN1 A;  5GAM j;  2G3R A;  4A4K A;  2QDY B;  3H6Z A;  2CZ1 B;  3WVD B;  4JS4 A;  1VQP T;  5LJ5 j;  3HP9 A;  2VUB A;  4J6Y A;  4J7F A;  4F7U G;  4JRQ A;  2HAX A;  2PVG B;  1UGS B;  1B34 B;  3M57 A;  4RCB A;  1I81 A;  2VGN A;  3E19 A;  1HXD A;  4MDW A;  4JDS A;  1W2B A;  3SWN B;  4NS5 A;  4XTV A;  2FB7 A;  2Y4Y A;  4F7U F;  2F5K A;  4XTX A;  1KQS A;  3JB9 H;  4J83 A;  1K73 U;  3OYM A;  3PIP A;  2KVQ G;  4C5I A;  3GP8 A;  3V8J A;  3EFR A;  1WJQ A;  4E47 A;  1X75 C;  4F7U A;  3TCJ A;  3TRE A;  1M1K U;  5IN1 A;  3QYH B;  5LJ3 h;  3FEO A;  3ER0 A;  3VUZ A;  3MHX A;  4C0D B;  4C0Z A;  1VQ6 A;  4JJN K;  1VQM A;  3CBM A;  1YHQ A;  1N6A A;  1WJR A;  5FRN A;  3CC4 T;  2JN0 A;  2B8A A;  1VQN A;  4HCB A;  3QII A;  5HY6 A;  2RJD A;  4LDU A;  2DD5 A;  3MO8 A;  2QTX A;  3RKX A;  4BE2 A;  3HFO A;  4PLL A;  4E7I A;  3OYG A;  5AYF A;  4C92 B;  2QQA A;  2KAF A;  2WSE E;  3G7Z A;  2RJC A;  5CKB A;  2D9T A;  2LNV A;  4NL3 A;  2EFI A;  2WSF E;  3F70 A;  4IUV A;  1VQL T;  4HT8 A;  2F5T X;  3CMA A;  3GIB A;  1XOV A;  2GQV A;  1YJW A;  4A54 A;  4MMK A;  2DXT A;  2R57 A;  5GAO r;  4MZP A;  3LWH A;  4LDV A;  1YJ9 T;  1NJI C;  4M7A F;  2MAM A;  4MDX A;  3QO3 A;  2EQM A;  4HA8 A;  5KCO A;  3PGG A;  4XTY A;  3HL8 A;  4XU3 A;  3CCR A;  2KQW A;  2L3R A;  2QEX A;  4A53 A;  3G71 T;  3CCV T;  2RK2 A;  1VQ9 A;  2DXC A;  4E7J A;  4L59 A;  2MMP A;  3CPW A;  1ZQ1 A;  2E5Q A;  3NTH A;  3PMI A;  4JRP A;  5HK3 A;  2OAU A;  4PKC C;  4N4I A;  3G4S T;  3CC7 T;  1Y07 A;  1LOJ A;  2JOY A;  3SWN C;  2RI3 A;  4L6V 5;  3JCM g;  5GAM g;  4PL6 A;  5LJ3 d;  5CAI A;  1GXI E;  3CCQ T;  3FC3 A;  3JCM c;  1KQ2 A;  1WGS A;  3J81 E;  3OB9 A;  2GCX A;  3DB4 A;  5LJ5 g;  5GAN j;  2EJG A;  1K8A U;  4N4H A;  4QQG A;  3SFM A;  5LJ3 f;  2QA4 T;  1B34 A;  3CCE A;  1VIF A;  4C0D C;  1KQ1 A;  3PT9 A;  1G3Y A;  3H8Z A;  4XAX B;  3A8H B;  3MEV A;  3I56 A;  3SWN A;  2K4Y A;  3UDC A;  4JRK A;  4C0G A;  2LC4 A;  2E10 A;  3OSV A;  2JTF A;  4XTZ A;  3M59 A;  3R6O A;  3L2V A;  5GAN 2;  4BAC A;  3X25 B;  3JAM E;  4FIB A;  2LTO A;  4F7U E;  2LT1 A;  2EIF A;  2KK4 A;  4C5G A;  4BD3 A;  2A7Y A;  3CCJ A;  1X6O A;  3ZBD A;  3OYI A;  2OTJ T;  4C92 C;  2A3L A;  3QSU A;  2IG0 A;  1UGP B;  3QPH A;  4C92 G;  3CC7 A;  1K9M U;  1BYM A;  4D6W A;  2CZ6 B;  2DJZ A;  5GAN 6;  3VU3 C;  2EQJ A;  2RD1 A;  2ZCF B;  2XU8 A;  2LVM A;  3NTK A;  3KXT A;  2YLC A;  2ZZD A;  3M4Y A;  1VQ8 A;  2VV5 A;  4BE1 A;  1QVF A;  3JCM X;  4C92 F;  2RO0 A;  3LW5 E;  4J5Y A;  2FL7 A;  1G3W A;  3CD6 T;  2JNG A;  4QQ6 A;  4DOV A;  4GLK A;  5KE3 A;  3L1A A;  3OMC A;  3HRT A;  3RKY A;  4IUR A;  1PSE A;  1M9S A;  2MWO A;  4DQ2 A;  3CCU A;  3C4S A;  4J6X A;  2ZPB B;  2LT4 A;  4M75 A;  2ZPE B;  3URG A;  2MI6 A;  2CZ0 B;  5FU6 B;  3JCM P;  4FL6 A;  3OW2 A;  4KT0 E;  4EPC A;  4ZN3 A;  2X4J A;  3E9G A;  5KCH A;  2FVU A;  2X4X A;  4PJO D;  2L5Q A;  2QI2 A;  2ZPI B;  1VQ6 T;  1VQM T;  5DLQ E;  3C12 A;  4IUP A;  3ZEH A;  3OYL A;  1YHQ T;  1N9R A;  2R5A A;  1PSF A;  1Y96 A;  4QVZ A;  3X20 B;  2PU9 B;  3CC2 A;  1VQN T;  2R5M A;  1KHI A;  1QP3 A;  4M75 D;  4J6W A;  3J80 E;  4II1 A;  5I21 A;  1G5V A;  3GNG A;  2DZ9 A;  2PVO B;  4VUB A;  4QW2 A;  5CKF A;  3UWN A;  2K5I A;  3HRS A;  4OVA A;  5DY9 A;  3VJP A;  1M90 C;  5HK0 A;  3FLG A;  4FU6 A;  1YJN A;  1O75 A;  5GAN g;  1VQ5 A;  2E65 A;  4M78 A;  3WXM B;  3DLL A;  3CMA T;  4ZGE B;  2DAQ A;  4M7D B;  4MZM A;  1YJW T;  1Q81 C;  3BY7 A;  1RI0 A;  3V7C A;  2V8J A;  2ZGW A;  3S3M A;  4IKF A;  3M56 A;  3JCM d;  3M58 A;  1U1S A;  2DXU A;  1KHC A;  5GAM d;  3LLR A;  4WF2 A;  3JB9 J;  3MCA B;  3CCR T;  5LJ5 d;  4M7A C;  2K3Y A;  2QEX T;  2DPP B;  3OYN A;  4ZTF A;  2YHT A;  1VQ9 T;  1XQH A;  2EKO A;  4L5G A;  3JCM f;  2X4W A;  1DJ7 B;  2QXF A;  5D6Y A;  2DIG A;  4M78 D;  5GAM f;  5KE2 A;  3FIF A;  2DXB A;  3QBY A;  2Y90 A;  3QHS A;  1Q86 C;  5LJ5 f;  1JBM A;  3O8V A;  1VUB A;  4EMK A;  3X28 B;  2JUF A;  4KUL A;  3P8D A;  4JLG A;  4ZTJ A;  4PJO B;  4BI3 A;  1UGR B;  2RHI A;  5EG2 A;  2OTL A;  5FRO A;  2EQU A;  2GFA A;  4BY6 C;  4FM4 B;  4C8Q B;  4OF1 A;  1M90 U;  3TEE A;  2EJ9 A;  4MML A;  3OBW A;  4M75 B;  3LYI A;  3HPW A;  1UEB A;  5FU6 C;  1W4S A;  1K8A C;  2K3X A;  1KD1 C;  1VQ7 A;  2F69 A;  3CD6 A;  4OB2 B;  1NZ9 A;  4PLI A;  1Q81 U;  4YTL A;  1OZ3 A;  1XNI A;  2E64 A;  4LD6 A;  3CCE T;  1YIT A;  1M8V A;  1QW1 A;  4UC4 A;  1FXX A;  2KMT A;  3M53 A;  2CZ7 B;  3RMQ A;  4C92 E;  3OYB A;  3I56 T;  3CXC S;  1QVG S;  5LJ3 e;  1D3B A;  2XHC A;  3BDL A;  3EAE A;  2DEQ A;  4RG8 A;  4XTU A;  4Y91 A;  3JB9 I;  3TU4 K;  4ATO A;  4XK8 E;  4X34 A;  5CK9 A;  2FYK A;  1Y96 B;  2RH2 A;  4NL2 A;  3LGF A;  1YI2 A;  3VUB A;  3CCM A;  1KD1 U;  3RES A;  3J7A F;  3T9N A;  2LX9 A;  2HQX A;  5CKH A;  3DLM A;  3Q1J A;  4BI8 B;  5GMK h;  3CCL A;  3V8L A;  3MET A;  2ZPH B;  3CCJ T;  1BI1 A;  1Q86 U;  2Y4X A;  5L8R E;  3QZ9 B;  3M55 A;  3C94 A;  3QZ5 B;  1K9M C;  3P8H A;  1SSF A;  3OQ5 A;  2PUO B;  4LDW A;  3OYE A;  2M16 A;  3V7R A;  2RM4 A;  5LJ3 j;  1M1G A;  4M77 A;  4M78 B;  5FU7 B;  5J39 A;  5HKC A;  1U8R A;  4M7D C;  1VQ8 T;  1NE8 A;  4KUD K;  4M7D G;  2VGM A;  2DIQ A;  3RUX A;  1JJ2 S;  4BDZ A;  2FHD A;  2P0P A;  3VYG A;  4ELY C;  2XK0 A;  5KH6 A;  4BUG A;  4QVC A;  1WQ7 A;  2DVE A;  1UB4 A;  2RHU A;  3L2U A;  4M7D F;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...