3QKJA

The pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta in complex with a bis-tris molecule
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
137
structure length
130
Chain Sequence
SEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPEDQLKPMLEWAHGGFKPTGIEGLKPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA cytosine-5 methyltransferase 3 beta isoform 6 variant
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 37
structure length 130
sequence length 137
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 3qkjA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qkjA01
5M9OA 4QQ6A 4QW2A 5FRMA 4NS5A 4X34A 5KH6A 3OA6A 3ZEHA 3FEOA 2RI2A 3L2VA 2DAQA 5D6XA 1SSFA 1OI1A 3QIIA 3LYIA 2EQKA 2X4XA 3FDRA 2HQXA 4IUQA 2CKKA 3L42A 4C5IA 2MWOA 4BE1A 2R58A 5D6WA 4C5HA 2RJFA 1WJSA 4N4HA 1WJRA 2O4XA 2R5AA 4IUTA 3UT1A 5KCHA 3OS2A 3L2QA 3PMTA 3E9FA 3OYBA 5C6SA 3P8HA 4IUUA 2B8AA 4RG2A 5J26A 3ME9A 2L3RA 2FHDA 2L89A 4C5EA 3L2WA 3BDLA 4ZTJA 2X4YA 3NTKA 3OYJA 4ZTFA 4C5GA 4IKFA 1RI0A 2BUDA 3CEYA 4L59A 4CRIA 3M9QA 4QVZA 5KE2A 3OYIA 3MEAA 2EQUA 2GFAA 4EDUA 3OMCA 3L2RA 4E7KA 3GOXA 4PLIA 2K3XA 1OZ3A 5FRNA 3Q1JA 3OMGA 3EAEA 1XNIA 4UC4A 2RI3A 2GF7A 4FU6A 2RJDA 2PQWA 1H3ZA 3FC3A 4B9XA 2RHZA 2L8DA 3E9GA 2RHIA 1OZ2A 3FLGA 2E5QA 3OYGA 3MP8A 5CIUA 2K3YA 3O8VA 3MEUA 3S3MA 2M0OA 2YRVA 2JZ2A 2IG0A 4OVAA 3OYCA 2RJCA 3MEWA 4BD3A 5KCOA 3OYHA 1G5VA 5C0MA 3OYNA 5IN1A 4A4EA 2EQMA 2RO0A 3LX7A 3PNWC 4LD6A 2F5KA 3NTHA 3OY9A 3P8DA 2LTOA 3OS1A 3DLMA 2JTFA 4N4IA 2XDPA 3OYKA 4IURA 1WJQA 3DB3A 4IUVA 3KUFA 2X35A 3UWNA 5KE3A 3OYFA 3OYEA 3OYAA 3OYLA 3LLRA 3OB9A 4IUPA 4Q5WA 2D9TA 2LDMA 3PMIA 2BKDN 4HCZA 2P0KA 4II1A 5IAYA 3LGLA 2HQEA 2QQSA 2RJEA 4E7IA 4A4GA 2LCCA 3S3NA 4A4FA 1OYXA 2LRQA 3MEVA 3NTIA 3L2UA 3OYDA 3C4SA 4N4GA 2LVMA 2XK0A 3DB4A 4GY5A 3QBYA 1N27A 3META 3S3OA 2NLUA 4BDZA 2MWPA 1KHCA 3MP1A 4E7HA 1MHNA 2RHUA 3QJ6A 2M16A 2RHXA 3LH0A 3F70A 2WACA 4A4HA 4E7LA 4PLLA 4BE0A 4E7JA 2EKOA 2EQJA 3OYMA 4BE2A 2BIVA 2RI5A 4BACA 3H6ZA 2RHYA 2E6NA 5D6YA 1WGSA 2VYTA 4BDYA 2DIQA 2QQRA 2M1HA 3PFSA 4FL6A 3QKJA 3LGFA 3MO8A 3OQ5A 5J39A 2EFIA 2R57A 2O4XB 4Z02A 3SD4A 3H8ZA 2R5MA 5FROA 4QQGA 4B9WA 2DIGA 2X4WA 2GFUA 2G3RA 3MP6A 4PL6A 3S6WA 3OS0A 3ASKA 4QQDA
chains in the Genus database with same CATH superfamily
3TCJA 2X3WD 1MMGA 1PKSA 1YIJQ 2OI3A 2QEXQ 2DBKA 1XOVA 3I5SA 1PSEA 3A8HB 4ELYC 3A5ZB 1JO8A 2LMJA 1AD5A 2QA4Q 2OTJT 3PT9A 2XDDA 5AYFA 3J81E 3M4GA 4UZWA 4ZTJA 3CCMT 4ZTFA 2JT4A 4AG2C 3V8KA 5CK9A 5KYWB 4FCYA 2QTXA 2YT6A 1VQKQ 3EAEA 4UC4A 1UB4A 2EJ9A 1UGRB 3E9GA 1VIFA 2YUPA 2J06A 4F17A 1ZUUA 2LNVA 3CCLA 2KAFA 4KULA 1VQ7A 4M75D 1VQNQ 1V76A 5HCKA 1Q7YC 5IHIA 2DA9A 3NTHA 1YI2Q 3J7AF 5L23A 1KC8U 4HCBA 3OS5A 5GAMe 2ZPHB 3OYEA 3ZL7C 2DXTA 1Y96A 3QZ5B 4KGVB 5FW9A 2GTOA 4ZN1A 4DOVA 5CKDA 2KXCA 1ZBHA 1RUWA 4GY5A 2CH4A 1M2OA 1OPLA 2E41A 3CC4A 4M75E 1RI9A 3JB9I 1BU1A 2XICA 4J6YA 2M02A 3LH0A 3REBB 3I55A 2YXYA 1VQLQ 1UTIA 1UJYA 3RERA 4C8QG 3QDFA 1CKBA 5LJ5e 4ATOA 5J3BA 2ZPEB 5GAN2 1WYXA 4QVDA 2LP5A 2DLPA 2QG9B 5KH6A 1GKUB 3FEOA 1BI3A 4QVCA 3J80E 2KGTA 1MMNA 2KR3A 5GAMg 1PC0A 4M7DD 2CUBA 1JQQA 2V26A 2AIRB 4OB1B 4OB3B 1SSHA 2YUQA 2FHDA 2XMFA 1KG1A 1M2VA 4IKFA 1UEBA 3H41A 2VKNA 2NYSA 1Y02A 1M1KU 2VXEA 3Q1JA 2FRYA 5GAMj 2QQ9A 1B34A 3VU3C 1K73U 4M7DE 5LJ5g 1YHQT 2BZXA 3OYCA 4C8QB 2KBTA 3OYHA 3GIBA 4PKCC 1G5VA 2LCLA 5LJ3g 3CCQT 4JJDA 3BFMA 1KQSS 4J9HA 3HRUA 2CT4A 2DETA 3GP8A 1YWPA 4RCBA 1VQ9Q 3G6EQ 2Y90A 3BY7A 1IHVA 3A98A 3M0QA 5LJ5j 1TG0A 2F5TX 1YJNA 2JVWA 3VS3A 5LJ3j 2AZSA 1AHJB 2W51A 2YRDA 1X43A 3QJ6A 3QWYA 4FYWB 1GCQC 4XU3A 4RTUA 4HCKA 2ROTA 1Q7YR 1I5OB 4XTVA 4XU1A 4JZ3A 3TEEA 3ULRB 2DZCA 1WGSA 5D6YA 3CMEQ 2VYTA 1BCMA 4ME7A 3QYGB 1RLQC 1WDXA 1I0CA 4J7IA 3MP6A 2DJZA 2MYSA 3QHSA 2IPOB 5KYUA 1J3TA 3JRZA 2K9GA 3WVDB 1WZOA 4JUVA 2DAQA 4XQ3A 1AZEA 1Q81U 1BIAA 3NHNA 1OQKA 1K9AA 4JRQA 2OJ2A 3C12A 5GMKh 5FWCA 4ZGEB 3M59A 3EG9B 4RCCA 2I2LA 1Q95G 1YITA 1GCQA 2JN0A 1OEBA 2FG0A 2GNCA 4JJBA 1PWTA 3FB9A 4PJOD 3HP9A 3I35A 2E5QA 3HTRA 5GAN4 2RJCA 2K2MA 2GBQA 2EAYA 4M78A 1QP2A 1GL5A 1FYNA 3VS5A 4YTLA 2KRNA 1VQ7Q 1VOMA 5HKCA 1AWXA 3CPWS 2OTJQ 3GNGA 3LLRA 3CD6A 1WFWA 4PJOE 4E7IA 5HK0A 1Y7XA 3EHQA 1OYXA 4E7SA 2JS2A 4AFZC 3DLLA 1O75A 1LOJA 2QQAA 3HRSA 1VQOQ 1MHNA 2VV5A 3ER0A 3VJPA 4JS4A 2KQWA 4BE0A 2EQJA 4BI8B 3CPFA 1OOTA 1VQ5T 3G71T 3CBPA 4BDYA 2JOYA 1QLYA 5D7UA 2HMAA 2CZ1B 2JMAA 2R57A 3SD4A 5FROA 2HEQA 2X4WA 4QQDA 3M0RA 2CH4W 3JSCA 1W2BP 5GANf 1TUGB 2M0YA 3TREA 2JM8A 4J7FA 1VQ6T 1RAAB 5A2QE 2RK2A 2JXBA 3VRZA 1YJ9T 2ED1A 1VQPQ 2LD7A 1LPLA 3CCVT 3HL8A 4HVVA 2RMOA 2O01E 4NL3A 2X4YA 2FO0A 3EHRA 4PFOA 1XTDA 2A28A 4JRIA 2XI9A 2XIDA 5I11A 2CP7A 1OU8A 4D8DA 2QA4A 2NUTB 3QZ9B 4EDUA 4ZGDB 3TVTA 1E6HA 2XDBA 4OGEA 1ABQA 2CS7A 4M4ZA 1GL9B 1YJWT 1I8FA 1G3YA 1Q82R 2DXBA 2YSQA 2EW3A 2RQVA 1ZSGA 4M7AC 3PE0A 1HJDA 5GJVB 1BK2A 4C92C 3OYNA 4EMHA 1S72T 1W70A 1WXUA 4LD9K 2HL5C 1D1CA 1EIFA 4F7UG 2YLCA 2DVJA 3WVEB 1W1FA 5KE3A 4N0AC 2EQIA 1RAEB 2D9TA 2P0KA 3VS1A 2IIMA 2DL5A 4XU0A 1AWJA 4J9GA 2KNBB 4A4GA 2DKGA 1YI2A 5FU6C 1KD1U 3META 3MP1A 1FMKA 2ATCB 1VQ8T 2HL3A 2PUOB 4BE2A 1B7TA 2RHYA 1RACB 2FRWA 3EGDA 4J6XA 1BI1A 1K4US 4M7AA 2R5MA 3M0UA 1QW1A 4QQGA 4E6RA 4C92A 3CCQQ 1TXQA 2OTLQ 3OS0A 2KRSA 3ASKA 5HK3A 4M78B 5HY6A 2PVGB 3OA6A 1K8AR 1QVGP 4FT4A 1NJIR 2CT3A 4N0AA 2D8JA 1UE9A 2A7YA 2EQKA 2DL4A 2MAMA 5GAMh 4F7UB 2EGAA 1K76A 2VC8A 3FJPA 2OAUA 3IQLA 3UT1A 5DLQE 1VQMA 2K7AA 4XTXA 9ATCB 3HPWA 1TH7A 2J7IA 5IT9E 1Y0MA 1X6GA 3OYIA 1BKBA 2YUNA 2RI3A 1NZ9A 1N8RU 3RR6A 2F2WA 2DNUA 2KXDA 3MEUA 3S3MA 2CSQA 1K9MU 1TWBA 3M56A 3BW1A 2Y4XA 3FJ5A 3CBOA 3EG2A 3NPFA 1KIKA 1DJ7B 1MNDA 3DKMA 5C0MA 5GAOn 1IRXA 1H641 1FXXA 2F2XA 1W2BA 2AK5A 1D1AA 1IXDA 1X2KA 3V7CA 4A4KA 3M58A 2HDAA 3A8MB 3HFOA 4J9IA 1NYFA 2H3EB 2DXCA 2DF6A 1G83A 5GMKj 2J6OA 5LL6S 3RKYA 3CC2Q 2CP3A 2EYWA 1SRMA 1XQHA 3CQTA 2KDSA 2CYZB 3DB4A 2E10A 2DD5A 4E7HA 1D3BA 3G6EA 3M5AA 4PLLA 3CCJT 1OU9A 2DMOA 1NG2A 2BIVA 4CC2A 4KGZB 2HJQA 1KHIA 2E4HA 2X9HA 3EFRA 2HNIA 2EYQA 1M3AA 4C8QD 2NUPB 1Y57A 4XU2A 1UJ0A 3V7RA 1U1TA 2DTHA 4QQ6A 3EH2A 3CMEA 1VIEA 3D7SB 2HQXA 3INZA 4MZTA 3RMSA 1SG5A 1TOVA 2R58A 5EG2A 4FYXB 2LQ8A 3GBQA 2A8VA 1XJWB 4IIMA 2EJGA 2LNHB 1JXOA 5FWBA 4MZPA 1ZA2B 4M77G 4C8QE 4C5GA 2KVDA 5GJWB 2ESWA 3M9QA 3JCMh 3OMCA 2QK0A 2GQVA 3UA7A 5A0DA 2VGNA 4J83A 3OW2P 2K3YA 4LXCA 4EMGA 3CMAQ 3I56Q 1Q86U 1K0SA 3JCMc 4AFQC 3CCRA 5A0GA 1ZUKA 2F5KA 3QYHB 3CCLT 1QVGA 3H0FA 2KY9A 3WXMB 2LTOA 4DEYA 1B3QA 1QVPA 1GBRA 4XK8E 1I1JA 1M30A 1VYVA 3OBYA 2DERA 1ACMB 4M75C 4HCCA 3CCSQ 2L2PA 3VS4A 4JRPA 1U5SA 2XK0A 5CKFA 3EFOA 3JCMd 2OTJA 4M77B 3TQ7P 2KMTA 2V1QA 3VYHB 1WHLA 4M77F 4WTOB 3MJXA 1YJWQ 1EZZB 3CCMA 1BB9A 1V29B 3VRYA 4K11A 1K73R 3PFSA 4IIOA 1VQOA 3MO8A 3I55T 5J39A 2QDLA 1GRIA 2EFIA 2A0FB 4MDWA 2LX9A 2YLBA 1X2QA 1S72Q 2DIGA 2K5LA 1R8OB 1S1NA 1SPKA 4VUBA 5FLXE 4LN2A 5FU7C 5GAOq 1QVFP 2GTJA 1ZA1B 3G4ST 3EGXA 1HSQA 3ZEHA 4NOYA 3L2VA 1FMWA 1M3CA 3V7SA 2X51A 2DJQA 3JCMQ 4PJNA 1AVZC 4Z89A 3EGUA 5KYYA 4FSSA 2K4YA 2C0OA 2O4XA 2LT4A 4M75A 1GCPA 3E1SA 4LUDA 2DX1A 3EG0A 1YCSB 4RTTA 3OW2S 1M90C 3CEYA 2BE9B 4L59A 1VQ8Q 4JLGA 3ZBDA 1VQMQ 3PVLA 1VQPA 4CC4B 1I81A 1XNIA 4M7DC 2GF7A 4RG8A 2RHZA 2DYIA 2AHJB 1E7DA 3RKXA 1VQ4Q 4JJNK 2A36A 3MKDA 2JZ2A 1SRLA 1A8VA 3M4YA 2JM9A 1ZSZB 2VGMA 3PNWC 3UA6A 5GAOm 1NEGA 1X69A 4ANJA 3UWNA 3OYFA 1PRMC 4Y28E 3UATA 2DTIA 2QXFA 3L0OA 2HSPA 4HA8A 4ZN3A 3QPHA 4N4GA 3UF4A 4C8QF 5CAIA 4JRKA 4GLKA 4A4HA 2VVKA 1YJNT 4M7DA 1A62A 4RTWA 1PM3A 3OW2A 3H6ZA 1T3LA 4DBQA 3VUZA 5LJ5f 3T9NA 4PFZA 3LGFA 2AT1B 3OQ5A 1H8KA 1R0BG 2AKLA 3A8GB 5LJ3f 5ECAA 4OMNA 2ODCI 3E19A 4R56A 2E65A 1TUDA 1VYUA 8ATCB 4L5GA 5FRMA 3JCMe 1YHQA 1QQJA 2DTOA 2F2VA 3CCQA 2CKKA 3GF5A 2OTLA 3FRNA 2YUOA 3VUBA 2RJFA 5I22A 3OYBA 2CSIA 2COYA 4IUUA 3HFNA 4LDVA 3NTKA 1M8VA 4JS5A 4E7KA 1Q82C 2D6FA 1I4K1 4FIBA 3M0TA 1PCXA 3OMGA 7AT1B 2RJDA 4B9XA 2VASA 1MMDA 3BDUA 2IG0A 3L2ZA 1Y96B 3MEWA 4BD3A 2MPXC 1QVFA 1R77A 4M78D 4OMPA 2WSCE 3JCMg 2V8JA 2LX7A 4KH1B 3OYYA 4PJOC 2O9VA 4ORZA 2X35A 1D0XA 4C0DC 2E12A 1M90R 3CCRQ 3EH1A 2OX7A 2SEMA 3LGLA 1KSWA 2XU8A 3THKA 1GXIE 3N5BB 3PIPA 2L0AA 2E1HA 2LVMA 1Y71A 3QBYA 4ESRA 3CD6T 2QGFB 2O2OA 3PVQA 2FZGB 3JCMP 2Z0WA 3M0PA 2VB6A 2ZCFB 4M78E 4FSXA 4EPCA 2CZ0B 3QG1A 3CC2A 2ENMA 1E7OA 1ZX6A 2P84A 2EKHA 2Y4YA 4F7UE 2LCSA 3VS2A 3H8ZA 1K8AC 3CCMQ 4MMKA 1NJIC 3CCUT 1UGQB 2CP0A 1F1BB 1IHWA 3HSBA 3R6OA 3SWNC 1M2VB 4F14A 3CCET 3M53A 2DRKA 2LT1A 2CDTA 4PJOA 4KUDK 2ZGWA 1Q7YU 4EMKC 5CQXA 3JAME 4C5HA 1G3WA 1WJSA 3L2QA 5KYNA 1B34B 2PVDB 4V2SA 3R6NA 1KD1R 1WX6A 1N9SA 2D8HA 3M57A 4AFUC 1NLOC 2DL7A 2EBPA 2XG8D 2GFAA 5GAOp 3L2RA 2DFUA 2E5KA 3GPLA 4J6WA 1OZ3A 5DY9A 1UG1A 1YIJT 2QEXT 1PG5B 2W0ZA 4AFSC 1SEMA 5I21A 2LJ0A 2CP6A 4ZGJB 2QA4T 3G1JA 2CUDA 4OVAA 4OMOA 1PHTA 1SF9A 1ZLMA 4B6MA 3VV0A 3CBMA 1LNXA 4Z88A 1OX9A 3SWNA 3G71A 3I9QA 1Y07A 3CMAA 3NMZC 2JTFA 4LDUA 3I56A 3JV3A 2QGGA 1RL2A 1VQKT 1WJQA 4EMKA 1G3TA 4HCZA 4BY6C 4Y91A 3C0CA 5EC7A 2QQSA 4JZ4A 2QDYB 1GJJA 3CC7T 4EIKA 2DZ9A 4M78G 1VQNT 2EPDA 1X27A 1YJ9A 2MWPA 1AOJA 5I2SA 3CCVA 2C0IA 2RHXA 3A1PA 2WACA 4OMLA 1TS9A 5KYUB 1VA7A 2XHCA 3EG3A 2COZA 3CCSA 4KRTA 1OULA 2CREA 1D0ZA 4L6V5 4PJLA 5IH2A 2QQRA 2KFVA 5GAN8 1ZS9A 3REAB 2RB6A 5KYXA 1YJWA 2V8IA 3VYGA 4PL6A 2KK4A 3GNFB 4OP0A 1JRIA 3A8OB 2DEQA 2FB7A 2DILA 1SHGA 1YN8A 2PNIA 4FW1A 1SSFA 1KQ2A 3QIIA 2H3JA 1QCFA 1VYTA 1S72A 1VQLT 4IUQA 2K79A 3FIFA 2GCXA 5IHNA 3M55A 2QAZA 4N4HA 1WJRA 3OS2A 1YHQQ 4X1VA 1W2BS 3PMTA 4PK4A 3RMQA 1WHMA 1TU0B 1M5Q1 4OB2B 3JB9G 2PTKA 1BBZA 2F1LA 2BE7D 1YCYA 1HYOA 3M0SA 2NUZA 3CXCP 4M77D 4JJCA 2EQUA 4C92E 3GOXA 2DXUA 4M78F 1ARKA 4E2FB 5FRNA 1V1CA 1H3ZA 4WF2A 5I2MA 4QKUA 3OYGA 3LWHA 3O8VA 1VQ8A 2YRVA 4FYVB 4F7UF 1ZQ1A 1ZBJA 2RF0A 2G80A 5GAN7 1G3SA 5IN1A 2ABLA 5KYWA 1NYGA 1I5LA 4HXJA 1VQ4A 2A08A 4D6WA 3QDRB 1JU5C 2EVRA 3V8JA 4M77E 3DLMA 2XDPA 1NEBA 1C0MA 3OYAA 3QSUA 4Q5WA 5IAYA 1X6BA 4RTVA 4OMMA 1QWEA 4AMCA 1M1KC 1BIBA 4XTZA 5DM7R 1UFFA 4NL2A 2A37A 4E7LA 4O5VA 1K73C 1BI2A 2EYYA 1VQ9T 2CZ7B 2DK4A 1C6VX 1FX7A 2LC4A 4RTYA 1CSKA 1WHJA 5IHKA 5GAOl 3MPUB 1OV3A 3V8LA 4QW2A 2HBPA 2RQWA 1G8XA 2MPHA 4PJJA 3AT1B 1OI1A 3LYIA 1U1SA 4C5IA 4BE1A 1OX8A 2MIOA 1A63A 4QT7A 4C8QC 1KQ1A 4PFPA 1QVGS 4M7AG 4LDYA 4A53A 4JDSA 4C92G 2B8AA 4OB0B 2L3RA 2LQWA 1WLPB 3OYJA 1QMCA 1RI0A 2LQNA 3RESA 2MF2A 1IB8A 1JEQA 3MEAA 3QJYA 1NJIU 2K3XA 4PJMA 1KC8R 4FU6A 1X75C 3FC3A 2EYXA 2BZ8A 3MP8A 3CCJA 5KCOA 2E70A 2O88A 2YDLA 1NE8A 2DL3A 1N6AA 4J5YA 2EQMA 2A3LA 2DM1A 1Q81C 3A8LB 1R0CB 4DBRA 1GFCA 5GMKi 1VQ5Q 3DB3A 1JEGA 4IUVA 2EYZA 1QWFA 2FPEA 3G71Q 4IUPA 2DEUA 2BKDN 4C8QA 1T0HA 2BTTA 4OMFB 4X9DA 3C94A 3EGDB 2AKKA 2JS0A 2ECZA 3MEVA 3OYDA 3C4SA 4M7AB 3CXCA 2KT1A 2JNGA 4C92B 8AT1B 1KHCA 4M7AF 2ZPIB 4C92F 1YBYA 1VQ7T 2DK3A 1VQ6Q 2RI5A 1YJ9Q 2E3IA 2E6NA 2HKNA 2XKOC 2KI7A 2ROLA 1GFDA 3CCVQ 1LCKA 1NPRA 2HZYA 4TVRA 4B9WA 5FU6B 1UDLA 1PKTA 2EGEA 1Z9QA 1VQOT 4X34A 3SFMA 5AT1B 2ZPGB 1M1KR 5GMKm 5D6XA 2KROA 5CQYA 2X4XA 3AHUA 3L42A 3CC4T 3EG1A 1X6OA 1WA7A 3CC7Q 2KVQG 2MI6A 4LDWA 5CKHA 2DO3A 1UHFA 4RG2A 3TU4K 3L2WA 1KFZA 4J9EA 4C5EA 2FPDA 1PNJA 1ZHIA 1JJRA 2J05A 4QVZA 5GANh 2O9SA 3JCMb 3M54A 1MNEA 1KQSP 2ZAEA 3SB2A 1VQPT 3EG9A 4BITA 2PZ1A 2DVEA 4KUIA 4KH0B 4A4EA 2EGCA 1OPKA 4DBHA 3VS6A 5CR2A 4R55A 2SRCA 3JCMW 1RAFB 1D3BB 4LUEA 3OS1A 3NGPA 3JCMX 1UECA 3KUFA 4F16A 3G4SA 2LDMA 3PMIA 4F04B 3PTAA 1UHCA 2HQEA 2KVUA 5CVIA 3S3NA 3OBWA 1V66A 2LRQA 5LJ3e 3S3OA 1UGPB 1FMVA 4R0KA 5GANd 5DLOA 4HT8A 1MV0B 2BZYA 2F69A 2C06A 2KYMA 5GAMf 1YFNA 5A0LA 3EFSA 1EX4A 2LZ6B 3JCMV 1Q81R 1WHGA 4Z8AA 2QNCA 1YP5A 2RQTA 4HT9A 5CKBA 2LJ3A 3RBBB 4BUGA 1IGUA 2QQBA 4RTZA 4D8KA 2K6DA 3X24B 1A0NB 5M9OA 1RADB 1IO6A 2YWWA 1VUBA 3X28B 1PD0A 2VWFA 2MWOA 1QVFS 1KD1C 4CC3A 2RA2A 2ZPBB 4RKUE 1YWOA 4DA4A 2R5AA 2EWNA 2M9UA 2ZPFB 2JUFA 3E9FA 4HVUA 2C0TA 5CKEA 2GGRA 3U23A 3P8HA 2G6FX 2DD4A 1NLPC 2COWA 2OTLT 1I07A 2EIFA 5GAN6 2BUDA 1X01A 2LJ1A 2V8KA 1U3OA 2MOXA 2YRCA 1AWOA 1YNSA 2LQKA 2D0NA 2QNFA 4O6JA 4GBQA 1MV3A 2LC3A 4M75G 1UGVA 2MMPA 1QKXA 4HKEA 2H8HA 2JW4A 3TSZA 3CPWP 2NUTA 4MMLA 2RK1A 2RO0A 1SHFA 3VKIA 2L3SA 3EFOB 4MZMA 3X25B 3CCJQ 2HBWA 1N9RA 3OYKA 1RAIB 2K2VA 2FZKB 3OB9A 2MK5A 1YITT 1AEYA 2J6FA 2KSSA 1M27C 2E6ZA 3VS7A 1RAGB 4M78C 1N27A 1M1GA 3JB9J 4GLMA 3HHTB 2RNAA 1N8RC 2HAXA 2PVOB 1D1BA 3EGXB 3JB9H 4E7JA 1K9MC 1BYMA 1U06A 3P8BB 3OYMA 4BACA 1KQSA 2FZCB 5IXBA 4FW2A 1HXDA 2FVUA 3C95A 3MCAB 1TSFA 4OGCA 2KEAA 2DIQA 2M1HA 5KYYB 4XTYA 2O4XB 1M1FA 4M75B 4XTWA 2FEIA 3CC2T 3SEMA 1WHKA 3URGA 2GFUA 3S6WA 4M75F 3JCMf 5GANe 4M7DG 4J9CA 1WPYA 2P0QA 1AWWA 2E64A 5CCAA 3SHWA 3SDZA 2HD0A 5KCHA 2D1XA 2JTEA 1SKUB 3TSWA 2CZ6B 1H1JS 5J26A 3ME9A 3H0IA 2RNNA 4A63B 2VXFA 2B86A 2IVWA 3CCLQ 1TTHB 5FU7B 5KE2A 1C1AA 1H9EA 3JB9D 1AT1B 4F7UA 1EFNA 3G7ZA 2HKQB 2KW9A 1IGQA 2P0PA 5IXFA 2M0OA 3H0HA 1WXTA 3RIRA 4FM4B 1JJ2P 1ABOA 4MDXA 3X26B 4LDXA 1GBQA 4KT0E 2KVEA 1W4SA 1E7LA 4XTUA 1PD1A 3LX7A 3OSVA 4AT1B 3LWIA 4RUGA 3P8DA 2P4TA 2NWMA 5GANg 2ZZDA 4N4IA 1LVKA 3CCUA 1MMAA 2K5IA 3CC4Q 4M7DB 1N5ZA 2J6KA 1NBEB 2X4JA 3I55Q 3CCEA 4M7DF 2JTMA 3CMAT 5CO7A 2LCCA 3I56T 2WQGA 1WNLA 1WIEA 2DRMA 1VQ5A 4X9CA 3JCMJ 2GQIA 3G4SQ 4BDZA 1D0YA 5GAN3 2M16A 5GANj 2EKOA 2DL8A 2QTVA 1Q86C 1M90U 4A54A 3LH5A 2JVVA 1TUCA 2JJ9A 1Z9ZA 4FT2A 5GAN5 4FL6A 3QKJA 2DYBA 3CPWA 2E3HA 2VUBA 1YIJA 2QEXA 2W10A 3I5RA 4DBFA 3CCST 1VQ6A 4ZNXA 2K57A 4P5NA 2HQHA 4RTXA 3BE3A 4DOWA 2KT8A 1PRLC 1YI2T 2DBMA 1D09B 2QASA 4WCIA 3NFCA 1N8RR 5D6WA 2NUPA 4IUTA 4BI4A 1JBMA 1K9MR 2D0QB 1WXBA 4JLIA 1VQKA 5C6SA 1JXMA 2JMCA 2DPPB 1KC8C 4PNOA 1RABB 4M7AD 4C0FA 4LNPA 2RQUA 4C92D 4CRIA 2K3BA 2K5FA 1JJ2S 3QWXX 4PLIA 4PJOG 3QXEB 3CC7A 1UGSB 2KYBA 2CP5A 1VQNA 2RHIA 4E47A 3FLGA 1OZ2A 4JPBW 1B07A 2RN8A 1K0XA 1JEIA 4HVWA 2QI2A 2AZVA 4ELZC 3OSSC 1P92A 2RH2A 4M77C 5GMKl 1UUEA 1MUZA 4DQ2A 3QUIA 4LE9A 2V1RA 1H92A 4M7AE 1HK9A 1YJNQ 1VQMT 3HKSA 3KFVA 4IURA 2X3XD 3OYLA 1BCOA 1QKWA 2L5QA 2KRMA 1G2BA 3RKWA 2M51A 4II1A 5L8RE 1EN7A 5GMKe 1H9FA 1VQ4T 3X20B 3UPUA 2RJEA 1IZ6A 2FPFA 4J8OA 1KJWA 4A4FA 1VQLA 2WSFE 1LJOA 2NLUA 3LW5E 2OAWA 1T0JA 2RQRA 3F70A 4RMOA 2WSEE 3ZFJA 2I0NA 1NM7A 3HRTA 3RUXA 1K1ZA 4PJOB 4C0DB 1MGQA 3KBGA 1Q82U 4PJOF 2YHTA 4BB7A 1JJ2A 3H9NA 2HCKA 1CKAA 3KXTA 4OMQA 4M77A 1T3SA 4BI3A 2G3RA 2CGHA 1HD3A 4NS5A 2EJFA 4KBMB 2RI2A 1ZUYA 3JB9F 2MCNA 3FDRA 3QO3A 1YITQ 4FYYB 1WI7A 2FYKA 1M8MA 2FL7A 5LJ5h 3G6ET 3MHXA 3PIOA 1Q86R 2L3PA 4KGXB 2O31A 2L89A 3BDLA 1ZSZC 5LJ3h 3VS0A 2QYZA 1BI0A 2ED0A 4OF1A 2RM4A 4C0GA 3SWNB 2RNOA 5GAMd 3RDVA 1KK7A 2RPNA 1NPPA 2PQWA 4DEXA 3L1AA 2L8DA 4J9BA 4Y92A 3CXCS 4EMKB 1WQ7A 4E7ZA 2XD0A 5CIUA 1WHHA 1QP3A 3CMET 1ZBXA 3CD6Q 1VQ9A 3E2UA 6AT1B 2PU9B 1M3BA 4AG1C 4LD6A 3O5ZA 3OY9A 1U8RA 1K8AU 2P4RA 2KE9A 1M9SA 4J9DA 4CC7A 1W6XA 1M4ZA 1RLPC 5LJ5d 2L3QA 1WQWA 2ODGC 4J9FA 5LJ3d 3UDCA 3CCUQ 3L2UA 3NTIA 1ZSZA 2PUKB 2CP2A 2RD1A 4XAXB 5KYXB 3CCEQ 1E6GA 1H3HA 2RHUA 1JB0E 4CI0C 1PSFA 2HSEB 5GAOr 1AZGB 4C0ZA 3CCRT 1IREB 4BY6B 3PGGA 1YNZA 1RAHB 4Z02A 1FWZA 1QCNA 3RNJA 1QCOA 3GLXA 1O9SA 2DE0X
chains in the Genus database with same CATH topology
2PVGB 3R6OA 3SWNC 3TCJA 5M9OA 3CCET 3OA6A 3M53A 2LT1A 4FT4A 4PJOA 4KUDK 1VUBA 4N0AA 1XOVA 2A7YA 2EQKA 2MAMA 2ZGWA 1PSEA 3X28B 3A8HB 4ELYC 4F7UB 5HY6A 5GAMh 4EMKC 3A5ZB 2MWOA 5CQXA 3JAME 1KD1C 1QVFS 4C5HA 1G3WA 2RA2A 2VC8A 2ZPBB 1WJSA 2OAUA 3FJPA 3PT9A 4RKUE 2XDDA 2R5AA 3UT1A 5DLQE 3L2QA 4DA4A 5AYFA 2EWNA 2M9UA 2ZPFB 2JUFA 3E9FA 5CKEA 1B34B 2PVDB 1VQMA 3J81E 4XTXA 4V2SA 3P8HA 3M4GA 4ZTJA 2DD4A 1N9SA 3HPWA 1TH7A 3CCMT 4ZTFA 2OTLT 3M57A 2EIFA 5GAN6 2BUDA 5IT9E 3V8KA 1X01A 3OYIA 2V8KA 2XG8D 5CK9A 2GFAA 5GAOp 3L2RA 2QTXA 3GPLA 4J6WA 1BKBA 1OZ3A 5DY9A 3EAEA 2LQKA 4UC4A 1UB4A 2RI3A 2EJ9A 1NZ9A 1YIJT 1UGRB 4O6JA 2QEXT 1N8RU 3E9GA 1VIFA 5I21A 4ZGJB 2LNVA 3MEUA 4M75G 2QA4T 3S3MA 3CCLA 2KAFA 1K9MU 3M56A 4KULA 3BW1A 2Y4XA 4OVAA 1VQ7A 2MMPA 3CBOA 4HKEA 4M75D 1DJ7B 3DKMA 3VV0A 5C0MA 5GAOn 3CBMA 1LNXA 1H641 4MMLA 1Q7YC 3SWNA 2RK1A 2RO0A 1FXXA 3VKIA 3G71A 1W2BA 3X25B 3NTHA 4MZMA 3J7AF 1Y07A 3CMAA 1N9RA 1KC8U 2JTFA 3V7CA 4LDUA 3I56A 4HCBA 3OS5A 4A4KA 3OYKA 5GAMe 1RL2A 1VQKT 2ZPHB 1WJQA 3M58A 2K2VA 3OYEA 4EMKA 3A8MB 3HFOA 1G3TA 3OB9A 4HCZA 4BY6C 2DXTA 1YITT 1Y96A 2DXCA 3QZ5B 4Y91A 2KSSA 5GMKj 2QQSA 2QDYB 5LL6S 3RKYA 4ZN1A 3CC7T 4DOVA 1XQHA 5CKDA 2KDSA 2CYZB 2DZ9A 2E6ZA 4M78G 4M78C 1VQNT 3DB4A 4GY5A 1N27A 1M1GA 2E10A 2E41A 3JB9J 4M75E 3HHTB 1YJ9A 2DD5A 2MWPA 1N8RC 4E7HA 2HAXA 1D3BA 3JB9I 3G6EA 2PVOB 2XICA 4J6YA 5I2SA 2RHXA 3LH0A 3I55A 2WACA 3CCVA 3M5AA 4PLLA 3CCJT 3JB9H 4E7JA 2XHCA 1K9MC 3P8BB 3OYMA 1BYMA 2BIVA 4BACA 1KQSA 3CCSA 3RERA 1HXDA 1KHIA 2FVUA 4C8QG 3C95A 3MCAB 4L6V5 3EFRA 4OGCA 2DIQA 2QQRA 2M1HA 2HNIA 5J3BA 5LJ5e 4ATOA 2ZPEB 2EYQA 5GAN8 5GAN2 4C8QD 4XTYA 2O4XB 1M1FA 4XU2A 4M75B 4XTWA 3CC2T 3URGA 2RB6A 3V7RA 4QVDA 1U1TA 2DTHA 2V8IA 2GFUA 3S6WA 3VYGA 4PL6A 2KK4A 1YJWA 3GNFB 4OP0A 4M75F 1JRIA 4QQ6A 3A8OB 3JCMf 3CMEA 5KH6A 2DEQA 2FB7A 3FEOA 1BI3A 5GANe 4QVCA 3J80E 1VIEA 4M7DG 1WPYA 2P0QA 1SSFA 1KQ2A 5GAMg 3QIIA 2H3JA 2E64A 1VQLT 2HQXA 3INZA 4MZTA 1S72A 4IUQA 3FIFA 4M7DD 2GCXA 3RMSA 2R58A 5CCAA 5EG2A 3M55A 2LQ8A 4N4HA 1WJRA 4OB1B 3SDZA 4OB3B 3OS2A 2HD0A 5KCHA 1W2BS 3PMTA 2EJGA 3RMQA 2CZ6B 4MZPA 5J26A 1M5Q1 4M77G 3ME9A 2FHDA 4OB2B 3JB9G 1KG1A 4C8QE 1YCYA 4C5GA 4IKFA 2VXFA 2IVWA 4M77D 3M9QA 5FU7B 5KE2A 1UEBA 3JB9D 3JCMh 4C92E 2EQUA 3OMCA 1M1KU 3GOXA 2DXUA 2GQVA 4M78F 4F7UA 2VXEA 5FRNA 3Q1JA 5A0DA 3G7ZA 5GAMj 1H3ZA 2QQ9A 2P0PA 4WF2A 5I2MA 2VGNA 4J83A 3OYGA 1B34A 3LWHA 2K3YA 3O8VA 3VU3C 4EMGA 5LJ5g 2M0OA 1K73U 2YRVA 1VQ8A 4F7UF 4M7DE 1YHQT 1Q86U 3RIRA 4FM4B 1ZQ1A 4C8QB 3OYCA 4MDXA 3X26B 3OYHA 3GIBA 4LDXA 4PKCC 5GAN7 1G3SA 4KT0E 1G5VA 2LCLA 1W4SA 5IN1A 5LJ3g 3JCMc 3CCQT 4XTUA 3BFMA 3CCRA 1KQSS 3LX7A 3OSVA 5A0GA 3LWIA 1I5LA 2F5KA 3QYHB 4D6WA 1VQ4A 3QDRB 3CCLT 1QVGA 3V8JA 3HRUA 2KY9A 2P4TA 3P8DA 3WXMB 2ZZDA 5GANg 2LTOA 4M77E 3DLMA 3GP8A 4N4IA 2XDPA 4RCBA 1QVPA 3CCUA 2K5IA 4M7DB 4XK8E 3OYAA 3QSUA 4Q5WA 2Y90A 3BY7A 2X4JA 3CCEA 3OBYA 5IAYA 4M7DF 2JTMA 5LJ5j 3CMAT 4M75C 5CO7A 2LCCA 2F5TX 1YJNA 3I56T 1M1KC 4HCCA 1WNLA 1BIBA 4JRPA 4XTZA 1VQ5A 2XK0A 4X9CA 5CKFA 5LJ3j 3JCMJ 5DM7R 3HSBA 3JCMd 2OTJA 1AHJB 4BDZA 4NL2A 4M77B 3QJ6A 5GAN3 2M16A 2KMTA 4XU3A 4E7LA 4O5VA 3VYHB 1K73C 4M77F 5GANj 2EKOA 1Q86C 1BI2A 3CCMA 1M90U 4A54A 4XTVA 1VQ9T 1V29B 2JVVA 4XU1A 3TEEA 2DZCA 1WGSA 2CZ7B 5D6YA 4FT2A 2VYTA 5GAN5 4FL6A 3PFSA 1VQOA 3QKJA 1FX7A 3MO8A 3I55T 2LC4A 4ME7A 5J39A 3QYGB 2EFIA 4MDWA 2LX9A 2YLBA 3CPWA 2VUBA 1YIJA 2QEXA 2DIGA 2K5LA 5GAOl 1R8OB 3CCST 4J7IA 1VQ6A 3MP6A 4VUBA 3V8LA 5FLXE 2K57A 2DJZA 5FU7C 5GAOq 4P5NA 3G4ST 3QHSA 4QW2A 2HBPA 3JRZA 3WVDB 3ZEHA 4DOWA 4JUVA 4NOYA 3L2VA 2DAQA 1YI2T 4XQ3A 1OI1A 3V7SA 3LYIA 3JCMQ 1U1SA 3NFCA 4C5IA 4BE1A 1Q81U 1BIAA 5D6WA 4JRQA 2K4YA 2O4XA 4IUTA 3C12A 1KQ1A 4C8QC 5GMKh 2LT4A 4M75A 4BI4A 1Q7YU 1JBMA 1QVGS 3E1SA 4ZGEB 2D0QB 4LDYA 3M59A 4M7AG 4A53A 4JDSA 4JLIA 4C92G 5C6SA 1VQKA 2B8AA 4OB0B 2L3RA 3CC4A 2DPPB 1KC8C 4PNOA 3OYJA 3OW2S 4C0FA 4RCCA 4M7AD 1RI0A 3RESA 2I2LA 4C92D 1YITA 3CEYA 4L59A 1M90C 4CRIA 2MF2A 4JLGA 2JN0A 3MEAA 2K5FA 3ZBDA 1JJ2S 3QJYA 4PLIA 1VQPA 4PJOG 2K3XA 3QXEB 3CC7A 1UGSB 1NJIU 1I81A 1XNIA 3FB9A 4M7DC 2GF7A 4FU6A 1X75C 4RG8A 3FC3A 1VQNA 2RHZA 2AHJB 4PJOD 2RHIA 3RKXA 4E47A 3FLGA 1OZ2A 3HP9A 2E5QA 4JJNK 3MP8A 2JZ2A 2QI2A 5GAN4 3CCJA 2RJCA 4ELZC 3OSSC 1P92A 2E70A 5KCOA 3M4YA 1NE8A 2EAYA 4M78A 1N6AA 1QP2A 2RH2A 2EQMA 4J5YA 4M77C 5GMKl 2A3LA 4DQ2A 2VGMA 4YTLA 3PNWC 3QUIA 1Q81C 4M7AE 1HK9A 5GAOm 3A8LB 5HKCA 1VQMT 5GMKi 3HKSA 4IURA 3DB3A 3UWNA 4IUVA 3OYFA 3OYLA 3CPWS 2L5QA 4Y28E 3GNGA 3LLRA 3CD6A 4IUPA 3RKWA 2DTIA 2BKDN 2QXFA 4C8QA 4II1A 5L8RE 5GMKe 1VQ4T 4PJOE 3X20B 4HA8A 4OMFB 4ZN3A 3UPUA 2RJEA 1IZ6A 4X9DA 3C94A 4J8OA 5HK0A 1Y7XA 4E7IA 4A4FA 1OYXA 3MEVA 3QPHA 2WSFE 1VQLA 3OYDA 3C4SA 4N4GA 4M7AB 3CXCA 3DLLA 1O75A 4C8QF 1LOJA 1LJOA 2NLUA 2JNGA 2QQAA 3HRSA 3LW5E 4C92B 1KHCA 1MHNA 2VV5A 2ZPIB 3ER0A 4M7AF 3VJPA 5CAIA 4JRKA 4GLKA 3F70A 4A4HA 4C92F 1YBYA 4JS4A 4RMOA 2KQWA 2WSEE 1YJNT 4BE0A 3ZFJA 1VQ7T 4M7DA 2EQJA 3RUXA 2DK3A 3HRTA 4BI8B 2RI5A 3CPFA 3OW2A 1VQ5T 3X24B 4PJOB 3H6ZA 4C0DB 2E6NA 2XKOC 1MGQA 3KBGA 3VUZA 3G71T 3CBPA 4BDYA 1Q82U 5LJ5f 4PJOF 2JOYA 2YHTA 3T9NA 4BB7A 1JJ2A 3LGFA 3OQ5A 1NPRA 2CZ1B 2R57A 4TVRA 3SD4A 5FROA 3KXTA 4B9WA 3A8GB 5FU6B 4M77A 2X4WA 5LJ3f 4BI3A 2G3RA 3E19A 4R56A 2E65A 2CGHA 4L5GA 5FRMA 4NS5A 3JSCA 4X34A 2EJFA 3SFMA 3JCMe 4KBMB 5GANf 1VQOT 1YHQA 2RI2A 2ZPGB 5GMKm 2DTOA 5D6XA 5CQYA 2X4XA 3TREA 3AHUA 3FDRA 3QO3A 3JB9F 4J7FA 3CCQA 1VQ6T 2CKKA 3L42A 3GF5A 2OTLA 2FYKA 3FRNA 3VUBA 5A2QE 2FL7A 2RK2A 3CC4T 2RJFA 1X6OA 1YJ9T 5LJ5h 3G6ET 3CCVT 2KVQG 2MI6A 3HL8A 3MHXA 2DO3A 4LDWA 5CKHA 3PIOA 3OYBA 4IUUA 4RG2A 3HFNA 3L2WA 3TU4K 2L89A 2O01E 4C5EA 4LDVA 3BDLA 4NL3A 2X4YA 3NTKA 5LJ3h 1ZHIA 1M8VA 1XTDA 4JRIA 2XI9A 2XIDA 1BI0A 4QVZA 2QA4A 4OF1A 2RM4A 4JS5A 4C0GA 3QZ9B 3SWNB 4EDUA 4ZGDB 5GAMd 4E7KA 5GANh 1Q82C 2D6FA 1I4K1 1NPPA 4FIBA 3JCMb 2XDBA 3OMGA 4OGEA 2RJDA 2PQWA 2CS7A 4B9XA 3L1AA 2L8DA 3M54A 1YJWT 1I8FA 1G3YA 3CXCS 4EMKB 1WQ7A 2XD0A 5CIUA 3SB2A 3BDUA 2DXBA 1QP3A 3CMET 2IG0A 1VQPT 3L2ZA 1Y96B 1ZBXA 3MEWA 4BD3A 4M7AC 2DVEA 4KUIA 1QVFA 4C92C 3OYNA 1VQ9A 4A4EA 4EMHA 1S72T 2PU9B 4LD9K 5CR2A 4M78D 4LD6A 4R55A 2WSCE 3JCMg 2V8JA 3JCMW 3OY9A 1EIFA 1U8RA 1K8AU 4F7UG 1D3BB 2YLCA 3OS1A 3OYYA 3WVEB 1M9SA 3JCMX 4PJOC 5KE3A 4N0AC 3KUFA 1M4ZA 2X35A 4C0DC 2E12A 5LJ5d 3G4SA 2D9TA 2LDMA 3PMIA 3PTAA 2P0KA 3LGLA 2OTJT 2HQEA 4XU0A 1WQWA 2XU8A 5CVIA 4A4GA 1YI2A 2DKGA 1GXIE 3S3NA 5FU6C 5LJ3d 3OBWA 3UDCA 2LRQA 3NTIA 3L2UA 3N5BB 1KD1U 5LJ3e 2PUKB 3PIPA 2E1HA 2LVMA 1Y71A 2RD1A 1UGPB 3META 3QBYA 3S3OA 3CD6T 4XAXB 3MP1A 5GANd 3JCMP 2RHUA 5DLOA 4HT8A 1JB0E 2ZCFB 1VQ8T 4CI0C 4M78E 1PSFA 4FSXA 2F69A 2C06A 4EPCA 2CZ0B 5GAOr 2PUOB 4BE2A 3QG1A 3CC2A 5GAMf 5A0LA 3EFSA 2RHYA 3JCMV 4C0ZA 3CCRT 2Y4YA 4F7UE 4J6XA 1IREB 4BY6B 3PGGA 4HT9A 1BI1A 5CKBA 4M7AA 4Z02A 3H8ZA 1FWZA 2R5MA 4QQGA 1QW1A 1K8AC 4C92A 4MMKA 1NJIC 3CCUT 1UGQB 3OS0A 4BUGA 2QQBA 3GLXA 3ASKA 5HK3A 1O9SA 4M78B 4QQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M9O A;  4QQ6 A;  4QW2 A;  5FRM A;  4NS5 A;  4X34 A;  5KH6 A;  3OA6 A;  3ZEH A;  3FEO A;  2RI2 A;  3L2V A;  2DAQ A;  5D6X A;  1SSF A;  1OI1 A;  3QII A;  3LYI A;  2EQK A;  2X4X A;  3FDR A;  2HQX A;  4IUQ A;  2CKK A;  3L42 A;  4C5I A;  2MWO A;  4BE1 A;  2R58 A;  5D6W A;  4C5H A;  2RJF A;  1WJS A;  4N4H A;  1WJR A;  2O4X A;  2R5A A;  4IUT A;  3UT1 A;  5KCH A;  3OS2 A;  3L2Q A;  3PMT A;  3E9F A;  3OYB A;  5C6S A;  3P8H A;  4IUU A;  2B8A A;  4RG2 A;  5J26 A;  3ME9 A;  2L3R A;  2FHD A;  2L89 A;  4C5E A;  3L2W A;  3BDL A;  4ZTJ A;  2X4Y A;  3NTK A;  3OYJ A;  4ZTF A;  4C5G A;  4IKF A;  1RI0 A;  2BUD A;  3CEY A;  4L59 A;  4CRI A;  3M9Q A;  4QVZ A;  5KE2 A;  3OYI A;  3MEA A;  2EQU A;  2GFA A;  4EDU A;  3OMC A;  3L2R A;  4E7K A;  3GOX A;  4PLI A;  2K3X A;  1OZ3 A;  5FRN A;  3Q1J A;  3OMG A;  3EAE A;  1XNI A;  4UC4 A;  2RI3 A;  2GF7 A;  4FU6 A;  2RJD A;  2PQW A;  1H3Z A;  3FC3 A;  4B9X A;  2RHZ A;  2L8D A;  3E9G A;  2RHI A;  1OZ2 A;  3FLG A;  2E5Q A;  3OYG A;  3MP8 A;  5CIU A;  2K3Y A;  3O8V A;  3MEU A;  3S3M A;  2M0O A;  2YRV A;  2JZ2 A;  2IG0 A;  4OVA A;  3OYC A;  2RJC A;  3MEW A;  4BD3 A;  5KCO A;  3OYH A;  1G5V A;  5C0M A;  3OYN A;  5IN1 A;  4A4E A;  2EQM A;  2RO0 A;  3LX7 A;  3PNW C;  4LD6 A;  2F5K A;  3NTH A;  3OY9 A;  3P8D A;  2LTO A;  3OS1 A;  3DLM A;  2JTF A;  4N4I A;  2XDP A;  3OYK A;  4IUR A;  1WJQ A;  3DB3 A;  4IUV A;  3KUF A;  2X35 A;  3UWN A;  5KE3 A;  3OYF A;  3OYE A;  3OYA A;  3OYL A;  3LLR A;  3OB9 A;  4IUP A;  4Q5W A;  2D9T A;  2LDM A;  3PMI A;  2BKD N;  4HCZ A;  2P0K A;  4II1 A;  5IAY A;  3LGL A;  2HQE A;  2QQS A;  2RJE A;  4E7I A;  4A4G A;  2LCC A;  3S3N A;  4A4F A;  1OYX A;  2LRQ A;  3MEV A;  3NTI A;  3L2U A;  3OYD A;  3C4S A;  4N4G A;  2LVM A;  2XK0 A;  3DB4 A;  4GY5 A;  3QBY A;  1N27 A;  3MET A;  3S3O A;  2NLU A;  4BDZ A;  2MWP A;  1KHC A;  3MP1 A;  4E7H A;  1MHN A;  2RHU A;  3QJ6 A;  2M16 A;  2RHX A;  3LH0 A;  3F70 A;  2WAC A;  4A4H A;  4E7L A;  4PLL A;  4BE0 A;  4E7J A;  2EKO A;  2EQJ A;  3OYM A;  4BE2 A;  2BIV A;  2RI5 A;  4BAC A;  3H6Z A;  2RHY A;  2E6N A;  5D6Y A;  1WGS A;  2VYT A;  4BDY A;  2DIQ A;  2QQR A;  2M1H A;  3PFS A;  4FL6 A;  3QKJ A;  3LGF A;  3MO8 A;  3OQ5 A;  5J39 A;  2EFI A;  2R57 A;  2O4X B;  4Z02 A;  3SD4 A;  3H8Z A;  2R5M A;  5FRO A;  4QQG A;  4B9W A;  2DIG A;  2X4W A;  2GFU A;  2G3R A;  3MP6 A;  4PL6 A;  3S6W A;  3OS0 A;  3ASK A;  4QQD A; 
#chains in the Genus database with same CATH topology
 3TCJ A;  2X3W D;  1MMG A;  1PKS A;  1YIJ Q;  2OI3 A;  2QEX Q;  2DBK A;  1XOV A;  3I5S A;  1PSE A;  3A8H B;  4ELY C;  3A5Z B;  1JO8 A;  2LMJ A;  1AD5 A;  2QA4 Q;  2OTJ T;  3PT9 A;  2XDD A;  5AYF A;  3J81 E;  3M4G A;  4UZW A;  4ZTJ A;  3CCM T;  4ZTF A;  2JT4 A;  4AG2 C;  3V8K A;  5CK9 A;  5KYW B;  4FCY A;  2QTX A;  2YT6 A;  1VQK Q;  3EAE A;  4UC4 A;  1UB4 A;  2EJ9 A;  1UGR B;  3E9G A;  1VIF A;  2YUP A;  2J06 A;  4F17 A;  1ZUU A;  2LNV A;  3CCL A;  2KAF A;  4KUL A;  1VQ7 A;  4M75 D;  1VQN Q;  1V76 A;  5HCK A;  1Q7Y C;  5IHI A;  2DA9 A;  3NTH A;  1YI2 Q;  3J7A F;  5L23 A;  1KC8 U;  4HCB A;  3OS5 A;  5GAM e;  2ZPH B;  3OYE A;  3ZL7 C;  2DXT A;  1Y96 A;  3QZ5 B;  4KGV B;  5FW9 A;  2GTO A;  4ZN1 A;  4DOV A;  5CKD A;  2KXC A;  1ZBH A;  1RUW A;  4GY5 A;  2CH4 A;  1M2O A;  1OPL A;  2E41 A;  3CC4 A;  4M75 E;  1RI9 A;  3JB9 I;  1BU1 A;  2XIC A;  4J6Y A;  2M02 A;  3LH0 A;  3REB B;  3I55 A;  2YXY A;  1VQL Q;  1UTI A;  1UJY A;  3RER A;  4C8Q G;  3QDF A;  1CKB A;  5LJ5 e;  4ATO A;  5J3B A;  2ZPE B;  5GAN 2;  1WYX A;  4QVD A;  2LP5 A;  2DLP A;  2QG9 B;  5KH6 A;  1GKU B;  3FEO A;  1BI3 A;  4QVC A;  3J80 E;  2KGT A;  1MMN A;  2KR3 A;  5GAM g;  1PC0 A;  4M7D D;  2CUB A;  1JQQ A;  2V26 A;  2AIR B;  4OB1 B;  4OB3 B;  1SSH A;  2YUQ A;  2FHD A;  2XMF A;  1KG1 A;  1M2V A;  4IKF A;  1UEB A;  3H41 A;  2VKN A;  2NYS A;  1Y02 A;  1M1K U;  2VXE A;  3Q1J A;  2FRY A;  5GAM j;  2QQ9 A;  1B34 A;  3VU3 C;  1K73 U;  4M7D E;  5LJ5 g;  1YHQ T;  2BZX A;  3OYC A;  4C8Q B;  2KBT A;  3OYH A;  3GIB A;  4PKC C;  1G5V A;  2LCL A;  5LJ3 g;  3CCQ T;  4JJD A;  3BFM A;  1KQS S;  4J9H A;  3HRU A;  2CT4 A;  2DET A;  3GP8 A;  1YWP A;  4RCB A;  1VQ9 Q;  3G6E Q;  2Y90 A;  3BY7 A;  1IHV A;  3A98 A;  3M0Q A;  5LJ5 j;  1TG0 A;  2F5T X;  1YJN A;  2JVW A;  3VS3 A;  5LJ3 j;  2AZS A;  1AHJ B;  2W51 A;  2YRD A;  1X43 A;  3QJ6 A;  3QWY A;  4FYW B;  1GCQ C;  4XU3 A;  4RTU A;  4HCK A;  2ROT A;  1Q7Y R;  1I5O B;  4XTV A;  4XU1 A;  4JZ3 A;  3TEE A;  3ULR B;  2DZC A;  1WGS A;  5D6Y A;  3CME Q;  2VYT A;  1BCM A;  4ME7 A;  3QYG B;  1RLQ C;  1WDX A;  1I0C A;  4J7I A;  3MP6 A;  2DJZ A;  2MYS A;  3QHS A;  2IPO B;  5KYU A;  1J3T A;  3JRZ A;  2K9G A;  3WVD B;  1WZO A;  4JUV A;  2DAQ A;  4XQ3 A;  1AZE A;  1Q81 U;  1BIA A;  3NHN A;  1OQK A;  1K9A A;  4JRQ A;  2OJ2 A;  3C12 A;  5GMK h;  5FWC A;  4ZGE B;  3M59 A;  3EG9 B;  4RCC A;  2I2L A;  1Q95 G;  1YIT A;  1GCQ A;  2JN0 A;  1OEB A;  2FG0 A;  2GNC A;  4JJB A;  1PWT A;  3FB9 A;  4PJO D;  3HP9 A;  3I35 A;  2E5Q A;  3HTR A;  5GAN 4;  2RJC A;  2K2M A;  2GBQ A;  2EAY A;  4M78 A;  1QP2 A;  1GL5 A;  1FYN A;  3VS5 A;  4YTL A;  2KRN A;  1VQ7 Q;  1VOM A;  5HKC A;  1AWX A;  3CPW S;  2OTJ Q;  3GNG A;  3LLR A;  3CD6 A;  1WFW A;  4PJO E;  4E7I A;  5HK0 A;  1Y7X A;  3EHQ A;  1OYX A;  4E7S A;  2JS2 A;  4AFZ C;  3DLL A;  1O75 A;  1LOJ A;  2QQA A;  3HRS A;  1VQO Q;  1MHN A;  2VV5 A;  3ER0 A;  3VJP A;  4JS4 A;  2KQW A;  4BE0 A;  2EQJ A;  4BI8 B;  3CPF A;  1OOT A;  1VQ5 T;  3G71 T;  3CBP A;  4BDY A;  2JOY A;  1QLY A;  5D7U A;  2HMA A;  2CZ1 B;  2JMA A;  2R57 A;  3SD4 A;  5FRO A;  2HEQ A;  2X4W A;  4QQD A;  3M0R A;  2CH4 W;  3JSC A;  1W2B P;  5GAN f;  1TUG B;  2M0Y A;  3TRE A;  2JM8 A;  4J7F A;  1VQ6 T;  1RAA B;  5A2Q E;  2RK2 A;  2JXB A;  3VRZ A;  1YJ9 T;  2ED1 A;  1VQP Q;  2LD7 A;  1LPL A;  3CCV T;  3HL8 A;  4HVV A;  2RMO A;  2O01 E;  4NL3 A;  2X4Y A;  2FO0 A;  3EHR A;  4PFO A;  1XTD A;  2A28 A;  4JRI A;  2XI9 A;  2XID A;  5I11 A;  2CP7 A;  1OU8 A;  4D8D A;  2QA4 A;  2NUT B;  3QZ9 B;  4EDU A;  4ZGD B;  3TVT A;  1E6H A;  2XDB A;  4OGE A;  1ABQ A;  2CS7 A;  4M4Z A;  1GL9 B;  1YJW T;  1I8F A;  1G3Y A;  1Q82 R;  2DXB A;  2YSQ A;  2EW3 A;  2RQV A;  1ZSG A;  4M7A C;  3PE0 A;  1HJD A;  5GJV B;  1BK2 A;  4C92 C;  3OYN A;  4EMH A;  1S72 T;  1W70 A;  1WXU A;  4LD9 K;  2HL5 C;  1D1C A;  1EIF A;  4F7U G;  2YLC A;  2DVJ A;  3WVE B;  1W1F A;  5KE3 A;  4N0A C;  2EQI A;  1RAE B;  2D9T A;  2P0K A;  3VS1 A;  2IIM A;  2DL5 A;  4XU0 A;  1AWJ A;  4J9G A;  2KNB B;  4A4G A;  2DKG A;  1YI2 A;  5FU6 C;  1KD1 U;  3MET A;  3MP1 A;  1FMK A;  2ATC B;  1VQ8 T;  2HL3 A;  2PUO B;  4BE2 A;  1B7T A;  2RHY A;  1RAC B;  2FRW A;  3EGD A;  4J6X A;  1BI1 A;  1K4U S;  4M7A A;  2R5M A;  3M0U A;  1QW1 A;  4QQG A;  4E6R A;  4C92 A;  3CCQ Q;  1TXQ A;  2OTL Q;  3OS0 A;  2KRS A;  3ASK A;  5HK3 A;  4M78 B;  5HY6 A;  2PVG B;  3OA6 A;  1K8A R;  1QVG P;  4FT4 A;  1NJI R;  2CT3 A;  4N0A A;  2D8J A;  1UE9 A;  2A7Y A;  2EQK A;  2DL4 A;  2MAM A;  5GAM h;  4F7U B;  2EGA A;  1K76 A;  2VC8 A;  3FJP A;  2OAU A;  3IQL A;  3UT1 A;  5DLQ E;  1VQM A;  2K7A A;  4XTX A;  9ATC B;  3HPW A;  1TH7 A;  2J7I A;  5IT9 E;  1Y0M A;  1X6G A;  3OYI A;  1BKB A;  2YUN A;  2RI3 A;  1NZ9 A;  1N8R U;  3RR6 A;  2F2W A;  2DNU A;  2KXD A;  3MEU A;  3S3M A;  2CSQ A;  1K9M U;  1TWB A;  3M56 A;  3BW1 A;  2Y4X A;  3FJ5 A;  3CBO A;  3EG2 A;  3NPF A;  1KIK A;  1DJ7 B;  1MND A;  3DKM A;  5C0M A;  5GAO n;  1IRX A;  1H64 1;  1FXX A;  2F2X A;  1W2B A;  2AK5 A;  1D1A A;  1IXD A;  1X2K A;  3V7C A;  4A4K A;  3M58 A;  2HDA A;  3A8M B;  3HFO A;  4J9I A;  1NYF A;  2H3E B;  2DXC A;  2DF6 A;  1G83 A;  5GMK j;  2J6O A;  5LL6 S;  3RKY A;  3CC2 Q;  2CP3 A;  2EYW A;  1SRM A;  1XQH A;  3CQT A;  2KDS A;  2CYZ B;  3DB4 A;  2E10 A;  2DD5 A;  4E7H A;  1D3B A;  3G6E A;  3M5A A;  4PLL A;  3CCJ T;  1OU9 A;  2DMO A;  1NG2 A;  2BIV A;  4CC2 A;  4KGZ B;  2HJQ A;  1KHI A;  2E4H A;  2X9H A;  3EFR A;  2HNI A;  2EYQ A;  1M3A A;  4C8Q D;  2NUP B;  1Y57 A;  4XU2 A;  1UJ0 A;  3V7R A;  1U1T A;  2DTH A;  4QQ6 A;  3EH2 A;  3CME A;  1VIE A;  3D7S B;  2HQX A;  3INZ A;  4MZT A;  3RMS A;  1SG5 A;  1TOV A;  2R58 A;  5EG2 A;  4FYX B;  2LQ8 A;  3GBQ A;  2A8V A;  1XJW B;  4IIM A;  2EJG A;  2LNH B;  1JXO A;  5FWB A;  4MZP A;  1ZA2 B;  4M77 G;  4C8Q E;  4C5G A;  2KVD A;  5GJW B;  2ESW A;  3M9Q A;  3JCM h;  3OMC A;  2QK0 A;  2GQV A;  3UA7 A;  5A0D A;  2VGN A;  4J83 A;  3OW2 P;  2K3Y A;  4LXC A;  4EMG A;  3CMA Q;  3I56 Q;  1Q86 U;  1K0S A;  3JCM c;  4AFQ C;  3CCR A;  5A0G A;  1ZUK A;  2F5K A;  3QYH B;  3CCL T;  1QVG A;  3H0F A;  2KY9 A;  3WXM B;  2LTO A;  4DEY A;  1B3Q A;  1QVP A;  1GBR A;  4XK8 E;  1I1J A;  1M30 A;  1VYV A;  3OBY A;  2DER A;  1ACM B;  4M75 C;  4HCC A;  3CCS Q;  2L2P A;  3VS4 A;  4JRP A;  1U5S A;  2XK0 A;  5CKF A;  3EFO A;  3JCM d;  2OTJ A;  4M77 B;  3TQ7 P;  2KMT A;  2V1Q A;  3VYH B;  1WHL A;  4M77 F;  4WTO B;  3MJX A;  1YJW Q;  1EZZ B;  3CCM A;  1BB9 A;  1V29 B;  3VRY A;  4K11 A;  1K73 R;  3PFS A;  4IIO A;  1VQO A;  3MO8 A;  3I55 T;  5J39 A;  2QDL A;  1GRI A;  2EFI A;  2A0F B;  4MDW A;  2LX9 A;  2YLB A;  1X2Q A;  1S72 Q;  2DIG A;  2K5L A;  1R8O B;  1S1N A;  1SPK A;  4VUB A;  5FLX E;  4LN2 A;  5FU7 C;  5GAO q;  1QVF P;  2GTJ A;  1ZA1 B;  3G4S T;  3EGX A;  1HSQ A;  3ZEH A;  4NOY A;  3L2V A;  1FMW A;  1M3C A;  3V7S A;  2X51 A;  2DJQ A;  3JCM Q;  4PJN A;  1AVZ C;  4Z89 A;  3EGU A;  5KYY A;  4FSS A;  2K4Y A;  2C0O A;  2O4X A;  2LT4 A;  4M75 A;  1GCP A;  3E1S A;  4LUD A;  2DX1 A;  3EG0 A;  1YCS B;  4RTT A;  3OW2 S;  1M90 C;  3CEY A;  2BE9 B;  4L59 A;  1VQ8 Q;  4JLG A;  3ZBD A;  1VQM Q;  3PVL A;  1VQP A;  4CC4 B;  1I81 A;  1XNI A;  4M7D C;  2GF7 A;  4RG8 A;  2RHZ A;  2DYI A;  2AHJ B;  1E7D A;  3RKX A;  1VQ4 Q;  4JJN K;  2A36 A;  3MKD A;  2JZ2 A;  1SRL A;  1A8V A;  3M4Y A;  2JM9 A;  1ZSZ B;  2VGM A;  3PNW C;  3UA6 A;  5GAO m;  1NEG A;  1X69 A;  4ANJ A;  3UWN A;  3OYF A;  1PRM C;  4Y28 E;  3UAT A;  2DTI A;  2QXF A;  3L0O A;  2HSP A;  4HA8 A;  4ZN3 A;  3QPH A;  4N4G A;  3UF4 A;  4C8Q F;  5CAI A;  4JRK A;  4GLK A;  4A4H A;  2VVK A;  1YJN T;  4M7D A;  1A62 A;  4RTW A;  1PM3 A;  3OW2 A;  3H6Z A;  1T3L A;  4DBQ A;  3VUZ A;  5LJ5 f;  3T9N A;  4PFZ A;  3LGF A;  2AT1 B;  3OQ5 A;  1H8K A;  1R0B G;  2AKL A;  3A8G B;  5LJ3 f;  5ECA A;  4OMN A;  2ODC I;  3E19 A;  4R56 A;  2E65 A;  1TUD A;  1VYU A;  8ATC B;  4L5G A;  5FRM A;  3JCM e;  1YHQ A;  1QQJ A;  2DTO A;  2F2V A;  3CCQ A;  2CKK A;  3GF5 A;  2OTL A;  3FRN A;  2YUO A;  3VUB A;  2RJF A;  5I22 A;  3OYB A;  2CSI A;  2COY A;  4IUU A;  3HFN A;  4LDV A;  3NTK A;  1M8V A;  4JS5 A;  4E7K A;  1Q82 C;  2D6F A;  1I4K 1;  4FIB A;  3M0T A;  1PCX A;  3OMG A;  7AT1 B;  2RJD A;  4B9X A;  2VAS A;  1MMD A;  3BDU A;  2IG0 A;  3L2Z A;  1Y96 B;  3MEW A;  4BD3 A;  2MPX C;  1QVF A;  1R77 A;  4M78 D;  4OMP A;  2WSC E;  3JCM g;  2V8J A;  2LX7 A;  4KH1 B;  3OYY A;  4PJO C;  2O9V A;  4ORZ A;  2X35 A;  1D0X A;  4C0D C;  2E12 A;  1M90 R;  3CCR Q;  3EH1 A;  2OX7 A;  2SEM A;  3LGL A;  1KSW A;  2XU8 A;  3THK A;  1GXI E;  3N5B B;  3PIP A;  2L0A A;  2E1H A;  2LVM A;  1Y71 A;  3QBY A;  4ESR A;  3CD6 T;  2QGF B;  2O2O A;  3PVQ A;  2FZG B;  3JCM P;  2Z0W A;  3M0P A;  2VB6 A;  2ZCF B;  4M78 E;  4FSX A;  4EPC A;  2CZ0 B;  3QG1 A;  3CC2 A;  2ENM A;  1E7O A;  1ZX6 A;  2P84 A;  2EKH A;  2Y4Y A;  4F7U E;  2LCS A;  3VS2 A;  3H8Z A;  1K8A C;  3CCM Q;  4MMK A;  1NJI C;  3CCU T;  1UGQ B;  2CP0 A;  1F1B B;  1IHW A;  3HSB A;  3R6O A;  3SWN C;  1M2V B;  4F14 A;  3CCE T;  3M53 A;  2DRK A;  2LT1 A;  2CDT A;  4PJO A;  4KUD K;  2ZGW A;  1Q7Y U;  4EMK C;  5CQX A;  3JAM E;  4C5H A;  1G3W A;  1WJS A;  3L2Q A;  5KYN A;  1B34 B;  2PVD B;  4V2S A;  3R6N A;  1KD1 R;  1WX6 A;  1N9S A;  2D8H A;  3M57 A;  4AFU C;  1NLO C;  2DL7 A;  2EBP A;  2XG8 D;  2GFA A;  5GAO p;  3L2R A;  2DFU A;  2E5K A;  3GPL A;  4J6W A;  1OZ3 A;  5DY9 A;  1UG1 A;  1YIJ T;  2QEX T;  1PG5 B;  2W0Z A;  4AFS C;  1SEM A;  5I21 A;  2LJ0 A;  2CP6 A;  4ZGJ B;  2QA4 T;  3G1J A;  2CUD A;  4OVA A;  4OMO A;  1PHT A;  1SF9 A;  1ZLM A;  4B6M A;  3VV0 A;  3CBM A;  1LNX A;  4Z88 A;  1OX9 A;  3SWN A;  3G71 A;  3I9Q A;  1Y07 A;  3CMA A;  3NMZ C;  2JTF A;  4LDU A;  3I56 A;  3JV3 A;  2QGG A;  1RL2 A;  1VQK T;  1WJQ A;  4EMK A;  1G3T A;  4HCZ A;  4BY6 C;  4Y91 A;  3C0C A;  5EC7 A;  2QQS A;  4JZ4 A;  2QDY B;  1GJJ A;  3CC7 T;  4EIK A;  2DZ9 A;  4M78 G;  1VQN T;  2EPD A;  1X27 A;  1YJ9 A;  2MWP A;  1AOJ A;  5I2S A;  3CCV A;  2C0I A;  2RHX A;  3A1P A;  2WAC A;  4OML A;  1TS9 A;  5KYU B;  1VA7 A;  2XHC A;  3EG3 A;  2COZ A;  3CCS A;  4KRT A;  1OUL A;  2CRE A;  1D0Z A;  4L6V 5;  4PJL A;  5IH2 A;  2QQR A;  2KFV A;  5GAN 8;  1ZS9 A;  3REA B;  2RB6 A;  5KYX A;  1YJW A;  2V8I A;  3VYG A;  4PL6 A;  2KK4 A;  3GNF B;  4OP0 A;  1JRI A;  3A8O B;  2DEQ A;  2FB7 A;  2DIL A;  1SHG A;  1YN8 A;  2PNI A;  4FW1 A;  1SSF A;  1KQ2 A;  3QII A;  2H3J A;  1QCF A;  1VYT A;  1S72 A;  1VQL T;  4IUQ A;  2K79 A;  3FIF A;  2GCX A;  5IHN A;  3M55 A;  2QAZ A;  4N4H A;  1WJR A;  3OS2 A;  1YHQ Q;  4X1V A;  1W2B S;  3PMT A;  4PK4 A;  3RMQ A;  1WHM A;  1TU0 B;  1M5Q 1;  4OB2 B;  3JB9 G;  2PTK A;  1BBZ A;  2F1L A;  2BE7 D;  1YCY A;  1HYO A;  3M0S A;  2NUZ A;  3CXC P;  4M77 D;  4JJC A;  2EQU A;  4C92 E;  3GOX A;  2DXU A;  4M78 F;  1ARK A;  4E2F B;  5FRN A;  1V1C A;  1H3Z A;  4WF2 A;  5I2M A;  4QKU A;  3OYG A;  3LWH A;  3O8V A;  1VQ8 A;  2YRV A;  4FYV B;  4F7U F;  1ZQ1 A;  1ZBJ A;  2RF0 A;  2G80 A;  5GAN 7;  1G3S A;  5IN1 A;  2ABL A;  5KYW A;  1NYG A;  1I5L A;  4HXJ A;  1VQ4 A;  2A08 A;  4D6W A;  3QDR B;  1JU5 C;  2EVR A;  3V8J A;  4M77 E;  3DLM A;  2XDP A;  1NEB A;  1C0M A;  3OYA A;  3QSU A;  4Q5W A;  5IAY A;  1X6B A;  4RTV A;  4OMM A;  1QWE A;  4AMC A;  1M1K C;  1BIB A;  4XTZ A;  5DM7 R;  1UFF A;  4NL2 A;  2A37 A;  4E7L A;  4O5V A;  1K73 C;  1BI2 A;  2EYY A;  1VQ9 T;  2CZ7 B;  2DK4 A;  1C6V X;  1FX7 A;  2LC4 A;  4RTY A;  1CSK A;  1WHJ A;  5IHK A;  5GAO l;  3MPU B;  1OV3 A;  3V8L A;  4QW2 A;  2HBP A;  2RQW A;  1G8X A;  2MPH A;  4PJJ A;  3AT1 B;  1OI1 A;  3LYI A;  1U1S A;  4C5I A;  4BE1 A;  1OX8 A;  2MIO A;  1A63 A;  4QT7 A;  4C8Q C;  1KQ1 A;  4PFP A;  1QVG S;  4M7A G;  4LDY A;  4A53 A;  4JDS A;  4C92 G;  2B8A A;  4OB0 B;  2L3R A;  2LQW A;  1WLP B;  3OYJ A;  1QMC A;  1RI0 A;  2LQN A;  3RES A;  2MF2 A;  1IB8 A;  1JEQ A;  3MEA A;  3QJY A;  1NJI U;  2K3X A;  4PJM A;  1KC8 R;  4FU6 A;  1X75 C;  3FC3 A;  2EYX A;  2BZ8 A;  3MP8 A;  3CCJ A;  5KCO A;  2E70 A;  2O88 A;  2YDL A;  1NE8 A;  2DL3 A;  1N6A A;  4J5Y A;  2EQM A;  2A3L A;  2DM1 A;  1Q81 C;  3A8L B;  1R0C B;  4DBR A;  1GFC A;  5GMK i;  1VQ5 Q;  3DB3 A;  1JEG A;  4IUV A;  2EYZ A;  1QWF A;  2FPE A;  3G71 Q;  4IUP A;  2DEU A;  2BKD N;  4C8Q A;  1T0H A;  2BTT A;  4OMF B;  4X9D A;  3C94 A;  3EGD B;  2AKK A;  2JS0 A;  2ECZ A;  3MEV A;  3OYD A;  3C4S A;  4M7A B;  3CXC A;  2KT1 A;  2JNG A;  4C92 B;  8AT1 B;  1KHC A;  4M7A F;  2ZPI B;  4C92 F;  1YBY A;  1VQ7 T;  2DK3 A;  1VQ6 Q;  2RI5 A;  1YJ9 Q;  2E3I A;  2E6N A;  2HKN A;  2XKO C;  2KI7 A;  2ROL A;  1GFD A;  3CCV Q;  1LCK A;  1NPR A;  2HZY A;  4TVR A;  4B9W A;  5FU6 B;  1UDL A;  1PKT A;  2EGE A;  1Z9Q A;  1VQO T;  4X34 A;  3SFM A;  5AT1 B;  2ZPG B;  1M1K R;  5GMK m;  5D6X A;  2KRO A;  5CQY A;  2X4X A;  3AHU A;  3L42 A;  3CC4 T;  3EG1 A;  1X6O A;  1WA7 A;  3CC7 Q;  2KVQ G;  2MI6 A;  4LDW A;  5CKH A;  2DO3 A;  1UHF A;  4RG2 A;  3TU4 K;  3L2W A;  1KFZ A;  4J9E A;  4C5E A;  2FPD A;  1PNJ A;  1ZHI A;  1JJR A;  2J05 A;  4QVZ A;  5GAN h;  2O9S A;  3JCM b;  3M54 A;  1MNE A;  1KQS P;  2ZAE A;  3SB2 A;  1VQP T;  3EG9 A;  4BIT A;  2PZ1 A;  2DVE A;  4KUI A;  4KH0 B;  4A4E A;  2EGC A;  1OPK A;  4DBH A;  3VS6 A;  5CR2 A;  4R55 A;  2SRC A;  3JCM W;  1RAF B;  1D3B B;  4LUE A;  3OS1 A;  3NGP A;  3JCM X;  1UEC A;  3KUF A;  4F16 A;  3G4S A;  2LDM A;  3PMI A;  4F04 B;  3PTA A;  1UHC A;  2HQE A;  2KVU A;  5CVI A;  3S3N A;  3OBW A;  1V66 A;  2LRQ A;  5LJ3 e;  3S3O A;  1UGP B;  1FMV A;  4R0K A;  5GAN d;  5DLO A;  4HT8 A;  1MV0 B;  2BZY A;  2F69 A;  2C06 A;  2KYM A;  5GAM f;  1YFN A;  5A0L A;  3EFS A;  1EX4 A;  2LZ6 B;  3JCM V;  1Q81 R;  1WHG A;  4Z8A A;  2QNC A;  1YP5 A;  2RQT A;  4HT9 A;  5CKB A;  2LJ3 A;  3RBB B;  4BUG A;  1IGU A;  2QQB A;  4RTZ A;  4D8K A;  2K6D A;  3X24 B;  1A0N B;  5M9O A;  1RAD B;  1IO6 A;  2YWW A;  1VUB A;  3X28 B;  1PD0 A;  2VWF A;  2MWO A;  1QVF S;  1KD1 C;  4CC3 A;  2RA2 A;  2ZPB B;  4RKU E;  1YWO A;  4DA4 A;  2R5A A;  2EWN A;  2M9U A;  2ZPF B;  2JUF A;  3E9F A;  4HVU A;  2C0T A;  5CKE A;  2GGR A;  3U23 A;  3P8H A;  2G6F X;  2DD4 A;  1NLP C;  2COW A;  2OTL T;  1I07 A;  2EIF A;  5GAN 6;  2BUD A;  1X01 A;  2LJ1 A;  2V8K A;  1U3O A;  2MOX A;  2YRC A;  1AWO A;  1YNS A;  2LQK A;  2D0N A;  2QNF A;  4O6J A;  4GBQ A;  1MV3 A;  2LC3 A;  4M75 G;  1UGV A;  2MMP A;  1QKX A;  4HKE A;  2H8H A;  2JW4 A;  3TSZ A;  3CPW P;  2NUT A;  4MML A;  2RK1 A;  2RO0 A;  1SHF A;  3VKI A;  2L3S A;  3EFO B;  4MZM A;  3X25 B;  3CCJ Q;  2HBW A;  1N9R A;  3OYK A;  1RAI B;  2K2V A;  2FZK B;  3OB9 A;  2MK5 A;  1YIT T;  1AEY A;  2J6F A;  2KSS A;  1M27 C;  2E6Z A;  3VS7 A;  1RAG B;  4M78 C;  1N27 A;  1M1G A;  3JB9 J;  4GLM A;  3HHT B;  2RNA A;  1N8R C;  2HAX A;  2PVO B;  1D1B A;  3EGX B;  3JB9 H;  4E7J A;  1K9M C;  1BYM A;  1U06 A;  3P8B B;  3OYM A;  4BAC A;  1KQS A;  2FZC B;  5IXB A;  4FW2 A;  1HXD A;  2FVU A;  3C95 A;  3MCA B;  1TSF A;  4OGC A;  2KEA A;  2DIQ A;  2M1H A;  5KYY B;  4XTY A;  2O4X B;  1M1F A;  4M75 B;  4XTW A;  2FEI A;  3CC2 T;  3SEM A;  1WHK A;  3URG A;  2GFU A;  3S6W A;  4M75 F;  3JCM f;  5GAN e;  4M7D G;  4J9C A;  1WPY A;  2P0Q A;  1AWW A;  2E64 A;  5CCA A;  3SHW A;  3SDZ A;  2HD0 A;  5KCH A;  2D1X A;  2JTE A;  1SKU B;  3TSW A;  2CZ6 B;  1H1J S;  5J26 A;  3ME9 A;  3H0I A;  2RNN A;  4A63 B;  2VXF A;  2B86 A;  2IVW A;  3CCL Q;  1TTH B;  5FU7 B;  5KE2 A;  1C1A A;  1H9E A;  3JB9 D;  1AT1 B;  4F7U A;  1EFN A;  3G7Z A;  2HKQ B;  2KW9 A;  1IGQ A;  2P0P A;  5IXF A;  2M0O A;  3H0H A;  1WXT A;  3RIR A;  4FM4 B;  1JJ2 P;  1ABO A;  4MDX A;  3X26 B;  4LDX A;  1GBQ A;  4KT0 E;  2KVE A;  1W4S A;  1E7L A;  4XTU A;  1PD1 A;  3LX7 A;  3OSV A;  4AT1 B;  3LWI A;  4RUG A;  3P8D A;  2P4T A;  2NWM A;  5GAN g;  2ZZD A;  4N4I A;  1LVK A;  3CCU A;  1MMA A;  2K5I A;  3CC4 Q;  4M7D B;  1N5Z A;  2J6K A;  1NBE B;  2X4J A;  3I55 Q;  3CCE A;  4M7D F;  2JTM A;  3CMA T;  5CO7 A;  2LCC A;  3I56 T;  2WQG A;  1WNL A;  1WIE A;  2DRM A;  1VQ5 A;  4X9C A;  3JCM J;  2GQI A;  3G4S Q;  4BDZ A;  1D0Y A;  5GAN 3;  2M16 A;  5GAN j;  2EKO A;  2DL8 A;  2QTV A;  1Q86 C;  1M90 U;  4A54 A;  3LH5 A;  2JVV A;  1TUC A;  2JJ9 A;  1Z9Z A;  4FT2 A;  5GAN 5;  4FL6 A;  3QKJ A;  2DYB A;  3CPW A;  2E3H A;  2VUB A;  1YIJ A;  2QEX A;  2W10 A;  3I5R A;  4DBF A;  3CCS T;  1VQ6 A;  4ZNX A;  2K57 A;  4P5N A;  2HQH A;  4RTX A;  3BE3 A;  4DOW A;  2KT8 A;  1PRL C;  1YI2 T;  2DBM A;  1D09 B;  2QAS A;  4WCI A;  3NFC A;  1N8R R;  5D6W A;  2NUP A;  4IUT A;  4BI4 A;  1JBM A;  1K9M R;  2D0Q B;  1WXB A;  4JLI A;  1VQK A;  5C6S A;  1JXM A;  2JMC A;  2DPP B;  1KC8 C;  4PNO A;  1RAB B;  4M7A D;  4C0F A;  4LNP A;  2RQU A;  4C92 D;  4CRI A;  2K3B A;  2K5F A;  1JJ2 S;  3QWX X;  4PLI A;  4PJO G;  3QXE B;  3CC7 A;  1UGS B;  2KYB A;  2CP5 A;  1VQN A;  2RHI A;  4E47 A;  3FLG A;  1OZ2 A;  4JPB W;  1B07 A;  2RN8 A;  1K0X A;  1JEI A;  4HVW A;  2QI2 A;  2AZV A;  4ELZ C;  3OSS C;  1P92 A;  2RH2 A;  4M77 C;  5GMK l;  1UUE A;  1MUZ A;  4DQ2 A;  3QUI A;  4LE9 A;  2V1R A;  1H92 A;  4M7A E;  1HK9 A;  1YJN Q;  1VQM T;  3HKS A;  3KFV A;  4IUR A;  2X3X D;  3OYL A;  1BCO A;  1QKW A;  2L5Q A;  2KRM A;  1G2B A;  3RKW A;  2M51 A;  4II1 A;  5L8R E;  1EN7 A;  5GMK e;  1H9F A;  1VQ4 T;  3X20 B;  3UPU A;  2RJE A;  1IZ6 A;  2FPF A;  4J8O A;  1KJW A;  4A4F A;  1VQL A;  2WSF E;  1LJO A;  2NLU A;  3LW5 E;  2OAW A;  1T0J A;  2RQR A;  3F70 A;  4RMO A;  2WSE E;  3ZFJ A;  2I0N A;  1NM7 A;  3HRT A;  3RUX A;  1K1Z A;  4PJO B;  4C0D B;  1MGQ A;  3KBG A;  1Q82 U;  4PJO F;  2YHT A;  4BB7 A;  1JJ2 A;  3H9N A;  2HCK A;  1CKA A;  3KXT A;  4OMQ A;  4M77 A;  1T3S A;  4BI3 A;  2G3R A;  2CGH A;  1HD3 A;  4NS5 A;  2EJF A;  4KBM B;  2RI2 A;  1ZUY A;  3JB9 F;  2MCN A;  3FDR A;  3QO3 A;  1YIT Q;  4FYY B;  1WI7 A;  2FYK A;  1M8M A;  2FL7 A;  5LJ5 h;  3G6E T;  3MHX A;  3PIO A;  1Q86 R;  2L3P A;  4KGX B;  2O31 A;  2L89 A;  3BDL A;  1ZSZ C;  5LJ3 h;  3VS0 A;  2QYZ A;  1BI0 A;  2ED0 A;  4OF1 A;  2RM4 A;  4C0G A;  3SWN B;  2RNO A;  5GAM d;  3RDV A;  1KK7 A;  2RPN A;  1NPP A;  2PQW A;  4DEX A;  3L1A A;  2L8D A;  4J9B A;  4Y92 A;  3CXC S;  4EMK B;  1WQ7 A;  4E7Z A;  2XD0 A;  5CIU A;  1WHH A;  1QP3 A;  3CME T;  1ZBX A;  3CD6 Q;  1VQ9 A;  3E2U A;  6AT1 B;  2PU9 B;  1M3B A;  4AG1 C;  4LD6 A;  3O5Z A;  3OY9 A;  1U8R A;  1K8A U;  2P4R A;  2KE9 A;  1M9S A;  4J9D A;  4CC7 A;  1W6X A;  1M4Z A;  1RLP C;  5LJ5 d;  2L3Q A;  1WQW A;  2ODG C;  4J9F A;  5LJ3 d;  3UDC A;  3CCU Q;  3L2U A;  3NTI A;  1ZSZ A;  2PUK B;  2CP2 A;  2RD1 A;  4XAX B;  5KYX B;  3CCE Q;  1E6G A;  1H3H A;  2RHU A;  1JB0 E;  4CI0 C;  1PSF A;  2HSE B;  5GAO r;  1AZG B;  4C0Z A;  3CCR T;  1IRE B;  4BY6 B;  3PGG A;  1YNZ A;  1RAH B;  4Z02 A;  1FWZ A;  1QCN A;  3RNJ A;  1QCO A;  3GLX A;  1O9S A;  2DE0 X; 
#chains in the Genus database with same CATH homology
 2PVG B;  3R6O A;  3SWN C;  3TCJ A;  5M9O A;  3CCE T;  3OA6 A;  3M53 A;  2LT1 A;  4FT4 A;  4PJO A;  4KUD K;  1VUB A;  4N0A A;  1XOV A;  2A7Y A;  2EQK A;  2MAM A;  2ZGW A;  1PSE A;  3X28 B;  3A8H B;  4ELY C;  4F7U B;  5HY6 A;  5GAM h;  4EMK C;  3A5Z B;  2MWO A;  5CQX A;  3JAM E;  1KD1 C;  1QVF S;  4C5H A;  1G3W A;  2RA2 A;  2VC8 A;  2ZPB B;  1WJS A;  2OAU A;  3FJP A;  3PT9 A;  4RKU E;  2XDD A;  2R5A A;  3UT1 A;  5DLQ E;  3L2Q A;  4DA4 A;  5AYF A;  2EWN A;  2M9U A;  2ZPF B;  2JUF A;  3E9F A;  5CKE A;  1B34 B;  2PVD B;  1VQM A;  3J81 E;  4XTX A;  4V2S A;  3P8H A;  3M4G A;  4ZTJ A;  2DD4 A;  1N9S A;  3HPW A;  1TH7 A;  3CCM T;  4ZTF A;  2OTL T;  3M57 A;  2EIF A;  5GAN 6;  2BUD A;  5IT9 E;  3V8K A;  1X01 A;  3OYI A;  2V8K A;  2XG8 D;  5CK9 A;  2GFA A;  5GAO p;  3L2R A;  2QTX A;  3GPL A;  4J6W A;  1BKB A;  1OZ3 A;  5DY9 A;  3EAE A;  2LQK A;  4UC4 A;  1UB4 A;  2RI3 A;  2EJ9 A;  1NZ9 A;  1YIJ T;  1UGR B;  4O6J A;  2QEX T;  1N8R U;  3E9G A;  1VIF A;  5I21 A;  4ZGJ B;  2LNV A;  3MEU A;  4M75 G;  2QA4 T;  3S3M A;  3CCL A;  2KAF A;  1K9M U;  3M56 A;  4KUL A;  3BW1 A;  2Y4X A;  4OVA A;  1VQ7 A;  2MMP A;  3CBO A;  4HKE A;  4M75 D;  1DJ7 B;  3DKM A;  3VV0 A;  5C0M A;  5GAO n;  3CBM A;  1LNX A;  1H64 1;  4MML A;  1Q7Y C;  3SWN A;  2RK1 A;  2RO0 A;  1FXX A;  3VKI A;  3G71 A;  1W2B A;  3X25 B;  3NTH A;  4MZM A;  3J7A F;  1Y07 A;  3CMA A;  1N9R A;  1KC8 U;  2JTF A;  3V7C A;  4LDU A;  3I56 A;  4HCB A;  3OS5 A;  4A4K A;  3OYK A;  5GAM e;  1RL2 A;  1VQK T;  2ZPH B;  1WJQ A;  3M58 A;  2K2V A;  3OYE A;  4EMK A;  3A8M B;  3HFO A;  1G3T A;  3OB9 A;  4HCZ A;  4BY6 C;  2DXT A;  1YIT T;  1Y96 A;  2DXC A;  3QZ5 B;  4Y91 A;  2KSS A;  5GMK j;  2QQS A;  2QDY B;  5LL6 S;  3RKY A;  4ZN1 A;  3CC7 T;  4DOV A;  1XQH A;  5CKD A;  2KDS A;  2CYZ B;  2DZ9 A;  2E6Z A;  4M78 G;  4M78 C;  1VQN T;  3DB4 A;  4GY5 A;  1N27 A;  1M1G A;  2E10 A;  2E41 A;  3JB9 J;  4M75 E;  3HHT B;  1YJ9 A;  2DD5 A;  2MWP A;  1N8R C;  4E7H A;  2HAX A;  1D3B A;  3JB9 I;  3G6E A;  2PVO B;  2XIC A;  4J6Y A;  5I2S A;  2RHX A;  3LH0 A;  3I55 A;  2WAC A;  3CCV A;  3M5A A;  4PLL A;  3CCJ T;  3JB9 H;  4E7J A;  2XHC A;  1K9M C;  3P8B B;  3OYM A;  1BYM A;  2BIV A;  4BAC A;  1KQS A;  3CCS A;  3RER A;  1HXD A;  1KHI A;  2FVU A;  4C8Q G;  3C95 A;  3MCA B;  4L6V 5;  3EFR A;  4OGC A;  2DIQ A;  2QQR A;  2M1H A;  2HNI A;  5J3B A;  5LJ5 e;  4ATO A;  2ZPE B;  2EYQ A;  5GAN 8;  5GAN 2;  4C8Q D;  4XTY A;  2O4X B;  1M1F A;  4XU2 A;  4M75 B;  4XTW A;  3CC2 T;  3URG A;  2RB6 A;  3V7R A;  4QVD A;  1U1T A;  2DTH A;  2V8I A;  2GFU A;  3S6W A;  3VYG A;  4PL6 A;  2KK4 A;  1YJW A;  3GNF B;  4OP0 A;  4M75 F;  1JRI A;  4QQ6 A;  3A8O B;  3JCM f;  3CME A;  5KH6 A;  2DEQ A;  2FB7 A;  3FEO A;  1BI3 A;  5GAN e;  4QVC A;  3J80 E;  1VIE A;  4M7D G;  1WPY A;  2P0Q A;  1SSF A;  1KQ2 A;  5GAM g;  3QII A;  2H3J A;  2E64 A;  1VQL T;  2HQX A;  3INZ A;  4MZT A;  1S72 A;  4IUQ A;  3FIF A;  4M7D D;  2GCX A;  3RMS A;  2R58 A;  5CCA A;  5EG2 A;  3M55 A;  2LQ8 A;  4N4H A;  1WJR A;  4OB1 B;  3SDZ A;  4OB3 B;  3OS2 A;  2HD0 A;  5KCH A;  1W2B S;  3PMT A;  2EJG A;  3RMQ A;  2CZ6 B;  4MZP A;  5J26 A;  1M5Q 1;  4M77 G;  3ME9 A;  2FHD A;  4OB2 B;  3JB9 G;  1KG1 A;  4C8Q E;  1YCY A;  4C5G A;  4IKF A;  2VXF A;  2IVW A;  4M77 D;  3M9Q A;  5FU7 B;  5KE2 A;  1UEB A;  3JB9 D;  3JCM h;  4C92 E;  2EQU A;  3OMC A;  1M1K U;  3GOX A;  2DXU A;  2GQV A;  4M78 F;  4F7U A;  2VXE A;  5FRN A;  3Q1J A;  5A0D A;  3G7Z A;  5GAM j;  1H3Z A;  2QQ9 A;  2P0P A;  4WF2 A;  5I2M A;  2VGN A;  4J83 A;  3OYG A;  1B34 A;  3LWH A;  2K3Y A;  3O8V A;  3VU3 C;  4EMG A;  5LJ5 g;  2M0O A;  1K73 U;  2YRV A;  1VQ8 A;  4F7U F;  4M7D E;  1YHQ T;  1Q86 U;  3RIR A;  4FM4 B;  1ZQ1 A;  4C8Q B;  3OYC A;  4MDX A;  3X26 B;  3OYH A;  3GIB A;  4LDX A;  4PKC C;  5GAN 7;  1G3S A;  4KT0 E;  1G5V A;  2LCL A;  1W4S A;  5IN1 A;  5LJ3 g;  3JCM c;  3CCQ T;  4XTU A;  3BFM A;  3CCR A;  1KQS S;  3LX7 A;  3OSV A;  5A0G A;  3LWI A;  1I5L A;  2F5K A;  3QYH B;  4D6W A;  1VQ4 A;  3QDR B;  3CCL T;  1QVG A;  3V8J A;  3HRU A;  2KY9 A;  2P4T A;  3P8D A;  3WXM B;  2ZZD A;  5GAN g;  2LTO A;  4M77 E;  3DLM A;  3GP8 A;  4N4I A;  2XDP A;  4RCB A;  1QVP A;  3CCU A;  2K5I A;  4M7D B;  4XK8 E;  3OYA A;  3QSU A;  4Q5W A;  2Y90 A;  3BY7 A;  2X4J A;  3CCE A;  3OBY A;  5IAY A;  4M7D F;  2JTM A;  5LJ5 j;  3CMA T;  4M75 C;  5CO7 A;  2LCC A;  2F5T X;  1YJN A;  3I56 T;  1M1K C;  4HCC A;  1WNL A;  1BIB A;  4JRP A;  4XTZ A;  1VQ5 A;  2XK0 A;  4X9C A;  5CKF A;  5LJ3 j;  3JCM J;  5DM7 R;  3HSB A;  3JCM d;  2OTJ A;  1AHJ B;  4BDZ A;  4NL2 A;  4M77 B;  3QJ6 A;  5GAN 3;  2M16 A;  2KMT A;  4XU3 A;  4E7L A;  4O5V A;  3VYH B;  1K73 C;  4M77 F;  5GAN j;  2EKO A;  1Q86 C;  1BI2 A;  3CCM A;  1M90 U;  4A54 A;  4XTV A;  1VQ9 T;  1V29 B;  2JVV A;  4XU1 A;  3TEE A;  2DZC A;  1WGS A;  2CZ7 B;  5D6Y A;  4FT2 A;  2VYT A;  5GAN 5;  4FL6 A;  3PFS A;  1VQO A;  3QKJ A;  1FX7 A;  3MO8 A;  3I55 T;  2LC4 A;  4ME7 A;  5J39 A;  3QYG B;  2EFI A;  4MDW A;  2LX9 A;  2YLB A;  3CPW A;  2VUB A;  1YIJ A;  2QEX A;  2DIG A;  2K5L A;  5GAO l;  1R8O B;  3CCS T;  4J7I A;  1VQ6 A;  3MP6 A;  4VUB A;  3V8L A;  5FLX E;  2K57 A;  2DJZ A;  5FU7 C;  5GAO q;  4P5N A;  3G4S T;  3QHS A;  4QW2 A;  2HBP A;  3JRZ A;  3WVD B;  3ZEH A;  4DOW A;  4JUV A;  4NOY A;  3L2V A;  2DAQ A;  1YI2 T;  4XQ3 A;  1OI1 A;  3V7S A;  3LYI A;  3JCM Q;  1U1S A;  3NFC A;  4C5I A;  4BE1 A;  1Q81 U;  1BIA A;  5D6W A;  4JRQ A;  2K4Y A;  2O4X A;  4IUT A;  3C12 A;  1KQ1 A;  4C8Q C;  5GMK h;  2LT4 A;  4M75 A;  4BI4 A;  1Q7Y U;  1JBM A;  1QVG S;  3E1S A;  4ZGE B;  2D0Q B;  4LDY A;  3M59 A;  4M7A G;  4A53 A;  4JDS A;  4JLI A;  4C92 G;  5C6S A;  1VQK A;  2B8A A;  4OB0 B;  2L3R A;  3CC4 A;  2DPP B;  1KC8 C;  4PNO A;  3OYJ A;  3OW2 S;  4C0F A;  4RCC A;  4M7A D;  1RI0 A;  3RES A;  2I2L A;  4C92 D;  1YIT A;  3CEY A;  4L59 A;  1M90 C;  4CRI A;  2MF2 A;  4JLG A;  2JN0 A;  3MEA A;  2K5F A;  3ZBD A;  1JJ2 S;  3QJY A;  4PLI A;  1VQP A;  4PJO G;  2K3X A;  3QXE B;  3CC7 A;  1UGS B;  1NJI U;  1I81 A;  1XNI A;  3FB9 A;  4M7D C;  2GF7 A;  4FU6 A;  1X75 C;  4RG8 A;  3FC3 A;  1VQN A;  2RHZ A;  2AHJ B;  4PJO D;  2RHI A;  3RKX A;  4E47 A;  3FLG A;  1OZ2 A;  3HP9 A;  2E5Q A;  4JJN K;  3MP8 A;  2JZ2 A;  2QI2 A;  5GAN 4;  3CCJ A;  2RJC A;  4ELZ C;  3OSS C;  1P92 A;  2E70 A;  5KCO A;  3M4Y A;  1NE8 A;  2EAY A;  4M78 A;  1N6A A;  1QP2 A;  2RH2 A;  2EQM A;  4J5Y A;  4M77 C;  5GMK l;  2A3L A;  4DQ2 A;  2VGM A;  4YTL A;  3PNW C;  3QUI A;  1Q81 C;  4M7A E;  1HK9 A;  5GAO m;  3A8L B;  5HKC A;  1VQM T;  5GMK i;  3HKS A;  4IUR A;  3DB3 A;  3UWN A;  4IUV A;  3OYF A;  3OYL A;  3CPW S;  2L5Q A;  4Y28 E;  3GNG A;  3LLR A;  3CD6 A;  4IUP A;  3RKW A;  2DTI A;  2BKD N;  2QXF A;  4C8Q A;  4II1 A;  5L8R E;  5GMK e;  1VQ4 T;  4PJO E;  3X20 B;  4HA8 A;  4OMF B;  4ZN3 A;  3UPU A;  2RJE A;  1IZ6 A;  4X9D A;  3C94 A;  4J8O A;  5HK0 A;  1Y7X A;  4E7I A;  4A4F A;  1OYX A;  3MEV A;  3QPH A;  2WSF E;  1VQL A;  3OYD A;  3C4S A;  4N4G A;  4M7A B;  3CXC A;  3DLL A;  1O75 A;  4C8Q F;  1LOJ A;  1LJO A;  2NLU A;  2JNG A;  2QQA A;  3HRS A;  3LW5 E;  4C92 B;  1KHC A;  1MHN A;  2VV5 A;  2ZPI B;  3ER0 A;  4M7A F;  3VJP A;  5CAI A;  4JRK A;  4GLK A;  3F70 A;  4A4H A;  4C92 F;  1YBY A;  4JS4 A;  4RMO A;  2KQW A;  2WSE E;  1YJN T;  4BE0 A;  3ZFJ A;  1VQ7 T;  4M7D A;  2EQJ A;  3RUX A;  2DK3 A;  3HRT A;  4BI8 B;  2RI5 A;  3CPF A;  3OW2 A;  1VQ5 T;  3X24 B;  4PJO B;  3H6Z A;  4C0D B;  2E6N A;  2XKO C;  1MGQ A;  3KBG A;  3VUZ A;  3G71 T;  3CBP A;  4BDY A;  1Q82 U;  5LJ5 f;  4PJO F;  2JOY A;  2YHT A;  3T9N A;  4BB7 A;  1JJ2 A;  3LGF A;  3OQ5 A;  1NPR A;  2CZ1 B;  2R57 A;  4TVR A;  3SD4 A;  5FRO A;  3KXT A;  4B9W A;  3A8G B;  5FU6 B;  4M77 A;  2X4W A;  5LJ3 f;  4BI3 A;  2G3R A;  3E19 A;  4R56 A;  2E65 A;  2CGH A;  4L5G A;  5FRM A;  4NS5 A;  3JSC A;  4X34 A;  2EJF A;  3SFM A;  3JCM e;  4KBM B;  5GAN f;  1VQO T;  1YHQ A;  2RI2 A;  2ZPG B;  5GMK m;  2DTO A;  5D6X A;  5CQY A;  2X4X A;  3TRE A;  3AHU A;  3FDR A;  3QO3 A;  3JB9 F;  4J7F A;  3CCQ A;  1VQ6 T;  2CKK A;  3L42 A;  3GF5 A;  2OTL A;  2FYK A;  3FRN A;  3VUB A;  5A2Q E;  2FL7 A;  2RK2 A;  3CC4 T;  2RJF A;  1X6O A;  1YJ9 T;  5LJ5 h;  3G6E T;  3CCV T;  2KVQ G;  2MI6 A;  3HL8 A;  3MHX A;  2DO3 A;  4LDW A;  5CKH A;  3PIO A;  3OYB A;  4IUU A;  4RG2 A;  3HFN A;  3L2W A;  3TU4 K;  2L89 A;  2O01 E;  4C5E A;  4LDV A;  3BDL A;  4NL3 A;  2X4Y A;  3NTK A;  5LJ3 h;  1ZHI A;  1M8V A;  1XTD A;  4JRI A;  2XI9 A;  2XID A;  1BI0 A;  4QVZ A;  2QA4 A;  4OF1 A;  2RM4 A;  4JS5 A;  4C0G A;  3QZ9 B;  3SWN B;  4EDU A;  4ZGD B;  5GAM d;  4E7K A;  5GAN h;  1Q82 C;  2D6F A;  1I4K 1;  1NPP A;  4FIB A;  3JCM b;  2XDB A;  3OMG A;  4OGE A;  2RJD A;  2PQW A;  2CS7 A;  4B9X A;  3L1A A;  2L8D A;  3M54 A;  1YJW T;  1I8F A;  1G3Y A;  3CXC S;  4EMK B;  1WQ7 A;  2XD0 A;  5CIU A;  3SB2 A;  3BDU A;  2DXB A;  1QP3 A;  3CME T;  2IG0 A;  1VQP T;  3L2Z A;  1Y96 B;  1ZBX A;  3MEW A;  4BD3 A;  4M7A C;  2DVE A;  4KUI A;  1QVF A;  4C92 C;  3OYN A;  1VQ9 A;  4A4E A;  4EMH A;  1S72 T;  2PU9 B;  4LD9 K;  5CR2 A;  4M78 D;  4LD6 A;  4R55 A;  2WSC E;  3JCM g;  2V8J A;  3JCM W;  3OY9 A;  1EIF A;  1U8R A;  1K8A U;  4F7U G;  1D3B B;  2YLC A;  3OS1 A;  3OYY A;  3WVE B;  1M9S A;  3JCM X;  4PJO C;  5KE3 A;  4N0A C;  3KUF A;  1M4Z A;  2X35 A;  4C0D C;  2E12 A;  5LJ5 d;  3G4S A;  2D9T A;  2LDM A;  3PMI A;  3PTA A;  2P0K A;  3LGL A;  2OTJ T;  2HQE A;  4XU0 A;  1WQW A;  2XU8 A;  5CVI A;  4A4G A;  1YI2 A;  2DKG A;  1GXI E;  3S3N A;  5FU6 C;  5LJ3 d;  3OBW A;  3UDC A;  2LRQ A;  3NTI A;  3L2U A;  3N5B B;  1KD1 U;  5LJ3 e;  2PUK B;  3PIP A;  2E1H A;  2LVM A;  1Y71 A;  2RD1 A;  1UGP B;  3MET A;  3QBY A;  3S3O A;  3CD6 T;  4XAX B;  3MP1 A;  5GAN d;  3JCM P;  2RHU A;  5DLO A;  4HT8 A;  1JB0 E;  2ZCF B;  1VQ8 T;  4CI0 C;  4M78 E;  1PSF A;  4FSX A;  2F69 A;  2C06 A;  4EPC A;  2CZ0 B;  5GAO r;  2PUO B;  4BE2 A;  3QG1 A;  3CC2 A;  5GAM f;  5A0L A;  3EFS A;  2RHY A;  3JCM V;  4C0Z A;  3CCR T;  2Y4Y A;  4F7U E;  4J6X A;  1IRE B;  4BY6 B;  3PGG A;  4HT9 A;  1BI1 A;  5CKB A;  4M7A A;  4Z02 A;  3H8Z A;  1FWZ A;  2R5M A;  4QQG A;  1QW1 A;  1K8A C;  4C92 A;  4MMK A;  1NJI C;  3CCU T;  1UGQ B;  3OS0 A;  4BUG A;  2QQB A;  3GLX A;  3ASK A;  5HK3 A;  1O9S A;  4M78 B;  4QQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...